Any and all devices such as plates, barricades, K -rails and notices shall be continuously maintained for pedestrian and vehicle safety. No curb lanes shall be closed during non -working days of the week. Appropriate advance warning signs shall be continuously maintained as needed during the project. All such devices, warning signs and interruptions of normal vehicle lanes, parking lanes and pedestrian walkways shall be shown on the Traffic Control Plan for advance approval by the Agency.
SECTION 601 – TEMPORARY TRAFFIC CONTROL FOR CONSTRUCTION AND
MAINTENANCE WORK ZONES
601-1 GENERAL.
The following is added this this subsection of the Standard Specifications:
At least one twelve -foot-wide traffic lane shall be provided for each direction of travel on all arterial streets at all times except as permitted by the Engineer. With previous authorization from the City, the Contractor can provide one traffic lane on a single direction on residential streets, during construction hours.
Clearances from traffic lanes shall be five feet to the edge of any excavation and two feet to the face of any curb, pole, barricade, delineator, or other vertical obstruction.
Any striped roadway shall be delineated by the Contractor with temporary raised reflective markers when it is to be left un-striped overnight.
Street closures will not be allowed except as specifically permitted by the Engineer.
601-2 TEMPORARY TRAFFIC CONTROL PLAN (TCP)
601-2.1 General
The following is added this this subsection of the Standard Specifications:
At the Pre -Construction meeting, the Contractor shall submit to the Engineer a detailed traffic control plan per section 601 of the Standard Specifications and construction sequencing for the project. The plan shall include drawings as necessary to clearly outline how traffic flow and pedestrian walkways will be handled during the course of construction and where detour and advance notice signs will be posted.
Traffic control plan shall be approved in writing by the City Engineer prior to construction starts. The plan shall be prepared per latest edition of California Manual on Traffic Control Devices (CA-MUTCD).
Traffic lane transitions shall not be sharper than a taper of thirty to one.
Temporary striping will not be allowed unless specifically permitted by the Engineer. The Contractor shall prepare any plans that may be required for temporary striping to the satisfaction of the Engineer. In no event will temporary striping be allowed to remain on finish pavement surfaces.
In no case shall traffic be diverted from the existing traveled way without prior approval of the City Engineer.
The contractor shall include in his Traffic Control Plan use of lighted message boards to notify traffic of project and any changes in vehicle or pedestrian travel routes.
If the Contractor shall fail to provide and install any of the signs or traffic control devices ordered by the Engineer, the Engineer may either stop the work or cause such signs or traffic control devices to be placed by others and charge the cost therefor against the Contractor and deduct same from the next progress payment.
601-2.2 Payment
Payment for provisions under section 601 of the Standard Specifications shall be considered included under the bid item for traffic control. No separate payment will be authorized.
FORD PARK EAST RESTROOM
“SUNSHINE BUILDING” DEMOLITION
FY 2025-2026
IN THE CITY OF BELL GARDENS
DEMOLITION SPECIFICATIONS
All Bid Items shall be in accordance with the Greenbook Standard Plans and Specifications for Public Works Construction (SPPWC & SSPWC), Latest Edition including supplements, State of California (Caltrans) Standard Plans and Specifications, Latest Edition, and the Special Provisions and General Conditions of these specifications.
PART 1 – GENERAL
1.1 DESCRIPTION
A. Scope:
1. CONTRACTOR shall provide all labor, materials, equipment and incidentals as specified and required for demolition, removal and disposal.
2. Included, but not limited to, are demolition and removals of existing materials, equipment, as shown and specified, and to connect same with existing work in an approved manner. Demolition includes structural concrete, foundations, walls, doors, windows, structural steel, metals, roofs, masonry, attachments, appurtenances, piping, electrical and mechanical equipment, paving, curbs, walks, fencing, , brush, rubbish, scrap, and similar existing facilities. The CONTRACTOR shall also be responsible for the removal of hazardous materials including asbestos and lead based paint as specified in these specifications.
3. Demolition and removals which may be specified under other Sections shall conform to requirements of this Section.
A. Demolition Procedures: Submit to the City Engineer for approval proposed methods, equipment, and operating sequences.
B. Demolition Schedule: The CONTRACTOR shall submit a schedule to the Engineer which indicates the proposed sequence of demolition.
1.3 JOB CONDITIONS
A. Review of Existing Conditions: By submitting a Bid, the CONTRACTOR acknowledges that all existing conditions have been reviewed and the CONTRACTOR is familiar with the nature, extent, and quantity of the demolition work to be performed.
B. Protection:
1. Perform all demolition and removal work to prevent damage or injury to structures, occupants thereof and adjacent features which might result from falling debris or other causes, and so as not to interfere with the use, and free and safe passage to and from adjacent structures.
2. Closing or obstructing of roadways, sidewalks, and passageways adjacent to the Work by the placement or storage of materials will not be permitted, and all operations shall be conducted with a minimum interference to traffic on these ways.
3. CONTRACTOR shall repair damage caused by CONTRACTOR to facilities to remain at CONTRACTOR’s expense or to any property belonging to the CITY ENGINEER or occupants of the facilities.
4. Streets, roads, adjacent property and other works and structures shall be protected throughout the entire project. CONTRACTOR shall return to original condition damaged facilities caused by the CONTRACTOR’s operations at the CONTRACTOR’s expense.
C. Scheduling:
CONTRACTOR shall carry out operations so as to avoid interference with CITY’s operations and work in the existing facilities.
D. Notification:
At least ten (10) days prior to commencement of a demolition or removal in a particular area, the CONTRACTOR shall notify the City Engineer in writing of a proposed schedule. The CONTRACTOR shall schedule a meeting with the Engineer to review existing conditions, review the demolition schedules, and confirm specific items to be salvaged. Do not start removals without the permission of the City Engineer in writing.
E. Explosives:
Blasting will not be permitted.
EXECUTION
2.1 GENERAL
A. CONTRACTOR shall divert, crush and salvage all asphalt, aggregate base and concrete. These materials shall be deposited in the staging area. All materials and equipment not to be salvaged shall be removed from existing work, shall be disposed of by the CONTRACTOR.
B. CONTRACTOR shall dispose of all demolition materials, equipment, debris, shrubs, brush, masonry, metals, rubbish, scrap, fences, and all other items off the site and in conformance with all existing applicable laws and regulations.
The CONTRACTOR shall protect all trees in place , with the exceptions of the ones specifically marked to be removed.
C. Pollution Controls: Use water sprinkling, temporary enclosures, and other suitable methods to limit the amount of dust and dirt and debris caused by demolition operations. Comply with governing regulations pertaining to environmental protection.
1. Do not use water when it may create hazardous or objectionable conditions such as ice, flooding, and pollution. All water, silt and sediment shall be kept out of the City’s storm drain system.
2. Clean adjacent structures, facilities, and improvements of dust, dirt, and debris caused by demolition operations. Return adjacent areas to conditions existing prior to the start of the work.
2.2 BUILDING DEMOLITION
A. Remove structural framing members and lower to ground by means of hoists, derricks, or other suitable methods.
B. Break up and remove foundations and slabs-on-grade and deposit in staging area.
C. Locate equipment used for demolition and remove demolished materials, so as not to impose excessive loads on supporting walls, floors or framing.
D. Wall mounted equipment, piping, and appurtenances mounted to walls to be removed shall also be removed.
2.3 STRUCTURAL REMOVALS
A. All concrete, brick, tile, masonry walls, concrete block, roofing materials, reinforcement, structural or miscellaneous metals, plaster, wire mesh and other items contained in or upon the structure that are designated for demolition shall be diverted or taken from the site.
2.4 MECHANICAL REMOVALS
A. Mechanical removals shall consist of dismantling and removing of existing piping, pumps, motors, boilers, tanks, water heaters, sinks, faucets, mechanical equipment and other appurtenances as specified or required for the completion of the demolition.
B. Existing process, water, chemical, gas, fuel, oil and other piping shall be removed.
C. Other underground piping like the existing sewer line, gas line, and water line shall be removed per the demolition plans within 5’ of building.
D. All drain waste and vent piping shall be removed within 5’ of building.
E. For all mechanical equipment to be removed with hydraulic controls, CONTRACTOR must ensure that the system pressure for the hydropneumatic system is relieved and that the piping system is drained prior to demolition.
ELECTRICAL REMOVALS
A. Electrical removals shall consist of the removal of existing control panels, motors, conduits and wires, panel boards, lighting fixtures, and miscellaneous electrical equipment.
B. Motors shall be disconnected and removed.
C. Conduits and wire shall be removed whenever an individual piece of equipment or a group of equipment is removed. All associated power and control, conduits and wire (which is no longer in use) shall be removed. All wires in abandoned conduits shall be removed or salvaged.
D. Wiring in any underground duct system shall be removed. All such wiring shall be salvaged or removed. CONTRACTOR shall verify the function of all wiring before disconnecting and removing it.
E. Direct-burial cable shall be removed within five feet of the building.
F. Panel boards and control panels shall be removed and disposed.
G. Lighting fixtures shall be removed and disposed.
2.6 PIPE, UTILITY AND CONDUIT REMOVALS
A. Removal of Buried Piping: Remove all buried piping, concrete cradles, encasements and piling encountered during excavation within five feet of the building.
B. Removal of Existing Cable: CONTRACTOR shall remove all existing cable within five feet of the building.
C. All explosive or hazardous gas or liquid lines shall be purged and made safe prior to removal, demolition, relocation, or modification.
2.7 PAVING, CURB AND GUTTER REMOVALS
A. At limit of demolition where removal of existing asphalt pavement is required for construction, the existing pavement shall be saw -cut in a straight line to a minimum depth of 2 inches. Replacement of paving not designated to be removed shall be done in accordance with Division 2, Site Work, of these Specifications.
B. At limit of demolition where removal of existing concrete pavement, sidewalk, curb or gutter is required for construction, the demolition shall in general, be to the nearest construction joint. Saw cutting shall be required when the line of removal is not an existing construction joint, so that the surface contact between the new and existing concrete will be a straight line. The minimum depth of the saw cut shall be 2 inches.
C. All curb, gutter, driveway, and sidewalk shall be removed as shown on the plans diverted, crush and stockpiled on site. All costs associated with removal of sidewalks, curbs, gutters, and driveways including all labor, equipment, and materials, shall be included in the Bid Item for Clearing and Grubbing and no additional compensation will be made therefor.
D. All concrete foundations, concrete slabs, and concrete flooring shall be removed diverted, crush and stockpiled on site as plans. Payment for removal of concrete foundations, flooring, and slabs shall be included in the Bid Item for Building Demolition and no additional compensation will be made therefor.
2.8 CLEARING AND GRUBBING
A. Remove obstructions, trees, shrubs, grass, and other vegetation to permit installation of new construction. Removal includes digging out stumps and obstructions and grubbing roots.
1. Do not remove trees, shrubs, and other vegetation indicated to remain or to be relocated.
2. Cut minor roots and branches of trees indicated to remain in a clean and careful manner where such roots and branches obstruct installation of new construction.
3. Completely remove stumps, roots, obstructions, and debris extending to a depth of 18 inches below exposed sub-grade.
4. Use only hand methods for grubbing within drip line of remaining trees.
B. Fill depressions caused by clearing and grubbing operations with satisfactory soil material, unless further excavation or earthwork is indicated.
1. Place fill material in horizontal layers not exceeding 8 -inch (200 -mm) loose depth, and compact each layer to a density equal to adjacent original ground.
2.9 CLEAN-UP
B. CONTRACTOR shall remove from the site all debris resulting from the demolition operations as it accumulates. Debris shall be disposed of at a legal point of disposal that is permitted to accept the type of waste being removed. Upon completion of the Work, all materials, equipment, waste, and debris of every sort shall be removed and premises shall be left clean, neat, and orderly.
CONTRACTOR shall submit proof to the CITY ENGINEER of compliance with this requirement. Proof shall be in the form of dump tickets or bills of sale or other documentation or pre-authorization by the CITY ENGINEER.
HAZARDOUS WASTE MANAGEMENT AND DISPOSAL IN CONNECTION WITH THE
DEMOLITION OF THE SITE BUILDINGS
PART 1 – GENERAL
1.1 BACKGROUND
A. The Site consists one Restroom Building. The City of Bell Gardens is proposing to redevelop the restroom
The Site is currently developed within the existing John Anson Ford Community Park.
1.2 SUMMARY
A. This project shall involve the demolition of Site buildings (see demolition drawings and specifications) and the proper management of wastes generated during the process. Some of the wastes generated during the process may be hazardous or contain hazardous components. These hazardous wastes, as defined by all federal, state, and local regulations, shall be properly managed as specified in Part 3 of this document. Proper management of hazardous wastes includes but is not limited to sampling, testing, packaging, labeling, storage, containment, and disposal.
1.3 HEALTH AND SAFETY REQUIREMENTS
A. As indicated in Section 1.1 above, elevated concentrations of various hazardous materials in the immediate vicinity of the Site buildings proposed to be demolished. the potential that demolition contractors may be exposed to elevated concentrations of hazardous materials and in general accordance OSHA requirements must be followed.
1. Because there is a potential that demolition workers may be exposed to elevated concentrations of CoCs, until a Negative Exposure Assessment
(NEA) is established by the demolition contractors industrial hygienist (discussed below), the demolition contractor shall require Site workers to wear proper Personal Protective Equipment (PPE) including, but not limited to an appropriate respirator, Tyvek suit, protective gloves, hard hats, steel toed boots, etc. In addition, a hand washing station shall be provided.
2. Personnel monitoring (air monitoring and analysis for organochlorine pesticides) must be conducted on demolition workers until laboratory analysis indicates that the workers are not exposed to concentrations of organochlorine pesticides above the Permissible Exposure Levels (PELs) established by OSHA. PELs for the organochlorine pesticides in the shallow soil in the immediate vicinity of the Site buildings include 1 mg/m3 for DDE and DDT, 0.25 mg/m3 for Dieldrin, and 0.5 mg/m3 for Toxaphene.
Although these are the CoCs known at the Site, the demolition contractor must compare all organochlorine concentrations reported from personal monitoring to their respective PELs.
3. Personnel monitoring and PPE can be discontinued when the demolition contractor’s industrial hygienist can demonstrate, through statistically reliable methods, that the workers are not being exposed to organochlorine pesticide concentration above the PELs.
4. It is the responsibility of the demolition contractor to decontaminate demolition equipment potentially contaminated with CoC’s using at a minimum a wash station with a gravel pad, prior to leaving the Site.
5. Based on the potential for exposure to elevated concentrations of organochlorine pesticides, the demolition contractor must comply with 29 CFR 1910.1200 (Hazard Communication Standard) and CCR Section 8.
As indicated in the above-referenced standards, the demolition contractor is responsible for implementing a Medical Monitoring Plan and Respiratory Protection Plan for pesticide residues in compliance with California and Federal OSHA requirements and good occupational medical practices.
6. In accordance with the Hazardous Communication Standard, the demolition contractor shall provide training for Site workers that complies with the standard. Training must include the specific health effects of exposure to organochlorine pesticides, respiratory protection, and PPE assessment. Evidence of training, medical monitoring, and respirator fit test shall be provided to the ENGINEER.
1.4 SUBMITTALS
A. Before Start of Work: Submit the following to the ENGINEER for review. Do not start work until these submittals are returned with the ENGINEER’S written approval indicating that the submittal is complete and acceptable.
1. Plan of Action outlining the procedures used for the identification, removal, testing, (if applicable) packaging, labeling, storage, containment, and disposal for each hazardous waste anticipated.
2. Name, address, phone number, company representative name, and EPA Generator Identification number for each company that shall be managing the transportation, treatment, storage, and/or disposal of the waste generated from this project.
3. Identify the disposal method, which shall be utilized for each type of waste generated.
4. Name, address, phone number, company representative name, and certification number for all state certified hazardous waste testing laboratories used to perform analytical testing. Include a list of the tests the laboratory is certified to perform under the laboratory’s state hazardous waste testing certification.
B. Weekly:
1. Hazardous Waste Log tracking all hazardous waste generated on site.
The Hazardous Waste Log shall be maintained on a daily basis and a copy of the log must be submitted to the ENGINEER on a weekly basis.
A copy of the week’s log shall be provided to the ENGINEER no later than the second working day of the following week. The daily Hazardous Waste Log shall contain the following:
a. The number used to identify each container of hazardous waste as specified in Part 3, Section 3.04 of this document.
b. The accumulation start date for each container of hazardous waste.
c. The intended disposal method for each container of hazardous waste
d. The disposal location where each container of hazardous waste will be shipped.
C. Ten Working Days Prior to Transportation Waste Off Site:
1. Submit to the ENGINEER a draft hazardous waste manifest which shall be used to ship each hazardous waste from the project site to the disposal location.
2. The ENGINEER shall return an approved completed manifest within three working days of receipt.
D. The Day the Waste is Transported Off Site:
1. Any changes to the manifest after it has been approved shall be cleared through the ENGINEER before the waste is transported offsite.
2. The ENGINEER shall sign the manifest as representing the generator at the time the hazardous waste is being removed from the site. Pre-signed manifests are not acceptable.
3. Two copies of the manifest shall be provided to the ENGINEER prior to the transporter leaving the site.
E. Contingency Plan:
Prepare a contingency plan for the release of hazardous materials or hazardous waste to the ground, air or water. A release is defined as any spilling, leaking,
pumping, pouring, emitting, emptying, discharging, dumping, or disposing into the environment. The contingency plan shall include the following:
a. Contacts (ENGINEER) which shall be notified when a release occurs including a specified time by which the notification shall be given to the ENGINEER.
b. Procedures for the identification of any unknown substances released.
c. Procedures for the containment, cleanup, storage, and disposal of the released material.
PART 2- PRODUCTS
2.1 EMPLOYEE TRAINING
Any contracted employee who manages hazardous waste shall be trained to ensure compliance with the regulations, and all contracted staff working at the job site shall be able to respond effectively to emergency situations including chemical spills (22 CCR66265.16).
2.2 WASTE CHARACTERIZATION
A hazardous waste determination shall be performed on all waste generated on site within 10 days of generation to determine if it meets hazardous waste criteria as specified in 22 CCR Division 4.5 or any other pertinent law or regulation. Substances requiring analytical testing shall be sampled and tested in accordance with Part 2, Section 2.08 of this document.
2.3 REMOVAL
A. All hazardous waste shall immediately upon generation be placed in an approved container as specified in Part 2, Section 2.4 of this document. No interim containers including but not limited to bags, transfer containers, buckets, or pails shall be acceptable.
B. Hazardous wastes or items and equipment containing hazardous wastes shall be removed and handled in such a way as to minimize the possibility of a release.
2.4 PRE-TRANSPORTATION REQUIREMENTS
A. Any packaging used to store and or transport hazardous waste off site such as a container, roll-off bin, tank or other device, shall comply with 49 CFR Parts 173, 178, 179 and be labeled and prepared for transportation in accordance with 22 CCR Article 3.
B. The hazardous waste label shall be affixed to the container and filled out when the first amount of hazardous waste is placed in the container. The label shall include the initial accumulation date, contents of the container, physical state and hazardous properties of the waste, and generator information.
C. The contractor shall use a numbering system to identify each hazardous waste container. Each hazardous waste container shall be marked with an identification number specific to that individual container. All markings shall be made in indelible ink no larger than 3 inches in height on the top of the container.
D. All additional pre -transportation labeling, marking, or placarding shall be conducted prior to transporting off site and in accordance with 22 CCR Chapter 12, Article 3.
E. All containers used to package hazardous waste shall be compatible with the waste (22 CCR 66265.172), maintained in good condition (22 CCR 66265.171), and kept closed unless adding or removing waste (22 CCR 66265.173).
F. Different waste types shall be stored in separate containers and incompatible wastes shall never be combined.
G. All containers and tanks of hazardous waste shall be managed in a way which minimizes the threat of fire, explosion, or any unplanned sudden or non -sudden release of hazardous waste to the air, soil, or surface water which could threaten human health or the environment (22 CCR66265.31). Management techniques include containment areas capable of holding the contents of largest container within the containment area.
H. The contractor shall perform inspection of their hazardous material and hazardous waste storage areas daily to ensure compliance with the regulations.
Any spills, leaks, damaged or unlabeled containers shall be immediately corrected once identified. All inspections must be documented and copies provided to the ENGINEER upon request.
I. Secondary containment shall be provided for all storage areas containing 55 gallons or more of hazardous material or a hazardous waste. The secondary containment area must be capable of holding the contents of the largest container plus ten percent of that volume.
2.5 ACCUMULATION TIME
Each container of hazardous waste shall be shipped offsite for disposal by a registered hazardous waste hauler within 40 days of the date of initial generation or by the end of the project, whichever comes first.
2.6 TRANSPORTATION REQUIREMENTS
A. The CONTRACTOR shall supply the ENGINEER with the EPA Generator Identification number for the work site. This number is site specific and shall only be used on hazardous waste disposal documentation for the appropriate site where the waste was generated.
B. A hazardous waste manifest shall be completed in accordance with 22 CCR Chapter 12, Article 2 for any shipment of hazardous waste leaving the work site.
C. The submission of each manifest to the ENGINEER shall be done as specified in these Specifications.
D. Only an ENGINEER pre -approved, licensed hazardous waste transportation company shall transport hazardous waste off site to a pre -approved disposal location in accordance with 22 CCR Chapter 13. Any contractor who allows the transportation or disposal of hazardous waste from a City site by an unauthorized vendor, upon conviction, shall be punished up to 3 years in prison and fined up to $100,000 per day (HSC 25163, 25189.5).
2.7 MANAGEMENT OF SPECIFIED WASTES
A. Hazardous Materials Containers:
All empty hazardous material containers shall be managed as specified in 22 CCR 66261.7 and outlined as follows:
a. Empty the entire contents of a hazardous material container.
i. If a liquid, pour or drain the contents from the container so that no hazardous material remains in the container when it is held in any orientation (e.g., inverted, tilted, etc).
ii. If not a liquid, remove the hazardous material by a physical method so that no more than a thin uniform film remains in the container.
b. The hazardous material that is removed from the container is used as a material or disposed of as a hazardous waste.
c. Mark each container with the date it was emptied. Manage the container within one year by one of the following methods:
i. Reclaim the scrap value of the container.
ii. Send the container off for reconditioning or re-manufacturing. iii. Send the container back to the manufacturer.
d. For containers 5 gallons capacity or less, once the container is empty, it may be disposed of to the regular trash.
e. Aerosol spray containers may be disposed of in the regular trash if the contents and propellant have been emptied to the maximum extent practical under normal use (i.e., the spray mechanism was not defective and thus allowed complete discharge of the contents and propellant.) f. A compressed gas cylinder is empty when the pressure in the container approaches atmospheric pressure.
B. Florescent Light Tubes
C. PCB Containing Florescent Light Ballasts
D. Oils Containing PCB’s:
1. All oils including oil in electrical equipment and or fixtures shall be identified by an experienced electrician to determine if the oil contains PCB’s prior to offsite removal. As necessary, identification includes sampling and analytical testing. The results of any assessment performed by an experienced electrician shall be provided to the ENGINEER within 1 working day of completion of the assessment.
2. Oils containing PCB’s shall be managed as hazardous waste as specified in these Specifications.
3. The facility designated for incinerating of oils containing PCB’s shall be pre-approved by the ENGINEER prior to waste being shipped offsite.
4. A hazardous waste manifest shall be completed prior to shipping the waste offsite with a completed copy provided to the ENGINEER the day the waste is shipped offsite.
5. Other specialty oils meeting the definition of “used oil” (as defined in HSC 25250.1) shall be managed as specified in these Specifications.
E. Sodium and Mercury Containing Light Bulbs:
All sodium and mercury containing light bulbs shall be considered hazardous waste and managed as specified in these Specifications unless a hazardous waste determination is performed indicating the waste to be non-hazardous.
a. The results of all waste determinations shall be approved by the ENGINEER prior to a hazardous or presumed hazardous waste being reclassified as non-hazardous.
F. Asbestos
1. Removal requirements in connection with materials containing asbestos are included in the following document:
• Asbestos Survey Report which was dated August 29, 2024.
G. Lead Paint
1. Removal requirements in connection with lead paint are included in the following document:
• Lead-Based Paint Survey Report which was dated August 29, 2024.
2.8 SAMPLING AND ANALYTICAL TESTING REQUIREMENTS
A. Each testing method shall be approved by the ENGINEER as appropriate for the sample being tested prior to having a certified laboratory conducting the test.
B. Representative samples shall be obtained for each waste to be tested with the sampling procedure pre-approved by the ENGINEER.
C. The ENGINEER shall be contacted prior to sampling, and if possible, be present to observe the sampling.
D. All containers (jars, bags, etc.) used for sampling shall be certified as pre- cleaned.
E. A copy of all analytical test results received by the contractor shall be provided to the ENGINEER within 1 working day of receipt from the certified testing laboratory.
2.9 HAZARDOUS MATERIALS AND HAZARDOUS WASTE SPILLS
A. All spills involving hazardous materials or hazardous waste shall be immediately reported to the ENGINEER.
B. All spills and any contaminated media (rags, absorbents, soil, etc.) shall be immediately cleaned up and handled as hazardous waste as specified in these Specifications unless a hazardous waste determination is performed indicating the waste to be non-hazardous.
C. A 304 Spill Report Form shall be completed and faxed to the ENGINEER for all spills of hazardous materials or hazardous wastes in quantities equal to or exceeding 5 gallons in quantity. Some spilled hazardous materials or hazardous wastes may require completion of a 304 Spill Report Form in quantities of less than 5 gallons. The ENGINEER shall determine if a 304 Spill Report Form is required for spills less than 5 gallons in quantity.
2.10 DISASSEMBLY
A. All devices including but not limited to equipment, fixtures, structures, storage tanks, fuel and chemical feed lines shall be disassembled in such a way as to
minimize the release of any hazardous materials or hazardous waste contained within the device.
B. Any hazardous materials or hazardous wastes encountered during disassembly shall be managed as specified in Part 2 of this document.
C. All equipment such as piping, chemical feed or distribution lines, transformers, storage tanks, that has the potential to contain a hazardous substance shall be assumed to contain a hazardous substance and handled accordingly.
D. All piping, chemical feed or distribution lines, storage tanks, containers or storage devices which were used for storage or transfer of hazardous substances shall be properly decontaminated prior to disassembly. The ENGINEER shall be consulted prior to and after disassembly to ensure adequate levels of decontamination have been achieved.
E. Personal protective equipment appropriate to the level of protection required by the circumstance in which an employee is working shall be provided by the contractor to all the contractors employees. Personal protective equipment shall be provided to any employee before the employee enters a work area where hazardous materials or hazardous wastes may exist.
2.11 SUBMITTAL CHECKLIST
A. Before Start of Work:
2. General
Plan of Action
Contingency Plan
Waste Management Plan
Name, Address, Phone Number, and Company Contact for each disposal, salvage, recycling. And composting facility used.
2. Hazardous Waste Disposal and Laboratory Testing
Name, address, phone number, company contact, and
EPA Identification Number for each licensed hazardous waste hauler used
Name, address, phone number, company contact, and EPA
Identification Number for each TSDF used
Disposal method utilized for disposal of each waste stream (as specified in Part 2 of this document
Name, address, phone number, company contact, and certification number for each certified hazardous waste testing laboratory used A list of the tests each laboratory is certified to perform under the laboratory’s State certification
B. Weekly
1. Hazardous Waste Logs
Copies of daily hazardous waste logs
Disposal/Salvage/Recycling Tonnage Receipts
C. Periodically During Work:
1. General
304 Spill Report Forms (as necessary)
2. Hazardous Waste Disposal and Laboratory Testing
Draft manifests for approval (submitted prior to disposal) Two copies of each hazardous waste manifest
Copies of all other disposal receipts (i.e., Bills of Lading) Copies of analytical test data
Copies of daily hazardous waste logs (submitted weekly)
LEAD BASED PAINT ABATEMENT
PART 1 – GENERAL
1.1 DESCRIPTION
A. Scope:
1. CONTRACTOR shall provide Storm Water Pollution Prevention Plan, tools, and materials for the removal and disposal of all lead based paint materials from structures designated for demolition in accordance with applicable federal, state, and local governmental regulations and the Contract Documents.
2. A preliminary lead based paint survey has been performed and is described in the hazardous materials study done by Air America Testing.
The purpose of this survey was to identify lead based paint containing materials scheduled for demolition. The level of detail of the survey was limited to readily accessible suspect lead based paint containing material, and was designed to confirm the presence or absence of lead based paint in locations other than those that were sampled. This study and the information contained therein is provided for information only. It shall be the CONTRACTOR’S responsibility to visit this project site prior to commencing the Work, and to assess the exact amounts and types of lead based paint containing materials present, as well as the physical difficulty involved in its complete removal.
3. Worker protection and monitoring, containment system specifications, environmental protection, and waste handling and disposal.
4. Method of lead based paint removal shall be accomplished by using shrouded, HEPA vacuum -assisted power tools which have been recognized by OSHA (pursuant to 1926.62), or otherwise demonstrated to generate lead emissions exposures below 30 µg/m3 when used in accordance with manufacturer’s written recommendations.
5. Method of lead based paint removal from plaster, stucco surfaces, wood cabinets or other surfaces subject to potential damage by the use of power tools shall include chemical stripping compounds and hand scraping. Chemical stripping compounds shall be fee of methylene chloride and of lowest possible level of chemical toxicity possible consistent with lead based paint system to be removed.
6. Submit a detailed job-specific plan of the procedures proposed for use in complying with the requirements of this specification. Include in the plan the location, size, layout and details of the Work Areas and worker decontamination facilities. Include the sequencing of abatement work, the interface of trades involved in the performance of work, methods to be used to assure the safety of building occupants and visitors to the site, disposal plan including location of approved disposal site, and a detailed description of the methods to be employed to control pollution. Method of removal to reduce lead dust generation in the Work Area, and packaging of removed lead paint, dust and debris. Describe the methods that will be used to comply with OSHA requirements including submission of exposure monitoring to demonstrate adequacy of respiratory and worker protection equipment selected. The plan must be approved by the Engineer prior to commencement of work.
7. Prior to commencement of work, examine areas in which work will be performed with the Engineer. Prepare a listing of damage to structure, surfaces, equipment or of surrounding properties which could be misconstrued as damage resulting from the work. Photograph or videotape existing conditions as necessary to document conditions.
Submit to Engineer prior to starting work.
8. The disturbance or dislocation of lead-based painted materials may cause lead dust to be released into the atmosphere, thereby creating a potential health hazard to workers and area occupants. Apprise all workers, supervisory personnel, subcontractors and consultants who will be at the job site of the seriousness of the hazard and of proper work procedures which must be followed.
9. Where in the performance of the work, workers, supervisory personnel, subcontractors, or consultants may encounter, disturb, or otherwise function in the immediate vicinity of any identified lead -based paint, take appropriate continuous measures as necessary to protect all building occupants from the potential hazard of exposure to lead dust. Such measures shall include the procedures and methods described herein, and in compliance with regulations and guidelines of applicable federal, state and local agencies.
10. If the Engineer or Project Monitor presents a written or verbal stop work order, or if stop work levels as set forth in the Contract Documents are exceeded immediately and automatically stop all work. Do not recommence work until authorized in writing by the Engineer.
B. Coordination
1. CONTRACTOR shall coordinate and schedule all phases of the Work with the ENGINEER, other contractors, material suppliers, and other parties as necessary to ensure the proper and timely execution of the Work.
2. Five days prior to the proposed start of Work at each separate location, CONTRACTOR shall request permission from ENGINEER to commence Work. No Work may proceed until written approval is provided by the ENGINEER.
3. In the event that the ENGINEER must enter the lead control area for reasons unrelated to the supervision of inspection of Work, CONTRACTOR shall stop lead based paint removal Work and immediately clean-up any loose debris, so as to permit safe entry by the
ENGINEER. Lead paint removal Work shall not proceed until the ENGINEER has left the control area.
4. Meetings: CONTRACTOR shall schedule, organize and hold all meetings with appropriate parties as scheduled and as directed by the ENGINEER to accomplish the Work. Meetings shall include the pre -construction meeting specified herein and other meetings as necessary or as requested by the OWNER and ENGINEER. Minutes of all meetings shall be recorded by the CONTRACTOR and copies shall be provided by CONTRACTOR to all parties attending.
C. General:
1. The CONTRACTOR shall seal off all critical areas such as doors, windows, openings and any other areas that may allow the escape of contaminants to the outside air. He shall erect decontamination facilities and provide all on-site personnel with all required protective equipment to ensure their health and safety.
2. The CONTRACTOR shall conduct comprehensive personal air monitoring of his on -site personnel, and shall dispose all lead based paint wastes and debris in a safe and approved manner.
3. The CONTRACTOR shall have full responsibility and liability for compliance with all applicable federal, state, and local government regulations pertaining to work practices, hauling, disposal, and protection of workers, visitors to the site, and persons occupying areas adjacent to the site.
4. CONTRACTOR shall be cognizant of handling materials containing or contaminated with lead based paint which may be encountered during removal and encapsulation operations, and the incidental procedures and equipment required to protect workers and occupants of the equipment, building area, or both, from contact with airborne lead based paint dust.
5. The disturbance or dislocation of lead based paint containing materials may cause lead based paint dust to be released into a building’s atmosphere, thereby creating a potential health hazard to workmen and building occupants. The CONTRACTOR shall apprise all workers, supervisory personnel, subcontractors, and consultants may be at the job site of the seriousness of the hazard and of the proper work procedures that must be followed.
6. Where in the performance of the Work, workers, supervisory personnel, subcontractors, or consultants may encounter, disturb or otherwise function in the immediate vicinity of any identified lead based paint containing materials, the CONTRACTOR shall take appropriate continuous measures as necessary to protect all building occupants from the potential hazard of exposure to airborne lead based paint. Such measures shall include the procedures and methods described in these specifications, and compliance with regulations of applicable federal, state, and local government agencies.
7. CONTRACTOR shall be responsible for providing secure storage facilities.
D. INSURANCE:
1. The CONTRACTOR’S liability insurance in accordance to these Specifications shall specifically cover claims arising out of or relating to
lead based paint abatement. Liability coverage for lead based paint abatement, whether expressly set forth in the policy or added by endorsement, shall be on an occurrence basis, and the City of Bell Gardens will not consider coverage on a “claims made” basis.
2. The General Conditions shall apply and be incorporated into the liability coverage for lead based paint abatement; provided, however, that if any provision(s) is/are manifestly inconsistent with the broadest possible coverage for lead based paint abatement, then such provision(s) only shall not apply. Specifically, without in any way limiting the foregoing, the lead based paint abatement coverage shall be in the same limits (amounts) and include the same additional insured.
3. The CONTRACTOR shall provide liability coverage for lead based paint abatement, as specified in this Section, through insurers authorized to transact business in the State and which have a “A” Best’s rating and a Class VII or better financial size category according to the most current Best Company ratings, unless otherwise authorized by the OWNER.
4. The CONTRACTOR shall submit proof of coverage under the workmen’s compensation laws of the State and shall disclose to the California State Compensation Fund or private workmen’s compensation carrier, authorized to write such coverages, that the CONTRACTOR’s employees and others for whom the CONTRACTOR may be responsible will be engaged in lead based paint abatement activities.
5. If the CONTRACTOR subcontracts all or part of the lead based paint abatement specified in this Section, the subcontractor(s) shall have all of the coverage specified in the General Conditions and this Section. For liability coverage for lead based paint abatement, the CONTRACTOR and subcontractor(s) may satisfy this requirement by adding the subcontractor(s) as additional named insured(s) on the CONTRACTOR’s policy. However, the subcontractor(s) must comply separately with all other insurance requirements.
E. PERSONNEL
1. General Superintendent: Provide a full -time General Superintendent who is experience in administration and supervision of lead based paint abatement projects including work practices, protective measures for building and personnel, disposal procedures, etc. This person is the Contractor’s representative responsible for compliance with all applicable federal, state and local regulations and guidelines, particularly those relating to lead based paint and hazardous waste.
2. Foreman: Provide a Foreman to directly supervise and direct no more than 10 abatement workers. Each Foreman will act as the Competent Person as required by 8 CCR 1532.1 for the workers the foreman is directing. The Foreman has oversight authority over the workers and reports to the General Superintendent may fill the foreman’s position.
3. Experience and Training: The General Superintendent and foreman shall meet all the requirements as a Competent Person as required by OSHA 8 CCR 1532.1. They shall have completed training in Lead Paint Abatement Health and Safety for Supervisors and have obtained interim certification from the State Department of Health Services as a “supervisor”. They shall have experience with projects of similar type and size.
F. DAILY LOG:
Maintain a daily log documenting the dates and time of but not limited to, the following items. Provide one (1) copy of this log to the Engineer on a daily basis:
1. Meetings, purpose, attendees, brief discussion and significant decisions.
2. Visitations; authorized and unauthorized
3. Log of those entering and leaving Work Area including personnel, by name
4. Accidents
5. Log of the waste as accumulated
6. Special or unusual events, i.e., barrier breaching, equipment failures, accidents
7. Documentation of Contractor’s completion of the following:
a. Inspection of Work Area preparation prior to start of removal and daily thereafter.
b. Removal of any sheet plastic barriers
c. Any Contractor operation that will conceal the condition of lead based painted components or the substrate from which such materials have been removed.
d. Removal of waste materials from Work Area
e. All waste properly stored in approved and labeled containers f. Decontamination of equipment (list items)
8. List of subcontractors at the site
9. Count of personnel at the site
10. High and low temperatures, general weather conditions.
11. Stoppages, delays, shortages, losses
12. Meter readings and similar recordings
13. Emergency procedures
14. Orders and requests of governing authorities
15. Change Orders received, implemented
16. Services connected, disconnected
17. Equipment or system tests and start-ups
18. Partial & substantial completions authorized
G. SPECIAL REPORTS
A. General: Except as otherwise indicated, submit special reports directly to Engineer within one day of occurrence requiring special report and to others affected by occurrence.
B. Reporting Unusual Events: When an event of unusual and significant nature occurs at site, within 24 hours prepare and submit a written special report to the Engineer listing chain of events, persons participating, response by Contractor’s personnel, evaluation of results or effects, and similar pertinent information. When such events are known or predictable in advance, advise City in advance at earliest possible date.
C. Reporting Accidents: Prepare and submit written reports of significant accidents, at site and anywhere else work is in progress. Reports must be submitted to the Engineer within 24 hours after the accident occurs.
Record and document data and actions; comply with industry standards.
For this purpose, a significant accident is defined to include events where personal injury is sustained, or property loss of substance is sustained, where the event posed a significant threat of loss or personal injury, or
where an OSHA 200 Log is required. A copy of an OSHA 200 Log may be submitted for this purpose.
D. Report Discovered Conditions: When an unusual condition of the tanks or piping is discovered during the work (e.g., leaks, corrosion) prepare and submit a written special report to the Engineer indicating condition discovered.
H. CONTINGENCY PLAN:
A. Contingency Plan: Prepare a contingency plan for emergencies including fire, accident, power failure, hazardous substance releases, or any other event that may require modification or abridgement of decontamination or Work Area isolation procedures. Include in plan specific procedures for decontamination or Work Area isolation. Note that nothing in this specification should impede safe exiting or providing of adequate medical attention in the event of an emergency.
B. Post: At entrance of Work Area. Telephone numbers and locations of emergency services including but not limited to fire, ambulance, doctor, hospital, police, power company, telephone company.
C. Notify Engineer immediately of any releases of hazardous materials including chemical spills such as oil and fuels.
D. Contractor shall send notifications out to all property owners that are contiguous to the work site. Engineer shall review and approve the notification prior to being sent out.
I. CODES, REGULATIONS, AND STANDARDS:
1. General Applicability of Codes and Regulations, Guidelines and Standards: Except to the extent that more explicit or more stringent requirements are written directly into the contract documents, all applicable codes, regulations, guidelines and standards have the same force and effect (and are made a part of the contract documents by reference) as if copied directly into the contract documents, or as if published copies are bound herewith.
2. Contractor Responsibility: The Contractor shall assume full responsibility and liability for the compliance with all applicable federal, state, and local regulations pertaining to work practices, hauling, disposal, and protection or workers, visitors to the site, and persons occupying areas adjacent to the site. The Contractor is responsible for providing medical examinations and maintaining medical records of personnel as required by the applicable federal, state, and local regulations. The Contractor shall hold the City and Engineer harmless for failure to comply with any applicable work, hauling, disposal, safety, health or other regulations on the part of himself, his employees, or his subcontractors.
3. Federal Requirements which govern lead based paint abatement work or hauling and disposal of hazardous waste materials include but are not limited to the following:
a. OSHA: U.S. Department of Labor, Occupational Safety and Health Administration, (OSHA), including but not limited to:
29 CFR 1910.134 Respiratory Protection
29 CFR 1926.20 General safety and health provisions
29 CFR 1926.21 Safety training and education
29 CFR 1926.23 First Aid
29 CFR 1926.24 Fire Protection
29 CFR 1926.25 Housekeeping
29 CFR 1926.28 Personal protective equipment
29 CFR 1926.51(f) Washing facilities
29 CFR 1926.55 Gases, vapors, fumes, dusts, and mists
29 CFR 1926.56 Illumination
29 CFR 1926.57 Ventilation
29 CFR 1926.59 Hazard Communication Standard;
29 CFR 1926.62 Lead Construction Standard
29 CFR 1926.103 Respiratory Protection
29 CFR 1926.353 Ventilation: Welding, cutting or heating of metals of toxic significance
29 CFR 1926.300, Hand and power tools
301, 302
29 CFR 1926.451 Scaffolding
29 CFR 1926.500 Fall Protection
502, 503
b. DOT: U.S. Department of Transportation, including but not limited to:
49 CFR 171 through 179 Hazardous Substances
c. EPA: U.S. Environmental Protection Agency (EPA), including but not limited to:
40 CFR 260, 261, Resource Conservation and Recovery Act (RCRA)
262, 263 and 264
40 CFR 745 Lead Based Paint Activities:
Training, Certification, and Work Practice Requirements d. HUD: Department of Housing and Urban Development
24 CFR 35, 905 Lead Based Paint Hazard Elimination; Interim Rule 941, 965, and 968
4. California State Requirements which govern lead based paint abatement work or hauling and disposal of hazardous waste materials include but are not limited to
8 CCR 5144 Respiratory Protection
8 CCR 1509 General safety and health provisions
8 CCR 1510 Safety training and education
8 CCR 1512 First Aid
8 CCR 1513 Housekeeping
8 CCR 1514 Personal protective equipment
8 CCR 1527 Washing facilities
8 CCR 1528 Gases, vapors, fumes, dusts, and mists
8 CCR 1523 Illumination
8 CCR 1530 Ventilation
8 CCR 5194 Hazard Communication Standard
8 CCR 1532.1 Lead Construction Standard
8 CCR 1531 Respiratory protection
8 CCR 1530 Ventilation: Welding, cutting or heating of metals of toxic significance
8 CCR 1707 Hand and power tools
8 CCR 1637 Scaffolding & Fall Protection
117 CCR DIV 1 CH.8 Accreditation of Interim Certification of individuals engaged in lead related construction work
22 CCR Div 4.5 Management of Hazardous Waste
Health & Safety Code, Hazardous Waste Control
Law
Div 20, Chapter 6.5
5. Local Requirements: Abide by all local requirements which govern lead abatement work or hauling and disposal of hazardous waste materials.
6. Building Codes: Comply with applicable provision of state and/or local building and construction codes that govern any part of the work.
7. Model Codes: In the absence of an applicable adopted state or local building code which governs work involved in the lead abatement project, comply with the applicable provisions of the BOCA National Codes/1993 published by International Conference for Building Officials or the SBCCI Standard Codes published by Southern Building Code Congress International.
J. PERMITS
1. Permit: All hazardous waste is to be transported by an entity maintaining a current licensed State of California Hazardous Waste permit as required for transporting of waste materials to a disposal or incineration site.
2. Building Permit: Secure all necessary building and demolition permits as required by state and/or local building codes.
3. Air Pollution Control Permits: For required abrasive blasting equipment, generators, and other regulated equipment.
K. STANDARDS
1. Applicability of Standards: Except where the Contract Documents include more stringent requirements, applicable construction industry standards have the same force and effect as if bound or copied directly into the Contract Documents to the extent referenced. Such standards are made a part of the Contract Documents by reference.
2. Publication Dates: Comply with the standards in effect as of the date of the Contract Documents
3. Conflicting Requirements: Where compliance with 2 or more standards is specified and where the standards may establish different or conflicting requirements for minimum quantities or quality levels, refer requirements that are different but apparently equal and uncertainties to the Engineer for a decision before proceeding.
a. Minimum Quantity or Quality Levels: The quantity or quality level shown or specified shall be the minimum provided or performed.
The actual installation may comply exactly with the minimum quantity or quality specified, or it may exceed the minimum within reasonable limits. To comply with these requirements, indicated numeric values are minimum or maximum, as appropriate, for the context of the requirements. Refer uncertainties to the City Representative for a decision before proceeding.
4. Copies of Standards: Each entity engaged in construction on the Project is required to be familiar with industry standards applicable to its
construction activity. Copies of applicable standards are not bound with the Contract Documents.
a. Where copies of standards are needed to perform a required construction activity, the Contractor shall obtain copies directly from the publication source.
5. Abbreviations and Names: Trade association names and titles of general standards are frequently abbreviated. Where such acronyms or abbreviations are used in the Specification or other Contract Documents, they mean the recognized name of the trade association, standards - generating organization, authority having jurisdiction, or other entity applicable to the context of the text provision. Refer to the “Encyclopedia of Associations”, published by Gale Research Co., available in most libraries.
6. Abbreviations and Names: Trade association names and titles of general standards are frequently abbreviated. the following acronyms or abbreviations, as referenced in Contract Documents, are defined to mean the associated names. Names and addresses are subject to change and are believed, but not assured, to be accurate and up-to-date as of date of the Contract Documents.
ALA American Association for Laboratory Accreditation
656 Quince Orchard Road #300
Gaithersburg, MD 20878 (301) 670-1377
AIA The American Institute of Architects
New York Ave. NW
Washington, DC 20006 (202) 626-7300
AIHA American Industrial Hygiene Assoc.
2700 Prosperity Avenue, Ste. 250
Fairfax, VA 22031-4307 (703) 849-8888
ANSI American National Standards Institute
11 West 42nd St., 13th Floor
New York, NY 10036 (212) 642-4900
ASTM American Society for Testing and Materials
1916 Race St.
Philadelphia, PA 19103-1187 (215) 299-5400
GA Gypsum Association
810 First St. NE, Ste. 510
Washington, DC 20002 (202) 289-5440
IESNA Illuminating Engineering Society of North America 345 E. 47th St.
New York, NY 10017 (212) 705-7926
ML/SFA Metal Lath/Steel Framing Asso.
(A Division of the National Association
of Architectural Metal Manufacturers)
600 S. Federal St., Ste. 400
Chicago, IL 60605
(312) 922-6222
NEC National Electrical Code (from NFPA)
NEMA National Electrical Manufacturers Asso.
2101 L St., NW, Ste. 300
Washington, DC 20037
(202) 457-8400
NFPA National Fire Protection Asso.
One Batterymarch Park
P.O. Box 130140
(800) 344-3555
Ann Arbor, MI 48113-0140 (617) 770-3000
NSF National Sanitation Foundation
3475 Plymouth Road
P.O. Box 130140
(800) 344-3555
Ann Arbor, MI 48113-0140 (313) 769-8010
PDCA Painting and Decorating Contractors of America
3913 Old Lee Highway Ste. 33-B
Fairfax, VA 22030 (703) 359-0826
UL Underwriters Laboratories
333 Pfingsten Rd.
Northbrook, IL 60062 (708) 272-8800
Federal Government Agencies: Names and titles of federal government standard or Specification-producing agencies are often abbreviated. The following acronyms or abbreviations referenced in the Contract Documents indicate names of standard or Specification-producing agencies of the federal government. Names and addresses are subject to change and are believed, but are not assured, to be accurate and up-to-date as of the date of the Contract Documents.
CFR Code of Federal Regulations
(Available from the Government Printing Office)
N. Capitol St. between G and H St. NW
Washington, DC 20402 (202) 783-3238
(Material is usually first published in the “Federal
Register”)
CCR California Code of Regulations
(Available from Barclays Law Publishers)
400 Oyster Point Blvd (415) 244-6611
P.O. Box 3066
South San Francisco, CA 94080
CPSC Consumer Product Safety Commission
5401 Westbard Ave.
Bethesda, MD 20207 (800) 638-2772
DTSC Department of Toxic Substances Council
Region 4 (310) 590-4868
245 W. Broadway, Ste. 350
Long Beach, CA 90802
EPA Environmental Protection Agency
401 M St. SW
Washington, DC 20460 (202) 382-2090
HUD Department of Housing and Urban Development
Office of Lead-Based Paint Abatement and Poisoning
Prevention
Room B-133
451 7th St. SW
Washington, D.C. 20410 (202) 755-1805
MSHA Mine Safety and Health Administration
(U.S. Department of Commerce)
4015 Wilson Blvd
Arlington, VA 22203 (703) 235-1565
NIOSH National Institute of Occupational Safety and Health U.S. Dept. of Labor, Room N-3718
200 Constitution Ave., N.W.
Washington, D.C. 20210 (800) 35-NIOSH
NIST National Institute of Standards & Technology
(U.S. Department of Commerce)
Gaithersburg, MD 20899 (301) 975-2000
OSHA Occupational Safety and Health Administration
(U.S. Department of Labor)
200 Constitution Ave., NW
Washington, DC 20210 (202) 219-6091
L. MISCELLANEOUS SUBMITTALS
A. Material Safety Data Sheets: Acknowledge compilation of all the material safety data sheets for the products to be used at the job site.
B. Inspection and Test Reports: Classify each inspection and test report as being either “shop drawings” or “product date” depending on whether the report is specially prepared for the project, or a standard publication of workmanship control testing at the point of production. Process inspection and test reports accordingly.
C. Records of Actual Work: Furnish 4 copies of records of actual work, one of which will be returned for inclusion in the record documents as specified in Section “Project Closeout”.
D. Closeout Submittals: Refer to Section “Project Closeout” and to individual Sections of these specifications for specific submittal requirements of project closeout information.
ASBESTOS ABATEMENT AND ASBESTOS RELATED DISTURBANCE
PART 1 – GENERAL
1.1 SCOPE OF WORK
A. These specifications cover the handling and removal of the asbestos -containing materials (ACM), and lead -based paint (LBP) for the Bell Gardens Aquatics Center and Playground in Bell Gardens, California. Based on the results of Titan Environmental Solutions’ reports titled “Asbestos Survey Report” Project Number 125373, dated August 29, 2024.
1.2 SUMMARY
A. Related Requirements:
1. Section 02 83 33 – Lead Related Construction Work.
2. Division 01 - General Requirements.
3. U.S. Environmental Protection Agency Regulations for Asbestos (Title 40, Code of Federal Regulations, Part 61, Subparts A and B, and Part 763, Subpart E.)
4. Title 8, Article 4, California Code of Regulations Construction Industry Safety Orders, Section 1529 "Asbestos" or current revised California regulations.
1.3 DEFINITIONS AND ACRONYMS
A. Abatement – Procedures to control fiber release from asbestos -containing material (ACM) or asbestos -containing construction material (ACCM). Includes removal, encapsulation, enclosures, repair, demolition, and renovation activities but does not include asbestos-related disturbance.
A. AHERA - Asbestos Hazard Emergency Response Act, 40 CFR, Part 763, Subpart E, and subsequent amendments.
B. Air Filtration and Ventilation System - A portable exhaust system, equipped with HEPA filtration, and capable of maintaining a constant air flow into a regulated area from adjacent areas and exhausted outside the Regulated Area.
C. Amended Water - Water to which a surfactant (wetting agent) has been added.
D. ANSI - American National Standards Institute.
E. Asbestos - Means the asbestiform varieties of chrysotile (Serpentine); crocidolite (Riebecktite); amosite (cummingtonitegrunerite); anthophyllite; tremolite; and actinolite.
F. Asbestos-Containing Construction Material (ACCM) – Means any manufactured construction material which contains more than one tenth of one percent (0.1 percent) Asbestos by weight.
G. Asbestos-Containing Material (ACM) – Means any material containing more than one-percent (1 percent) Asbestos.
H. Asbestos-Containing Waste (Non -hazardous) – non-friable asbestos -containing material including, but not limited to, floor covering, roofing materials and cementitious materials requiring disposal.
I. Asbestos-Containing Waste (Hazardous) – friable asbestos-containing materials and asbestos contaminated objects and debris requiring disposal.
J. Asbestos Related Disturbance – is the drilling, coring, removal or similar disturbance of ACCM or ACM not to exceed three square feet in any one opening and not to disturb 100 square feet or greater cumulatively on any one project (contract).
K. ASTM - American Society for Testing and Materials.
L. Bulk Samples - Samples of building or other materials collected for analysis to determine the presence and quantities of asbestos.
M. CDCR – The California Department of Corrections and Rehabilitation, owner and operator of the project site, and CDCR’s designated representative.
N. Class I, II, III, and IV asbestos work has the meaning as defined in California Code of Regulations Title 8, Section 1529.
O. Clean Room - An uncontaminated area or room, which is a part of the worker Decontamination Enclosure System with provisions for storage of worker's street clothes and clean protective equipment.
P. Competent Person - Has the same meaning as defined in the California Code of Regulations Title 8, as it relates to, "Competent Person." Q. Controlled Disturbance – An activity by which a contractor disturbs an asbestos - containing material or an asbestos containing construction material using the work practices allowed for in this specification and in compliance with regulatory limitations.
R. Curtained Doorway – A device to allow ingress and egress from one room to another while permitting minimal air movement between the rooms, typically constructed by placing two overlapping sheets of plastic over an exit or temporarily framed doorway, securing each along the top of the doorway, securing the vertical edge of one sheet along one vertical side of the doorway and securing the vertical edge of the other sheet along the opposite vertical side of the doorway. Other effective designs may be submitted for review.
S. Decontamination – The process of eliminating Asbestos contamination from building surfaces, objects, and property, by cloths, mops, or other utensils dampened with water and disposed of afterwards as asbestos contaminated waste.
T. Decontamination Enclosure System – Means an enclosed area, which is adjacent and connected to the regulated area, consisting of an equipment room, shower room, and clean room for the decontamination of workers, materials, and equipment contaminated with Asbestos.
U. DOSH - Division of Occupational Safety & Health or Cal/OSHA.
V. DOT – Department of Transportation.
W. DTSC – Department of Toxic Substances Control.
X. Encapsulating Material - A liquid material applied to asbestos -containing materials which controls the possible release of asbestos fibers from the material either by creating a membrane over the surface (bridging agent) or by penetrating into the material and binding its components together (penetrating Encapsulating Material).
Y. Encapsulation - The application of an encapsulating material to asbestos -containing materials to prevent the release of asbestos fibers into the air.
Z. Equipment Room - A room within the worker decontamination enclosure system with provisions for storage of used clothing and equipment and for controlled transfer of materials and equipment into and out of the regulated area.
AA. Facility Component – Means any part of a facility including equipment.
BB. Fixed Object - A piece of equipment, furniture, or improvement in the Work area, which cannot be removed from the work area.
CC. Friable Asbestos – asbestos-containing material which, when dry, can be crumbled, pulverized or reduced to a powder by hand pressure or as defined by current regulations.
DD. Hazardous Waste - Means friable asbestos generated and prepared for waste disposal. Does not include non -friable material or materials containing one -percent or less of asbestos as determined by PLM and/or the point counting method.
EE. HEPA Filter - Means a filtering system capable of trapping and retaining at least
99.97 percent of mono-dispersed particles 0.3 microns in diameter or larger. For respirators this shall include NIOSH rated P-100 cartridges only.
FF. HEPA Vacuum - A vacuum system furnished with HEPA filtration.
GG. HVAC – Heating, Ventilation, and Air Conditioning System.
HH. Lockdown Coat – A material applied to surfaces where Asbestos has been completely removed. The manufacturer shall determine the concentration of this material.
II. Member – A component part of a structure complete in itself.
JJ. Movable Object - A portable piece of equipment or furniture in the Work area, which can be removed from the work area.
KK. NESHAP - National Emission Standards for Hazardous Air Pollutants (40 CFR Part 61).
LL. NIOSH - National Institute for Occupational Safety and Health.
MM. Outside Air - Air outside of buildings and structures.
NN. Owner Consultant (OC) - Refers to the firm, company or individual designated by the Owner.
OO. PCM - Phase Contrast Microscopy as it relates to clearance air, personnel exposure assessment, and ambient air monitoring. This procedure must follow the NIOSH Method 7400, Asbestos Fibers by PCM.
PP. PLM - Polarized Light Microscopy used for bulk sample analysis with dispersion staining for the determination and quantifying of Asbestos in Bulk Samples building materials.
QQ. Regulated Area - Designated rooms, spaces or areas of the Project in which asbestos abatement actions are to be performed or which may become contaminated as a result of abatement activities. A contained Work area is a work area, which has been sealed and furnished with a decontamination enclosure system. A non-contained work area is an isolated or controlled access work area, which has not been sealed or furnished with a decontamination enclosure system.
RR. Removal – Means operations where ACM and/or PACM is removed or stripped from structures or substrates including demolition.
SS. Renovation – Means the modifying of any existing structure, facility, or portion thereof.
TT. Shower Room - A room between the clean room and the equipment room in the worker decontamination enclosure system furnished with hot and cold running water controllable at the tap, and suitably arranged for complete showering during decontamination.
UU. San Joaquin Valley Air Pollution Control District
VV. Staging Area - Areas near the waste transfer airlock where containerized asbestos waste is temporarily placed prior to permanent removal from the work area.
WW. Surfactant - A chemical wetting agent added to water.
XX. TEM - Transmission Electron Microscopy as defined for asbestos clearance air monitoring within AHERA. This procedure must follow the NIOSH Method 7402, Asbestos Fibers by TEM.
YY. TSI - Thermal System Insulation as defined in AHERA.
ZZ. USEPA or EPA – United States Environmental Protection Agency.
AAA. Visible Emissions - Any emissions from a known or suspected asbestos-containing material that is visually discernible.
BBB. Waste Transfer Airlock - A decontamination system provided for transferring containerized waste from inside to outside of the work area.
1.4 POLICIES AND PROCEDURES
A. The California Department of Corrections and Rehabilitation (Owner) has a zero tolerance policy for uncontrolled asbestos releases during construction or Abatement Work. An Asbestos release requiring an emergency response is any uncontrolled release of Asbestos Containing Construction Materials. The Owner shall be immediately notified of such uncontrolled releases.
B. Pre-qualified asbestos abatement subcontractors are not permitted to subcontract any abatement work to a lower tier Subcontractor without the prior written approval of the Owner.
1.5 ROLES AND RESPONSIBILITIES
A. Roles and Functions:
1. Coordinate the work of this section directly with the Owner and/or Owner Consultant.
2. Work under this section shall be performed in strict accordance with applicable Federal, State, and Local regulations, standards, and codes governing asbestos abatement and any other work performed in conjunction with the asbestos abatement work.
3. The most recent edition of any relevant regulation, standard, document, or code is in effect. Where conflict among the requirements or with this Specification exists, the most stringent requirement shall be provided.
1.6 SITE SECURITY
A. The work area shall be restricted to authorized, trained, and protected personnel. A list of authorized personnel shall be established by the Owner Consultant prior to commencement of the work and posted at the entrance of the regulated area.
Authorized personnel accessing the work area shall be subject to the worksite’s gate clearance protocols.
B. Report to the Owner Consultant any unauthorized entry into the regulated area.
Following notification, a written report of the incident shall be provided to the Owner Consultant.
C. A logbook shall be maintained at the entrance of the regulated area. Persons entering the regulated area shall record their name, company affiliation, time in, and time out for each entry and exit.
D. Access to the contained area shall be through the worker decontamination enclosure system or other room established when worker decontamination enclosure system is not required. Other means of access shall be blocked or locked to prevent entry to or exit from the regulated area. The only exceptions are the waste pass -out airlock, which shall be sealed except during the removal of containerized asbestos waste from the work area, and emergency exits in case of fire or accident. Emergency exits shall be operable from inside the work area; however they shall be sealed with polyethylene sheeting and tape.
E. Unless otherwise specified, remove barriers upon completion of the work of this section. Repair and/or replace to original condition, damage resulting from installation, use, and removal of the barriers.
1.7 EMERGENCY PLANNING
A. Emergency planning and procedures shall be developed, submitted, reviewed, and agreed to by the Owner prior to the commencement of abatement work.
B. Emergency procedures shall be provided in the written languages understood by employees working on the Project and shall be prominently posted at the entrance of the decontamination enclosure system. Prior to entering the work area, parties must read and sign these procedures to acknowledge receipt and understanding of the work site layout, location of emergency exits, and emergency procedures.
C. Emergency planning shall consider the effects of fire, explosion, toxic atmospheres, electrical hazards, slips, trips and falls, confined spaces, and heat related injury.
Develop and provide written procedures and training to employees.
D. Employees shall be trained in evacuation procedures in the event of workplace emergencies.
E. In the event of non -life threatening situations requiring medical treatment, injured or otherwise incapacitated employees shall decontaminate following normal procedures with assistance from fellow workers if necessary, before exiting the Work area.
F. In the event of life threatening injury or illness requiring immediate medical treatment, worker decontamination shall be given minimum priority. Provide measures to stabilize the injured worker, remove them from the work area, and secure proper medical treatment.
G. Telephone numbers of emergency response personnel shall be prominently posted at the entrance of the decontamination enclosure system along with the location of the nearest telephone. In addition to the 911 emergency number, post the address and telephone number of the nearest emergency medical services provider.
H. Provide at least one employee on the project site at times during progress of abatement work that is trained and certified in first aid and cardiopulmonary resuscitation (CPR). This employee shall be identified by name and proof of training shall be provided to the Owner Consultant prior to the commencement of the work of this section.
I. Emergency exits shall be provided and clearly marked with arrows or other clearly visible markings to permit easy identification from anywhere within the work area.
Exits shall be secured to prevent access from uncontaminated areas while still permitting emergency egress. Exits shall be properly sealed with polyethylene sheeting, which can be cut to permit emergency egress. Emergency exits may lead through the worker decontamination enclosure, the waste removal airlock or other alternative exits as required by fire officials.
J. Provide at least one ABC dry chemical extinguisher in the decontamination compartment. Workers shall be trained in the proper operation of fire extinguishers.
1.8 LICENSING
A. The work of this section shall be performed by an entity duly licensed in the State of California in accordance with the provisions of Chapter 9 of Division 3 of the Business and Professions Code, as amended. The abatement work of this section shall be performed by an entity holding a license with an “ABS” asbestos certification as issued by the Contractors State License Board.
B. The entity performing the Work of this section, other than asbestos -related disturbance involving less than 100 square feet shall be registered with the Department of Industrial Relations in accordance with the provisions of Section 6501.5 of the California Labor Code.
1.9 ASBESTOS RELATED REQUIREMENTS
C. Qualifications:
1. Comply with the provisions of the California Labor Code, Division 5, Part 1, as it pertains to safety in employment and the applicable provisions of Title 8, Chapter 4, Subchapters 1 through 21, California Code of Regulations (CCR) as it pertains to Occupational Safety and Health, and Subchapter 7, Section 5208 Article 4, and Section 1529, asbestos regulations.
2. Comply with the provisions of Section 02 83 33 Lead Related Construction Work for all work impacting the lead based paint and lead containing materials.
D. Abatement Activities:
1. The asbestos abatement work shall be performed by persons who comply with applicable Federal, State, and local regulations including AHERA certified training.
2. Supply labor, materials, services, insurance, permits, and equipment necessary to perform the work in accordance with applicable Federal, State, and Local regulations and this Specification.
3. Submit weekly job progress reports detailing Abatement activities for projects with schedules that exceed thirty days of abatement work. Include review of progress with respect to previously established Milestones and schedules, major problems and action taken, injury reports, equipment breakdown, and air sampling results.
4. Within five workdays of transport and/or disposal, submit copies of transport manifests, disposal receipts, and weight certificates for asbestos waste removed from the Work area during the Abatement process. Weight certificates shall indicate in pounds the net weight of waste disposed from the project site as indicated on the manifest.
5. Submit logs on a weekly basis documenting filter changes on respirators, HEPA Vacuums, HEPA Filtered ventilation units, water filtration units, and other approved engineering controls.
6. Where decontamination enclosure system is required, post at the entrance a list containing the names, addresses, and telephone numbers of the entity performing the work of this section, designated Competent Person, the Owner and/or Owner Consultant, the testing laboratory and any other personnel who
may be required to access the work area or perform services during the abatement work.
7. Within five workdays the abatement contractor shall post all personal air sampling results in a location that is accessible to the workers.
E. Asbestos Related Disturbance:
1. The asbestos-related disturbance work shall be performed by persons who comply with applicable Federal, State, and local regulations including AHERA certified training.
2. Within five workdays of transport and/or disposal of asbestos -containing waste, submit copies of transport manifests and/or disposal receipts.
1.10 PRE-ABATEMENT SUBMITTALS
E. Prior to commencement of the asbestos abatement work of this section, submit the following notices, documentation, Shop Drawings, and Product Data:
1. For Projects involving asbestos -containing materials 100 square feet or more, provide a typed written notification in accordance with the San Joaquin Valley Air Pollution Control District and 40 CFR Part 61.146 of Subpart M, and to and in accordance with the Division of Occupational Safety and Health prior to start of the Work.
2. Submit to the Owner, satisfactory proof the required permits, site location, and arrangements for transport and disposal of asbestos -containing waste materials have been completed in accordance with California Health and Safety Code, Section 25143.7. Obtain and submit a copy of handling procedures and a list of protective equipment utilized for asbestos disposal at the landfill.
3. Submit to the Owner satisfactory documentation that employees, including foremen, supervisors, and any other company personnel or agents who may be exposed to airborne asbestos fibers or who may be responsible for any aspects of asbestos abatement work or asbestos -related disturbance have received adequate training that includes, at a minimum, information as described within this section and as required by AHERA.
4. Prior to commencement of abatement work, personnel required to construct and enter the work area or handle containerized asbestos -containing materials shall have received adequate training, in accordance with the requirements of this Specification and by 40 CFR, Part 763, Subpart E (AHERA) and Title 8, Section 1529, of the California Code of Regulations applies.
5. Submit documentation from a physician certifying that employees are medically monitored and are physically capable of working while wearing the required respiratory protection without suffering adverse health effects as required by California D.O.S.H regulations. Where such documentation is required, the certification shall state that the employee or agent is approved to work with asbestos and wear a respiratory protection without restrictions. Provide information to the examining physician about unusual conditions in the workplace environment that may impact on the employee's ability to perform abatement work activities.
6. Submit shop drawings for layout and construction of decontamination enclosure systems and barriers for isolation of the contained asbestos abatement work area as detailed in this Specification and required by applicable regulations.
7. When used, submit manufacturer's certification that HEPA Vacuums, air filtration units, and other local exhaust ventilation equipment complies with ANSI Z9.2.
8. Submit Product Data verifying that air filtration devices (i.e., air filtration units and vacuums) for use on this project have been registered or certified, as applicable, in compliance with the San Joaquin Valley Air Pollution Control District Rules.
9. Document NIOSH approvals for respiratory protective devices furnished as required by the work. Include manufacturer certification of HEPA filtration capabilities for cartridges and filters.
10. Submit documentation of respirator fit testing for employees and agents entering the abatement work area or areas where respiratory protection is required. This fit testing shall be performed in accordance with DOSH regulations.
11. Submit a Sample of forms to be used in documenting required items to be submitted and/or reviewed.
12. Submit SDS for all chemical products used.
F. Provide other required submittals specified as part of the work of this section.
1.11 PRE-ABATEMENT MEETING
A. A pre -abatement meeting shall be held prior to the commencement of abatement work. Attending this meeting shall be representatives of the Owner, the Owner Consultant if applicable, and the testing/monitoring personnel who shall actually participate in the testing/monitoring program. Secure the attendance of the individual who will be the project site competent person for the abatement work.
B. Included in the general preconstruction meeting will be a discussion of requirements and submittals for asbestos-related disturbance, where such applies.
C. At this meeting provide required submittals except for those to be submitted during progress of the work. In addition, provide detailed information concerning:
1. Preparation of work area and shop drawings. (Abatement Only).
2. Personal protective equipment, including respiratory protection and protective clothing. (Abatement, and Asbestos Related Disturbance if required).
3. Employees who will participate in the Project, including delineation of experience, training, and assigned responsibilities during the Work. (Abatement and Asbestos Related Disturbance).
4. Decontamination procedures for personnel, Work area, and equipment. (Abatement and Asbestos Related Disturbance).
5. Abatement methods and procedures to be provided. (Abatement Only).
6. Required air monitoring procedures (pre -Abatement and NESHAP requirement (Abatement Only), and Cal/OSHA mandatory (Abatement and Asbestos Related Disturbance).
7. Procedures for handling and disposing of waste materials, including disposal facility. (Abatement and Asbestos Related Disturbance).
8. Procedures for final decontamination and cleanup. (Abatement Only).
9. A sequence of work activities and performance schedule. (Abatement Only).
10. Procedures for dealing with heat stress. (Abatement Only).
11. Emergency procedures. (Abatement Only).
1.12 CLOSE OUT DOCUMENTATION
A. Provide the following close out documentation:
1. Filter change logs for air filtration units, water filtration units and respirators. (Abatement Only).
2. Foreman's daily job reports. (Abatement Only).
3. Employee entry/exit logs for containment. (Abatement Only).
4. Visitor entry/exit logs for containment. (Abatement Only).
5. Manometer printout reports for applicable containment. (Abatement Only).
6. Air sample results for personnel (Abatement and Asbestos Related Disturbance).
7. Air Samples for abatement work areas and air filtration units. (Abatement Only).
8. Copies of hazardous and non-hazardous waste manifests. (Abatement and Asbestos Related Disturbance).
9. Hazardous waste weight tickets. (Abatement Only).
10. Signed daily personnel report forms. (Abatement Only).
11. Signed asbestos abatement project personnel logs. (Abatement Only).
B. Receipt of the last workday attendance log and the daily personal monitoring results shall be submitted within two days upon completion of the abatement work of this section.
PART 2 – PRODUCTS
2.1 Materials and Equipment:
A. Materials
1. General:
a. Damaged, deteriorating or previously used materials shall not be furnished and shall be removed from the project site and legally disposed of. b. A sufficient supply of disposable mops, rags, and sponges for abatement work area decontamination shall be provided by the abatement contractor. c. Unless otherwise specified, the Owner will provide water and power for construction purposes. Connect to existing system as required.
2. Asbestos Related:
a. Plastic, polyethylene sheeting or visqueen shall be a fire retardant type.
Provide documentation from the manufacturer verifying compliance with this requirement.
b. Where a contained work area is required for abatement work, a minimum of two layers of 4 -mil polyethylene sheeting shall be installed for walls. For floors and other installations, polyethylene sheeting of at least 6-mil thickness shall be furnished in sufficient widths to minimize the frequency of joints. c. Method of attaching polyethylene sheeting shall be reviewed prior to installation and/or commencement of abatement work. Method of attaching
polyethylene sheeting shall not cause damage to equipment, finish surfaces, or other property.
d. Polyethylene sheeting furnished for the decontamination enclosure system shall be opaque white or black in color and shall be a minimum of 6-mil thick. e. Disposal bags shall be of 6 -mil polyethylene, with the outer bag pre -printed with labels as required by San Joaquin Valley Air Pollution Control District and applicable Cal/OSHA and DOT requirements at a minimum. f. Apply labels as per San Joaquin Valley Air Pollution Control District, Cal/OSHA, and DOT requirements for disposal containers. g. Provide warning signs as required by CAL/OSHA.
h. Surfactant (wetting agent) shall be a material that, when tested, demonstrates a surface tension of 29 dynes/cm as tested in its properly mixed concentration, using ASTM method D1331 - Surface and Interfacial Tension of Solutions of Surface Active Agents. Where work area temperature may cause freezing of the amended water solution, the addition of approved antifreeze in a manufacturer recommended amount is permitted.
B. Equipment
1. General:
a. Equipment delivered to the project site shall be free of asbestos and/or fibrous debris. No equipment with asbestos and/or fibrous debris in or on it is permitted on Owner properties.
b. Provide sufficient lighting to illuminate the Work area for safe visual working conditions and to clearly examine surfaces.
c. Provide a sufficient supply of scaffolds, ladders, lifts, and hand tools that meet applicable Federal, State, and local regulations.
2. Asbestos Related:
a. A sufficient quantity of air filtration ventilation units furnished with HEPA filtration and operated in accordance with ANSI Z9.2 -79 and EPA guidance documents shall be furnished to provide one workplace air change every 15 minutes creating -0.02 column inches of water pressure differential everywhere within the contained area when compared to the pressure outside the area. For small enclosures and glove bags, a HEPA Filtered vacuum system may be furnished to provide the pressure differential. A log documenting the filter change history of each unit is required before use. Any unit without this log shall have filters changed and the unit decontaminated. b. Provide a printable manometer for determining and recording the pressure differential within the isolated work area as compared with the ambient environment. A printed record is required for the duration of the project. The manometer shall operate 24 hours per day with a printed differential reading not to exceed fifteen minute intervals.
c. Provide sprayers with pumps in a quantity capable of providing amended water in sufficient quantities to adequately wet materials during asbestos abatement activities. Provide spray bottles or adequate equipment necessary to keep materials impacted by asbestos -related disturbance adequately wet.
d. Non-skid footwear shall be worn by abatement workers. Disposable clothing shall be adequately sealed to the footwear to prevent body contamination. e. Provide other required safety equipment to workers and authorized visitors. f. When roll-off disposal containers are delivered to a project site, four wheels of each container shall be moved and rested upon a sheet of plywood no smaller than four-foot by four-foot by ¾ inch minimum.
2.2 EMPLOYEE PERSONAL PROTECTIVE EQUIPMENT
A. Respiratory Protection:
1. Where respirators are required these shall be provided for protection from particulate contaminants as required by the National Institute of Occupational Safety and Health.
2. The respirators provided shall furnish a protection factor as required by CCR Title 8, Section 1529 for the fiber concentration in the work area. When powered air purifying respirators are provided, a sufficient supply of charged replacement batteries, filters, and a flow test meter shall be provided in the Clean Room area.
Air purifying respirators with dual HEPA Filters may be provided during Work area preparation activities.
B. Fit Testing:
1. Workers must perform positive and negative air pressure fit tests each time a respirator is donned, whenever the respirator design so permits. Powered air purifying respirators shall be tested for adequate flow as specified by the manufacturer.
2. Workers shall be undergo a qualitative fit test in accordance with procedures detailed in the D.O.S.H. requirements for respirators provided to comply with the requirements of this Project. An appropriately administered quantitative fit test may be substituted for the qualitative fit test.
3. Where respirators are required, documentation of adequate respirator fit must be provided to the Owner Consultant.
4. No one wearing a beard shall be permitted to don a respirator and enter the work area.
C. Protective Clothing:
1. Where protective clothing is required, full body disposable protective clothing, including head, body, and foot coverings, shall be provided to workers and authorized visitors in sizes adequate to accommodate movement without tearing.
2. Disposable clothing including head, foot, and full body protection shall be provided in sufficient quantities and adequate sizes for workers and authorized visitors.
3. A new suit shall be donned upon each entry to the Abatement Work area or area where the permissible exposure level will be exceeded.
4. Hard hats, protective eye wear, gloves, rubber boots and/or other footwear shall be provided as required for workers and authorized visitors. Safety shoes may be required and shall be provided.
PART 3 – EXECUTION
3.1 ABATEMENT PROCEDURES AND WORK AREA PREPARATION
A. Work Area Preparation
1. For Class I and II asbestos work, shut down and lock out heating, cooling and air conditioning system (HVAC) components that are located in, supply, or pass through the work area. Seal intakes and exhaust vents in the work area with tape and 6 -mil polyethylene. Seal seams in any system components that pass through the Work area.
2. Provide and post signs at locations and approaches to the regulated area. The signs shall comply with Cal/OSHA regulations.
3. In conjunction with the Owner, shut down and lock out/tag out electric power to Class I and II asbestos work areas. Provide equipment for temporary power with ground fault interrupters and lighting sources. Temporary power sources and equipment shall comply with applicable electrical code requirements and Cal/OSHA requirements for temporary electrical systems. The Owner shall perform electrical connections of electrical cable and equipment provided as part of the work of this section to existing Owner systems. The Owner shall pay for the costs of electric power consumed during performance of the work of this section, unless otherwise noted.
4. For Class I and II asbestos work, clean and seal off windows, doorways, corridor entrances, drains, ducts, grills, grates, diffusers, skylights, and any other openings between the abatement work area and areas outside of the abatement work area with 6 -mil polyethylene sheeting and tape prior to proceeding with required cleaning.
5. Clean movable objects within the abatement work area with a HEPA Filtered vacuum and wet cleaning methods. After cleaning, these objects shall be removed from the abatement work area and carefully stored in a location designated by the Owner.
6. Clean fixed objects in the abatement work area with a HEPA Filtered vacuums and wet cleaning methods. Careful attention shall be given to machinery behind grills or gratings where access may be difficult but contamination is present.
Cleaning of walls, floors, and ceilings behind fixed items is required. After cleaning, enclose fixed objects in 6 -mil polyethylene sheeting and seal securely in place with durable tape.
7. Clean surfaces in the abatement work area with a HEPA Filtered vacuums and wet cleaning methods. Do not utilize any methods, such as dry sweeping or vacuuming, with equipment not furnished with HEPA Filters thereby creating airborne dust and particulates. Do not disturb asbestos -containing materials during this cleaning phase.
8. Polyethylene sheeting shall be sized and installed to minimize seams. If the floor area to be covered requires seaming, seams on successive layers of polyethylene sheeting shall be staggered a minimum of six feet between each seam to reduce the potential for water penetration into the existing flooring. Do not install seams at the junction between a wall and floor.
9. Polyethylene sheeting shall be installed so as to prevent slippage between successive layers of installed material.
10. For Class I and II asbestos work, walls shall be covered with two layers of 4 -mil minimum thickness polyethylene sheeting.
11. Polyethylene sheeting installed on a wall shall be adequately fastened to prevent it from falling away from the walls. Provide additional support/attachment when air filtration ventilation systems are provided.
12. For Class I and II asbestos work with porous, dropped, or perforated ceilings, those ceilings shall be covered with one layer 4 -mil minimum thickness polyethylene sheeting.
13. Polyethylene sheeting installed on ceilings shall be adequately fastened to prevent it from falling away from the ceiling.
14. Provide one layer of 3 -mil maximum, polyethylene sheeting (non -fire retardant type) for isolation of fire sprinkler devices. Installed taping shall not impede the normal function of the fire sprinkler device. Approved wire sprinkler guards shall be furnished in conjunction with isolation.
15. Where required, install and operate air filtration equipment to provide one air change in the abatement work area every 15 minutes. Openings made in the enclosure system to accommodate these units shall be made airtight with durable tape and/or caulking as needed. If more than one unit is installed, they shall be turned on one at a time, checking the integrity of barriers after each unit is started. Insure that adequate power supply is available to satisfy the requirements of the air filtration units. Exhaust from these units shall be directed to the outside of the building whenever feasible. They shall not be exhausted into occupied areas of the buildings. Exhaust duct shall be extended from the abatement work area to the outside as required. Careful installation and daily inspections shall be performed to verify the exhaust ducts do not discharge into any areas of the building.
16. Once the enclosure system is constructed and reinforced with air filtration units in operation as required, test the enclosure for leakage utilizing smoke tubes.
Repair, replace or reconstruct as required.
17. Commencement of the work of this section shall not occur until:
a. The entire containment system has been constructed and inspected by Owner Consultant in accordance with the required Shop Drawings. b. Air filtration units are functioning within the requirements of this section. c. Pre-Abatement submittals, notifications, postings, and permits have been provided and reviewed by the Owner Consultant.
d. Equipment for abatement, decontamination, and disposal are on the project site.
e. Worker training, respirator fit testing, and medical surveillance has been provided and reviewed by the Owner Consultant.
f. A Notice to Proceed is transmitted by the Owner.
3.2 DECONTAMINATION ENCLOSURE SYSTEM FOR ABATEMENT WORK A. Decontamination enclosure systems shall be provided at locations where workers will enter or exit the abatement work area of Class I and II asbestos work prior to any other set up. Only one system at a single location for each regulated area is required. At least one individual shall be stationed at the entrance of each system at times abatement work is in progress.
B. These systems may consist of existing rooms outside of the abatement work area, if the layout permits, and that can be enclosed in polyethylene sheeting, and are accessible from the Abatement work area. If this intended layout is not feasible, given existing site conditions, enclosure systems may be constructed out of metal, wood, or plastic support as required.
C. Decontamination Enclosure Systems constructed at the project site shall be furnished with 6-mil opaque white or black polyethylene sheeting or other approved materials for privacy. Detailed descriptions of portable, prefabricated units, if furnished, shall be submitted for review. Shop drawings must include floor plan with dimensions, materials, size, thickness, plumbing, and electrical utilities.
D. Decontamination enclosure system shall consist of at least a clean room, a shower room, and an equipment room, each separated from the other, from the abatement work area and from the non -work area by "Z-flaps" at a minimum. The system shall be furnished with, at a minimum, two layers of 6 -mil polyethylene sheeting on the floors, walls, and ceiling.
E. Clean room shall be of adequate size to accommodate the abatement crew. Clean work clothes, clean disposable clothing, replacement filters for respirators, disposable towels, and other necessary items shall be provided for in adequate supply adjacent to the clean room. A location for posting notices shall also be provided adjacent to this area. When required, a lockable door shall be furnished to control access into the clean room from outside the abatement work area. Comfort lighting, heat, and electricity shall be provided as required. The clean room shall not be used for storage of tools, equipment, materials, or as office space.
F. Shower room (where required) shall contain one or more showers as required to adequately accommodate workers. Each showerhead shall be supplied with hot and cold water adjustable at the tap. The shower enclosure shall be constructed to ensure against any kind of leakage. Provide an adequate supply of soap, shampoo, and disposable towels, available at times. Shower water shall be drained, collected, and progressively filtered through a system achieving a maximum particle size of 1.0 microns.
G. The equipment room shall be used for storage of equipment and tools at the end of a shift. These shall have been cleaned using a HEPA Filtered vacuum and wet cleaning methods. A container lined with a labeled 6 -mil polyethylene bag for collection of disposable clothing shall be located in this room. Reusable footwear shall be stored in this area after being cleaned.
3.3 WASTE CONTAINER REMOVAL AIRLOCK AND EMERGENCY EXITS A. The waste container pass -out airlock shall be constructed away from the decontamination enclosure system. This airlock shall be in a location that provides direct access from abatement work area to the outside of the building if possible.
B. This system shall consist of an airlock, container staging area, and another airlock providing access to outside abatement work area.
C. The waste container airlock shall be constructed in similar fashion with similar materials as the decontamination enclosure system.
D. This airlock system shall not be used to enter or exit the abatement work area.
3.4 WORKPLACE ENTRY AND EXIT PROCEDURES
A. Before entering the regulated area personnel shall read and be familiar with posted regulations, personal protection requirements, and emergency procedures. A signature sheet shall be posted for signatory acknowledgement these have been reviewed and understood by personnel prior to entry.
B. Workers and other authorized personnel shall enter the abatement work area through the decontamination enclosure system or other room required when decontamination enclosure system is not required.
C. Personnel who enter or exit the regulated area shall sign the entry and exit log located adjacent to the clean room.
D. Personnel shall proceed first to the clean room, don respirator, and washable and/or disposable clothing.
E. General construction area equipment including, but not limited to, hard hats, eye protection, and gloves shall also be provided as required. Clean respirator and cartridges, and protective clothing shall be provided and utilized by each person for each separate entry into the regulated area.
F. Before leaving the regulated area for Class I and II asbestos work, personnel shall remove gross contamination from the outside of respirators and protective clothing by vacuuming and/or wet wiping methods. Each person shall clean protective footwear just prior to entering the equipment room.
G. Personnel shall proceed to equipment room where they remove protective equipment except respirators. Deposit disposable clothing into appropriately labeled containers.
H. Still wearing respirator, personnel shall proceed to the shower area, clean the outside of the respirators and the exposed face area under running water prior to removal of respirator then shower and shampoo to remove residual asbestos contamination. Various types of respirators will require slight modification of these procedures. A powered air purifying respirator face piece will have to be disconnected from the filter/power pack assembly when such is not waterproof, upon entering the shower. A dual cartridge respirator may be worn into the shower and cartridges shall be replaced for each new entry into the work area.
I. After showering and drying off, proceed to the clean room and don clean clothing.
J. At no time shall any personnel exit an abatement work area into a space occupied by staff or inmates without being completely dressed. Any violation of this requirement will result in the permanent removal of the person from the Project site.
3.5 REMOVAL PROCEDURES
A. Wet all asbestos containing material with an amended water solution using equipment capable of providing a fine spray mist, in order to reduce airborne fiber concentrations when the material is disturbed. Saturate the material to the substrate; however, do not allow excessive water to accumulate in the work area. Keep all removed material wet enough to prevent fiber release until it can be containerized for disposal. If work area temperatures are below 32 F and amended water is subject to freezing, dry removal permits and procedures must be utilized (see 2.1.2.1).
Maintain high humidity in the work area by misting or spraying to assist in fiber settling and reduce airborne concentrations. Wetting procedures are not equally effective on all types of asbestos containing materials but, shall none the less be used in all cases.
B. Saturated asbestos containing material shall be removed in manageable sections.
Removed material should be containerized before moving to a new location for continuance of work. Surrounding areas shall be periodically sprayed and maintained in a wet condition until visible material is cleaned up.
C. Material removed from building structures or components shall not be dropped or thrown to the floor. Material should be removed as intact sections or components whenever possible and carefully lowered to the floor. If this cannot be done for materials greater than 50 feet above the floor, a dust -tight chute shall be constructed to transport the material to containers on the floor or the material may be containerized at elevated levels (e.g., on scaffolds) and carefully lowered to the ground by mechanical means. For materials between 15 and 20 feet above the ground, they may be containerized at elevated levels or dropped onto inclined chutes or scaffolding for subsequent collection and containerization.
D. Large components removed intact may be wrapped in 2 layers of 6 mil. Polyethylene sheeting secured with tape for transport to the landfill.
E. Asbestos containing waste with sharp -edged components (e.g., nails, screws, metal lath, tin sheeting) will tear the polyethylene bags and sheeting and shall be placed into drums for disposal.
F. After completion of all stripping work, surfaces from which asbestos containing materials have been removed shall be wet brushed and sponged or cleaned by some equivalent method to remove all visible residues.
G. After the work area has been rendered free of visible residues, a thin coat of a satisfactory encapsulation agent shall be applied to all surfaces in the work area including structural members, building components and plastic sheeting on walls, floors and covering non-removable items, to seal in non-visible residue.
H. Brushes furnished for removing loose Asbestos Containing Material during detail cleaning of substrate shall be furnished with nylon or fiber bristles. Metal or wire brushes are not permitted. Brushes used during this process shall be disposed as contaminated waste when use of the brush for this work is completed.
I. A sufficient supply of HEPA Filtered vacuum systems shall be provided during cleanup of abatement work. Brush attachments are not permitted for use with vacuum systems.
J. Barriers constructed to isolate the regulated area from other areas shall be inspected at least three times per shift; prior to the start of abatement activities; half way into the shift; and following the completion of the abatement activities at the end of the shift.
Inspect and document observations in the daily Project log.
K. Damage and defects in the Enclosure system shall be repaired immediately upon discovery.
L. At any time during abatement work, following barrier installation, if visible debris is observed outside of the regulated area or damage occurs to the barriers, stop work immediately. Repairs shall be performed to the barriers and debris/residue shall be cleaned up with appropriate HEPA Vacuuming and wet wiping methods. These incidents shall be recorded in the daily project log.
M. If air samples collected outside of the work area during abatement work indicate airborne fiber concentrations greater than 0.01 f/cc or the pre -measured background levels (whichever is lower) work shall stop immediately. An inspection and repair of barriers shall be performed as required. Surface cleaning with HEPA vacuums and wet wiping methods of areas outside of the work area may be required by the Owner.
Findings, observations, and corrective actions shall be documented in the daily project log.
3.6 ENCAPSULATION AND BRIDGING AGENTS
A. Clean and isolate the work area in accordance with "Work Area Preparation" of this Section.
B. Lockdown and encapsulating material, and bridging agents shall be reviewed by the Owner Consultant prior to the commencement of the work of this section.
C. Encapsulating material shall be sprayed applied with airless spray equipment.
Nozzle pressure shall be adjustable within a range of 400 to 1500 PSI.
D. Lock down coat shall be spray applied with low pressure providing a continuous even coat.
3.7 CLEAN UP PROCEDURES
A. Asbestos Clean Up Procedures:
1. Unless decontaminated daily, reusable footwear and kneepads shall be stored in the equipment room when not in the work area. Upon completion of abatement work, these shall be disposed of as asbestos contaminated waste or may be decontaminated at the completion of abatement work.
2. Remove and containerize visible accumulations of asbestos -containing material and asbestos contaminated debris with rubber dustpans and rubber squeegees.
Special care shall be taken to minimize damage to flooring materials.
3. All asbestos waste shall be double bagged and the opening sealed in a gooseneck fashion.
4. Remove containerized waste from the abatement work area and the waste container airlock.
5. Wet wipe surfaces in the regulated area with clean rags, mops, and sponges as appropriate.
6. After cleaning remove the top layer of polyethylene sheeting from walls and floors.
7. Clean the second layer of polyethylene sheeting by wet wipe and HEPA vacuuming. Windows, doors, HVAC system vents, and other critical seals shall remain sealed until the abatement work area passes final clearance. The air filtration units shall remain in continuous operation and the decontamination enclosure system shall remain in place and be utilized.
8. Decontaminate tools and equipment and remove at the appropriate time in the cleaning process.
9. Provide notification to the Owner at least one day in advance when abatement work will be completed and ready for final visual inspection. If, upon inspection, abatement work is not completed or the area does not pass final visual inspection, finish or correct the abatement work as required before notifying the Owner. Subsequent inspections shall commence not later than one day following notice.
10. The Owner Consultant shall inspect the work area for visible residue. If residue is observed, it shall be deemed to contain asbestos and the cleaning process shall be repeated. The lock down coat shall be applied only after inspection by the Owner Consultant and during non-school hours.
11. The second layer of isolation shall only be removed after the Owner Consultant inspects the lock down coat or installed Encapsulation, but in no case prior to overnight drying of lock down coat or encapsulation.
12. Following completion of air clearance monitoring the remaining barriers shall be removed and properly disposed of. A final visual inspection by the Owner Consultant shall be performed to verify that no contamination remains in the abatement work area. Unsatisfactory conditions may require additional cleaning and air monitoring.
3.8 WASTE HANDLING AND TRANSPORTATION
A. Asbestos Waste Handling
1. As the Work progresses, to prevent exceeding available storage capacity on the project site, sealed and labeled containers of asbestos-containing waste shall be removed and transported to the prearranged disposal location.
2. Personnel loading Asbestos waste shall be protected with disposable clothing and at a minimum half-face, air purifying, dual cartridge respirators furnished with HEPA Filters.
3. All waste material shall be labeled in compliance with California Code of Regulations, Title 8, Section 1529. Asbestos subsection (k) (C) (8) Labels.
4. Waste shall not be transported from the work are to the storage container while inmates or staff are present in the path of travel. Where a path of travel cannot be cordoned off, the movement of waste must be completed when inmates and/or staff are not present.
5. Once the drums, bags, and/or wrapped components have been removed from the work area, they shall be loaded into an enclosed truck or bin for transportation.
6. Before transporting or offering hazardous waste for transportation off -site, the generator shall mark each package of hazardous waste in accordance with the applicable Department of Transportation regulations on hazardous materials under Title 49 Code of Federal Regulations Part 172.
7. Waste disposal shall occur at an authorized site in accordance with regulatory requirements of NESHAP and applicable State and Local regulations.
3.9 TRANSPORTATION OF NON HAZARDOUS WASTE
A. Waste shall be containerized, labeled, and transported in accordance with federal, state, and local regulations.
B. Waste shall be transported under a non-hazardous waste manifest.
C. Containers shall be enclosed during transportation.
3.10 TRANSPORTATION OF HAZARDOUS WASTE
A. Dump receipts; trip tickets, transportation manifests, weight certificates or other documentation of disposal shall be delivered to the Owner Consultant within 48 hours of disposal. As the material and responsibility for the material changes hands, the generator or designee, the transporter(s), and the disposal site operator shall sign the Uniform Hazardous Waste Manifest. If a separate waste hauler is employed, the name, address, U.S.E.P.A. ID number, and signature of the transporter shall also be affixed onto the manifest.
B. The enclosed cargo area of trucks or containers shall be free of debris and lined with 6 mil polyethylene sheeting to prevent contamination from leaking or spilled containers. Floor sheeting shall be installed first and extend up the sidewalls. Wall sheeting shall be overlapped and taped into place.
C. Drums shall be placed on level surfaces in the cargo area and packed tightly together to prevent shifting and tipping. Large structural components shall be secured to prevent shifting, with bags placed on top.
D. Access openings on large metal containers, which are used for storing or transporting Asbestos waste, shall have doors and tops that can be closed and locked. Materials not properly bagged shall not be placed in these containers nor shall these containers be used for non -Asbestos waste or non -hazardous asbestos waste. Bags shall be placed, not thrown, into these containers to avoid damage.
3.11 MONITORING
A. Abatement Project Management and Inspection:
1. Owner has the right to perform air and performance monitoring at any time.
2. The Owner has unlimited access to the regulated and surrounding areas at times during progress of the work, including, but not limited to, use of ladders, scaffolds, and other equipment required to gain access to the Work surfaces.
B. Work Area Monitoring:
1. Visual inspections and air testing may be performed at any time during the progress of the abatement work. Provide corrective measures as required to maintain the work area in compliance with this Specification and regulatory requirements.
C. Contractor’s Employee – Personal Air Monitoring:
1. Provide air monitoring as required California Code of Regulations, Title 8, Section 1529. Results shall be provided to the Owner Consultant within ten working days of sampling. Negative Exposure Assessments utilizing prior project monitoring require submittal of applicable data for approval before work proceeds.
D. Clearance Air Monitoring:
1. Following the completion of abatement work and clean -up operations, lock down coat application, and visual inspection by the Owner, clearance air monitoring shall be performed by the Owner Consultant.
2. The Owner Consultant shall arrange for sampling of the air in the abatement work area for airborne fiber concentrations. Clearance sampling shall be performed in compliance with one of the following methods:
a. AHERA TEM air clearance sampling shall be performed in compliance with 40 CFR, Part 763, Subpart E which may include the following:
i. Five (5) samples inside the work area. Samples taken inside the work area shall be conducted under aggressive conditions.
ii. Five (5) samples outside of the work area.
iii. One (1) inside work area blank, one (1) outside work area blank and one (1) sealed blank.
iv. All inside work area sample results on average must be below 70s/mm2 b. NIOSH 7402 TEM Level II (Yamate)
i. Three (3) samples inside the work area.
ii. One (1) inside work area blank (field blank), one (1) sealed blank. iii. All inside work area sample results on average must be below 70s/mm2 c. NIOSH 7400 Phase Contrast Microscopy (PCM)
i. Three (3) samples inside the work area.
ii. One (1) inside work area blank (field blank), one (1) sealed blank. iii. All inside work area sample results must be below 0.01f/cc
3. If air -sampling results are within the limits of 40 CFR, Part 763, Subpart E (AHERA), the Abatement Work area shall be released for occupancy.
4. Areas failing clearance monitoring shall be cleaned as required in article 3.09, CLEAN UP PROCEDURES, and tested until satisfactory levels are provided in accordance with this Specification where required.
5. Unauthorized interference or tampering with air sampling equipment may result in termination of the Contract and/or removal of the abatement contractor from the list of prequalified abatement contractors.
E. Visual Clearance Inspections:
1. Following the completion of abatement work and clean -up operations, lock down coat application, and visual inspection by the Owner, final clearance inspections shall be performed by the Owner Consultant.
2. The Owner Consultant shall perform a visual final clearance inspection of each regulated work area to insure that all impacted asbestos -containing materials have been adequately removed and that no ACM material or debris remains in the work areas.
3. Areas failing clearance inspections shall be cleaned and re -evaluated until no visible asbestos -containing materials and/or asbestos -containing debris remain in the work areas.
3.12 RE-ESTABLISHMENT OF THE WORK AREA AND SYSTEMS
A. Reestablishment of the work area shall only occur following the completion of final inspection and clearance air monitoring.
B. Critical barriers shall be removed at this time.
C. Accompanied by the Owner Consultant, visually inspect the abatement work area for any remaining visible residue. Evidence of contamination will require additional cleaning requirements.
D. Upon successful completion of the clearance inspection, air monitoring and final walkthrough of the work areas, the site will be released to the Owner as a non - regulated work area and the demolition activities may proceed.
END OF SECTION
18 EXHIBIT “B”
QUOTE
Work Order Signature Document
EZIQC Contract No.: CA-R8-GB-101723-HRZ
New Work Order
139969.00
Modify an Existing Work Order
Work Order Title:
Work Order Number.: Work Order Date:
X
05/05/2025
Contractor Name:
Contact:
Phone:
Contact:
Phone:
Kinan Kotrash
(714) 626-0000
Owner Name:
City of Bell Gardens-Ford Park Demo
City of Bell Gardens
Bernardo Iniguez
562-806-7770
Horizons Construction Co. Int'l, Inc.
Work to be Performed
Work to be performed as per the Final Detailed Scope of Work Attached and as per the terms and conditions of Sourcewell EZIQC Contract No CA-R8-GB-101723-HRZ.
Brief Work Order Description:
Demo
Will not apply:Liquidated Damages Will apply:
Estimated Completion Date:
Estimated Start Date: Time of Performance
X
Work Order Firm Fixed Price: $81,233.05
Owner Purchase Order Number:
Approvals
Date DateContractorCity of Bell Gardens
2.00
5/5/2025
Work Order Signature Document
3.00 Detailed Scope of Work
Bernardo IniguezKinan KotrashTo: From:
Horizons Construction Co. Int'l, Inc.
432 W. Meats Ave.
Orange, CA 92865
(714) 626-0000
City of Bell Gardens
8327 Garfield Ave
Bell Gardens, CA 91201
562-806-7770
Work Order Number:
May 05, 2025Date Printed:
139969.00
City of Bell Gardens-Ford Park DemoWork Order Title:
Brief Scope: Demo
Revised FinalPreliminary X
The following items detail the scope of work as discussed at the site. All requirements necessary to accomplish the items set forth below shall be considered part of this scope of work.
Detailed Scope
· Demo existing restroom building
· Asbestos Removal of vinyl floor tile with mastic & gray pentration mastic · Cut and cap existing sewer line
Exclusions:
Demo of existing slab and footing excluded
Subject to the terms and conditions of ezIQC Contract CA-R8-GB-101723-HRZ.
Contractor Date
DateCity of Bell Gardens
5/5/2025
Scope of Work
4.00 Contractor's Price Proposal - Summary
Owner PO #:
City of Bell Gardens-Ford Park Demo
139969.00
CA-R8-GB-101723-HRZIQC Master Contract #:
W
ork Order #:
Title:
Re:
May 05, 2025Date:
Proposal Value:
Contractor: Horizons Construction Co. Int'l, Inc.
$81,233.05
$29,150.89Section - 01
$52,082.16Section - 02
Proposal Total
Thisl total represents the correct total for the proposal. Any discrepancy between line totals, sub-totals and the proposal total is due to rounding.
$81,233.05
The Percentage of NPP on this Proposal: %
5/5/2025
Contractor's Price Proposal - Summary
5.00 Contractor's Price Proposal - Detail
City of Bell Gardens-Ford Park Demo
139969.00
CA-R8-GB-101723-HRZIQC Master Contract #:
Work Order #:
Owner PO #:
Title:
Re:
May 05, 2025Date:
Proposal Value:
Contractor: Horizons Construction Co. Int'l, Inc.
$81,233.05
(Excludes)Equip. MaterialLabor
Line TotalDescriptionUOMMod.ItemSect.
Section - 01
01 22 16 00 0002 Reimbursable FeesReimbursable Fees will be paid to the contractor for eligible costs as directed by Owner. Insert the appropriate quantity to adjust the base cost to the actual Reimbursable Fee. If there are multiple Reimbursable Fees, list each one separately and add a comment in the "note" block to identify the Reimbursable Fee (e.g. sidewalk closure, road cut, various permits, extended warranty, expedited shipping costs, etc.). A copy of each receipt, invoice, or proof of payment shall be submitted with the Price Proposal. 1 $1,748.66EA
Installation =x x 1,748.66
FactorUnit PriceQuantity Total
1.00 1.1000 1,589.69
Bond and insurance 2%
$79,484.39 x 0.02 = $1,589.69
01 22 20 00 0040 PlumberFor tasks not included in the Construction Task Catalog® and as directed by owner only.
2 $1,906.08HR
Installation =x x 1,906.08
FactorUnit PriceQuantity Total
115.66 1.0300 16.00
2 plumber for 1 day to cap existing drain, sewer, and water line for future connection 01 22 23 00 0283 1,500 To 1,700 Lb. Capacity, 60" Wide, Skid-Steer Loader With Full-Time Operator
3 $3,200.37DAY
Installation =x x 3,200.37
FactorUnit PriceQuantity Total
1,553.58 1.0300 2.00
skid steer for demo work
01 22 23 00 0415 6,000 Lb. Capacity, Mini-Excavator With Full-Time Operator4 $4,057.39DAY Installation =x x 4,057.39
FactorUnit PriceQuantity Total
1,313.07 1.0300 3.00
mini excavator for demo of underground utility and dirt 01 22 23 00 1623 6 CY Rear Dump Truck With Full-Time Truck Driver5 $10,965.94WK Installation =x x 10,965.94
FactorUnit PriceQuantity Total
5,323.27 1.0300 2.00
dump truck for removal of demolished materials
01 22 23 00 1623 0042 For Equipment Without Operator, Deduct6 -$1,970.80MOD Installation =x x -1,970.80
FactorUnit PriceQuantity Total
-3,826.79 1.0300 0.50
01 56 26 00 0006 Temporary 8' High Chain Link Fence And Posts, Up To 6 Months7 $4,052.02LF Installation =x x 4,052.02
FactorUnit PriceQuantity Total
11.24 1.0300 350.00
temporary fence approx 350 lf to protect site
01 56 26 00 0006 0075 For Each LF Shade Cloth, Add8 $1,297.80MOD Installation =x x 1,297.80
FactorUnit PriceQuantity Total
3.60 1.0300 350.00
5/5/2025
Contractor's Price Proposal - Detail
Contractor's Price Proposal - Detail Continues..
Work Order Title:
Work Order Number: 139969.00
City of Bell Gardens-Ford Park Demo
Section - 01
01 71 13 00 0004 First 25 Miles, Equipment Delivery, Pickup, Mobilization And Demobilization Using A Tractor Trailer With Up To 53' BedIncludes loading, tie-down of equipment, delivery of equipment, off loading on site, rigging, dismantling, loading for return and transporting away. For equipment such as bulldozers, motor scrapers, hydraulic excavators, gradalls, road graders, loader-backhoes, heavy-duty construction loaders, tractors, pavers, rollers, bridge finishers, straight mast construction forklifts, telescoping boom rough terrain construction forklifts, telescoping and articulating boom man lifts with >40' boom lengths, etc.
9 $3,079.06EA
Installation =x x 3,079.06
FactorUnit PriceQuantity Total
1,494.69 1.0300 2.00
delivery of skid steer and mini excavator
01 71 36 00 0005 >4 To 8 Hours On Site, Electromagnetic (SIR/GPR) Survey, Earth, Concrete, Masonry Or Asphalt
10 $0.00EA
Installation =x x 0.00
FactorUnit PriceQuantity Total
3,454.74 1.0300 0.00
SIR for underground utilities survey
01 74 19 00 0034 Traditional Building Construction Materials Landfill Dump Fee11 $517.32CY Installation =x x 517.32
FactorUnit PriceQuantity Total
20.09 1.0300 25.00
dump fee for demo materials
01 74 19 00 0037 Hazardous Materials And Rubbish Landfill Dump FeeIncludes regulated waste such as paint cans, refrigerators/freezers, air conditioners, smoke detectors, batteries, etc.
12 $297.05CY
Installation =x x 297.05
FactorUnit PriceQuantity Total
57.68 1.0300 5.00
dump fee for asbestos containing materials
$29,150.89Subtotal for Section - 01
Section - 02
02 41 16 13 0012 By Machine, Reinforced Concrete Building Demolition13 $37,616.08CCF Installation =x x 37,616.08
FactorUnit PriceQuantity Total
64.41 1.0300 567.00
Demo restroom building
approx 1700 sf x 9' height
= 567 ccf
02 41 16 13 0012 0005 For >500 To 1,000, Add14 $7,522.05MOD Installation =x x 7,522.05
FactorUnit PriceQuantity Total
12.88 1.0300 567.00
02 82 33 00 0115 >500 To 2,500 SF, Single Layer Or First Of Multiple Layers, Floor Tile, Asbestos Abatement And Disposal
15 $5,566.12SF
Installation =x x 5,566.12
FactorUnit PriceQuantity Total
7.72 1.0300 700.00
asbestos removal of vinyl floor tile approx 700sf
02 82 33 00 0137 Up To 100 SF, Mastic, Asbestos Abatement And DisposalApplies to bottom layer only if multiple layers.
16 $1,377.91SET
Installation =x x 1,377.91
FactorUnit PriceQuantity Total
1,337.78 1.0300 1.00
asbestos removal of penetration mastic approx 50sf
$52,082.16Subtotal for Section - 02
5/5/2025
Contractor's Price Proposal - Detail
Contractor's Price Proposal - Detail Continues..
Work Order Title:
Work Order Number: 139969.00
City of Bell Gardens-Ford Park Demo
Proposal Total
This total represents the correct total for the proposal. Any discrepancy between line totals, sub-totals and the proposal total is due to rounding.
$81,233.05
The Percentage of NPP on this Proposal: %
5/5/2025
Contractor's Price Proposal - Detail
19 EXHIBIT “C”
SOURCEWELL DOCUMENTS
Rev. 4/2023 Sourcewell IFB #CA101723Indefinite DeliveryIndefinite Quantity Construction Contracts in the State of CaliforniaPage 1 IFB #CA101723Invitation for BidsforIndefinite DeliveryIndefinite QuantityConstruction Contractsin theState of CaliforniaBid Due Date: October 17, 2023, 4:30 p.m., Central TimeSourcewell, a State of Minnesota local government entity and public agency, is issuing this Invitation forBids (IFB) on behalf of its participating entities to create indefinite deliveryindefinite quantityconstruction (IDIQ) contracts that may be used by those participating entities for projects related toconstruction or the repair, alteration, modernization, or renovation of buildings, structures, or other realproperty.This IFB consists of the following parts:1. Invitation for Bids, including Map of Regions2. Template IDIQ Construction Contract3. IDIQ Contract General Terms and Conditions4. Construction Task Catalog5. Technical SpecificationsA full copy of the IFB can be found on the Sourcewell Procurement Portal(https://proportal.sourcewellmn.gov), and only bids submitted through the Sourcewell Procurement Portal will be considered. Bidsare due no later than October 17, 2023, at 4:30 p.m. Central Time, and late bids will not be considered.Solicitation Schedule Notice of Solicitation Published: September 12, 2023Prebid Conference: September 26, 2023, 12:00 p.m., Central TimeQuestion Submission Deadline: October 10, 2023, 4:30 p.m., Central TimeBid Due Date:October 17, 2023, 4:30 p.m., Central TimeLate responses will not be considered.Opening: October 17, 2023, 6:30 p.m., Central TimeSee Article VII. G. for more information.
Rev. 4/2023 Sourcewell IFB #CA101723Indefinite DeliveryIndefinite Quantity Construction Contracts in the State of CaliforniaPage 2 I. ABOUT SOURCEWELL AND ITS PARTICIPATING ENTITIESSourcewell is a State of Minnesota local government and public agency created under the laws of theState of Minnesota (Minnesota Statutes Section 123A.21) that facilitates a competitive publicsolicitation and contract award process for the benefit of its participating entities across the UnitedStates. It has the authority to develop and offer, among other services, joint purchasing services to itsparticipating entities. Sourcewells solicitation process complies with State of Minnesota law andpolicies. Sourcewells participating entities in the State of California may include: Federal and state government Cities, towns, and counties/parishes Education service cooperatives K12 and higher education Tribal government Some nonprofit Other public entitiesII. INDEFINITE DELIVERYINDEFINITE QUANTITY CONSTRUCTION PROGRAMSourcewell is soliciting bids for its IDIQ construction program. IDIQ contracting offers participatingentities access to competitively solicited and awarded contracts for projects related to construction orthe repair, alteration, modernization, or renovation of buildings, structures, or other real property.Sourcewell has engaged The Gordian Group, Inc. (Gordian) to provide management of its IDIQconstruction program. In this role, Gordian provides support to Sourcewell in the administration of theprogram, including: preparing Construction Task Catalogs and related technical specifications, providinginformation management systems and licenses to contractors, training to contractors, administering feecollection, consulting services to Sourcewell, and assisting with proposal package or work orderdevelopment. Participating Entities access Sourcewell IDIQ contracts resulting from this IFB throughrelevant purchasing authority, and work directly with Contractors awarded through this IFB.Under IDIQ, an awarded Contractor furnishes management, labor, materials, equipment, and incidentaldesign support needed to perform the work. Details of the programs operation can be found within theContract, and General Terms and Conditions document included in this IFB.III. REQUIRED BIDDER QUALIFICATIONSIn determining a Bidder's responsibility and ability to perform under a Contract, Sourcewell has the rightto investigate and request information concerning the financial condition, experience record, personnel,equipment, facilities, business location(s) and organization of the Bidder, the Bidder's record withenvironmental regulations, and the claims and litigation history of the Bidder. Sourcewell reserves theright to verify the Bidders information and may request clarification from a Bidder.A. A Bidders business must be normally engaged in performing the type of work specified within thisIFB and must have adequate organization, facilities, equipment, and personnel to ensure prompt andefficient service to a Sourcewell participating entity (as solely determined by Sourcewell).
Rev. 4/2023 Sourcewell IFB #CA101723Indefinite DeliveryIndefinite Quantity Construction Contracts in the State of CaliforniaPage 3 B. Bidders responding to a General Building solicitation must be willing and capable of providing all or amajority of the various types of construction work as specified in the Construction Task Catalog eitherthrough its own forces or by using subcontractors. Bidder must provide documentation of all applicablerequired licensure(s).C. Bidders responding toPaving, Roofing/Waterproofing, Plumbing, Sanitation System, Flooring,Abatement Services, Landscaping, Painting, Low Voltage Systems, Fire Protection, Mechanical/HVAC,Electrical, Solar, and/or Limited Specialty Contracts (C61)solicitations must perform at least51%of allcontracted work with its own organization and forces. The percentage calculation does not include fieldsuperintendents or office management personnel.D. Bidders must demonstrate a physical presence within the geographic boundary of the region(s), oradjacent region(s) to which they are bidding as identified in the Map of Sourcewell Contract Regions.IV. BID OVERVIEW AND PREPARATION INSTRUCTIONSA. REQUESTED INDEFINITE DELIVERYINDEFINITE QUANTITY CONSTRUCTION SERVICES. The IDIQservices specified include General Building, Paving, Roofing/Waterproofing, Plumbing, SanitationSystem, Flooring, Abatement Services, Landscaping, Painting, Low Voltage Systems, Fire Protection,Mechanical/HVAC, Electrical, Solar, and Limited Specialty Contracts. At this time, no specific projectshave been identified; work and work volume from any resulting contract are not guaranteed. Specificdescription of work and summary of duties for each category of construction can be found in theTechnical Specifications.B. PREPARATION INSTRUCTIONS. Strict compliance with the following instructions is required forproperly preparing a bid. Before submitting a bid, it is the responsibility of each Bidder to:1) Examine the IFB Documents thoroughly;2) Consider all applicable federal, state and local laws, regulations, ordinances, andprocurement codes that may affect costs, progress, performance, or furnishing of aparticipating entitys work; and,3) Notify Sourcewell of all conflicts, errors, or discrepancies in the IFB Documents of whichBidder knows.The submission of a Bid constitutes a representation by the Bidder to Sourcewell that it has compliedwith the above requirements and that, without exception, its Bid is premised upon performing andfurnishing the Work required by this IFB.Bidders should include all relevant information in its bid. Sourcewell cannot consider information that isnot provided in the bid.C. ESTIMATED CONTRACT VALUE AND USAGE. Based on past volume of similar contracts, theestimated annual value of each contract resulting from this IFB is $5,797,275. Sourcewell anticipatesconsiderable activity under the contract(s) awarded from this IFB; however, work and work volume fromany resulting contract are not guaranteed.
Rev. 4/2023 Sourcewell IFB #CA101723Indefinite DeliveryIndefinite Quantity Construction Contracts in the State of CaliforniaPage 4 V. BID PRICINGA. CONSTRUCTION TASK CATALOG AND ADJUSTMENT FACTOR. In order to evaluate bid pricing and theretain consistency within contract pricing, Sourcewell uses Gordians proprietary Construction TaskCatalog (CTC). The CTC as a comprehensive listing of specific repair and construction related Tasks,together with a specific unit of measurement and a preset unit price (Unit Price). All Unit Prices withinthe CTC are based on local labor, material, and equipment prices for the direct cost of construction.Under this IFB, Bidders will offer price adjustments (Adjustment Factors) that will be applied to CTC UnitPrices. The Adjustment Factors represent either an increase to the present Unit Prices (such as 1.1000)or a decrease from the presetUnit Prices (such as 0.9800).A participating entitys cost for a specific task will be determined by multiplying the preset Unit Prices bythe appropriate quantities and by the appropriate Adjustment Factor (e.g., specific task cost = presetunit price in CTC * quantity needed * Adjustment Factor).1) Each Bidder must submit 3 Adjustment Factors to be applied to every task in the CTC. Thebid must be either an adjustment decrease from (e.g. 0.9800) or increase to (e.g.1.1000) the Unit Prices listed in the CTC.2) The Bidder's Adjustment Factors must include all of the Bidder's direct and indirect costs.This includes, but is not limited to, its costs for overhead, profit, bond premiums above thereimbursable amount, insurance, mobilization, purchase order proposal development, andall contingencies in connection therewith. See pages 00t1 006 of the CTC for a completeexplanation of what is and is not included in the Unit Prices. Note, where applicable, thebidder must comply with all applicable prevailing wage laws. The wage rates in the CTC werecurrent at the time these IFB Documents were issued.a. The first Adjustment Factorwill be applied to work to be accomplished duringNormal Working Hours and are performed on projects thatdo requireprevailing wagerates.b. The second Adjustment Factorwill be applied to work to be accomplished duringOther Than Normal Working Hours and are performed on projects thatdo requireprevailing wage rates.c. The third Adjustment Factorwill be applied to work to be accomplished at securedfacilities/OSHPD thatdo requireprevailing wage rates.d. The fourth Adjustment Factorwill be applied to work to be accomplished on allunion wage projects.e. The fifth Adjustment Factorwill be for work tasks not identified in the ConstructionTask Catalog. IQCC includes a provision for establishing of prices for Work requirementswhich are within the general scope of IQCC but were not included in the CTC at the timeof Contract award. These Tasks are referred to as "Non Prepriced Tasks (NPP)." NPPTasks may require new specifications and drawings and may subsequently beincorporated into the CTC. The bidders will offer an Adjustment Factor to be applied tothe actual material, equipment, and labor cost for NPP work Tasks.3) Adjustment Factors may be specified to the fourth decimal place. For example:1 . 1 0 0 0
Rev. 4/2023 Sourcewell IFB #CA101723Indefinite DeliveryIndefinite Quantity Construction Contracts in the State of CaliforniaPage 5 Or0 . 9 8 0 04) For bid evaluation purposes only, the following weighing of the Adjustment factors will beused to determine the Combined Adjustment Factor. Complete the following informationwithin the Sourcewell Procurement Portal:Adjustment FactorsWeightNormal Working Hours Prevailing Wage RateProjects50%Other Than Normal Working Hours PrevailingWage Rate Projects15%Secured/OSHPD Prevailing Wage Rate Projects 15%All Union Wage Projects 10%NonPrePriced Adjustment Factor 10%B. ADMINISTRATIVE FEES. Awarded contractors must pay an administrative fee in exchange for theadministration of the contracts by Sourcewell and Sourcewells contract administrator, Gordian. Thebidder must include the administrative fee in calculating the Contractors Adjustment Factors.Detailed information about Sourcewells administrative fee can be found in Article VII. B of the GeneralTerms and Conditions.VI. CONTRACTBidders awarded a contract will be required to execute the Contract (including its General Terms andConditions) attached to this IFB.VII. BIDDING PROCESSA. PREBID CONFERENCE. Sourcewell will hold a nonmandatory prebid conference via webcast on thedate and time noted in the Solicitation Schedule and on the Sourcewell Procurement Portal. Thepurpose of this conference is to allow potential bidders to ask questions regarding this IFB. Informationabout the webcast will be sent to all entities that have registered for this solicitation opportunitythrough their Sourcewell Procurement Portal Vendor Account. Prebid conference attendance isoptional but highly encouraged.B. QUESTIONS REGARDING THIS IFB AND ORAL COMMUNICATION. Any questions regarding this IFBmust be submitted through the Sourcewell Procurement Portal. The deadline for submission ofquestions is found in the Solicitation Schedule and on the Sourcewell Procurement Portal. Answers toquestions will be issued through an addendum to this IFB. Repetitive questions will be summarized intoa single answer and identifying information will be removed from the submitted questions.
Rev. 4/2023 Sourcewell IFB #CA101723Indefinite DeliveryIndefinite Quantity Construction Contracts in the State of CaliforniaPage 6 All questions, whether specific to a Bidder or generally related to the IFB, must be submitted using thisprocess. Do not contact individual Sourcewell staff (or any representative of Gordian) to ask questionsor request information as this may disqualify the Bidder from responding to this IFB. Sourcewell will notrespond to questions submitted after the deadline.C. ADDENDA. Sourcewell may modify this IFB; however, no Addenda will be issued later than 5 daysprior to the Bid Due Date, except an Addendum that withdraws or postpones this IFB. Addenda issuedby Sourcewell become a part of the IFB and will be delivered to potential Bidders through theSourcewell Procurement Portal. Sourcewell accepts no liability in connection with the delivery of anyaddenda.Before abid will be accepted through the Sourcewell Procurement Portal, all addenda, if any, must beacknowledged by the Bidder by checking the box for each addendum. It is the responsibility of theBidder to check for any addenda that may have been issued up to the solicitation due date and time.If an addendum is issued after a Bidder submitted its Bid, the Sourcewell Procurement Portal willWITHDRAW the submission and change the Bidders Bid status to INCOMPLETE. The Bidder can view thisstatus change in the MY BIDS section of the Sourcewell Procurement Portal Vendor Account. TheBidder is solely responsible to check the MY BIDS section of the Sourcewell Procurement PortalVendor Account periodically after submitting its Bid (and up to the Bid due date). If the Bidders Bidstatus has changed to INCOMPLETE, the Bidder is solely responsible to:1) make any required adjustments to its bid,2) acknowledge the addenda, and3) ensure the resubmitted bid is received through the Sourcewell Procurement Portal no laterthan the Bid Due Date and time shown in the Solicitation Schedule above.D. BID SUBMISSION. Bidders complete bid must be submitted through the Sourcewell ProcurementPortal no later than the date and time specified in the Solicitation Schedule and on the SourcewellProcurement Portal. Any other form of bid submission, whether electronic, paper, or otherwise, will notbe considered by Sourcewell. Late bids will not be considered. It is the Bidders sole responsibility toensure that the bid is received on time. To ensure receipt of the latest information and updates viaemail regarding this solicitation, or if the Bidder has obtained this IFB from a third party, the onus is onthe Bidder to create a Sourcewell Procurement Portal Vendor Account and register for this solicitationopportunity.Within the Procurement Portal, all bids must be digitally acknowledged by an authorized representativeof the Bidder attesting that the information contained in in the bid is true and accurate. By submitting abid, Bidder warrants that the information provided is true, correct, and reliable for purposes ofevaluation for potential contract award. The submission of inaccurate, misleading, or false information isgrounds for disqualification from a contract award and may subject the Bidder to remedies available bylaw.It is recommended that Bidders allow sufficient time to upload the bid and to resolve any issues thatmay arise. The time and date that a bid is received by Sourcewell is solely determined by the SourcewellProcurement Portal web clock. In the event of problems with the Sourcewell Procurement Portal, followthe instructions for technical support posted in the portal. It may take up to 24 hours to respond tocertain issues.
Rev. 4/2023 Sourcewell IFB #CA101723Indefinite DeliveryIndefinite Quantity Construction Contracts in the State of CaliforniaPage 7 Upon successful submission of a bid, the Portal will automatically generate a confirmation email to theBidder. If the Bidder does not receive a confirmation email, contact Sourcewells support provider [email protected]. GENERAL BID REQUIREMENTS. Bids must be: In substantial compliance with the requirements of this IFB or it will be considerednonresponsive and be rejected Completea bid will be rejected if it is conditional or incompleteSubmitted in English Valid and irrevocable for 180 days following the Bid Due DateAny and all costs incurred in responding to this IFB will be borne by the Bidder.F. BID MODIFICATION WITHDRAWAL. A submitted bid may not be modified, withdrawn, or cancelledby the Bidder for a period of 180 calendar days following the time and date designated for the receipt ofbids. Prior to the deadline for submission of bids, any bid submitted may be modified or withdrawnthrough the Sourcewell Procurement Portal.G. OPENING. The Opening of Bids will be conducted electronically through the Sourcewell ProcurementPortal. A list of all Bidders will be made publicly available in the Sourcewell Procurement Portal after theBid Due Date, but no later than the Opening time listed in the Solicitation Schedule.To view the list of Bidders, verify that the Sourcewell Procurement Portal opportunities list search is setto All or Closed. The solicitation status will automatically change to Closed after the Bid Due Dateand Time.VIII. EVALUATION AND AWARDA. EVALUATION. Only responsive bids will be evaluated. A responsive bid must have been submitted ontime and materially satisfy all mandatory requirements identified in this IFB. Deviations or exceptionsstipulated in Bidders response, while possibly necessary in the view of the Bidder, may result indisqualification.B. AWARD(S). It is the intent of Sourcewell to award each Contract to the lowest, responsive,responsible Bidder(s) based on the Combined Adjustment Factor as calculated by Sourcewell within eachRegion.C. CONTRACT TERM. The term of the resulting contract(s) awarded by Sourcewell under thissolicitation will be one year. Sourcewell and Contractor may agree to up to five additional oneyearextensions. Sourcewell retains the right to consider additional extensions beyond six years as requiredunder exceptional circumstances.A Bidder will not be awarded more than one same scope Contract within any Region. The maximumnumber of contracts to be initially awarded for each geographic region and contract type are reflected inthe tables below:
Rev. 4/2023 Sourcewell IFB #CA101723Indefinite DeliveryIndefinite Quantity Construction Contracts in the State of CaliforniaPage 8 Region 1:General Building 2 ContractsElectrical 2 ContractsMechanical/HVAC 2 ContractsPaving 2 ContractsRegion 2:General Building 2 ContractsElectrical 2 ContractsMechanical/HVAC 2 ContractsPaving 2 ContractsRegion 3:General Building 2 ContractsElectrical 2 ContractsMechanical/HVAC 2 ContractsPaving 2 ContractsRegion 4:General Building 6 ContractsElectrical 2 ContractsMechanical/HVAC 2 ContractsPaving 2 ContractsRegion 5:General Building 6 ContractsElectrical 2 ContractsMechanical/HVAC 2 ContractsPaving 2 ContractsRegion 6:General Building 6 ContractsElectrical 2 Contracts
Rev. 4/2023 Sourcewell IFB #CA101723Indefinite DeliveryIndefinite Quantity Construction Contracts in the State of CaliforniaPage 9 Mechanical/HVAC 2 ContractsPaving 2 ContractsRoofing/Waterproofing 2 Contracts Region 7:General Building 6 ContractsElectrical 4 ContractsMechanical/HVAC 4 ContractsPaving 4 ContractsRoofing/Waterproofing 4 ContractsFlooring 4 ContractsAbatement Services 4 ContractsLandscaping 2 ContractsPainting 2 Contracts Region 8:General Building 20 ContractsElectrical 6 ContractsMechanical/HVAC 6 ContractsPaving 6 ContractsRoofing/Waterproofing 6 ContractsFlooring 4 ContractsAbatement Services 4 ContractsPainting 4 ContractsLow Voltage Systems 4 ContractsFire Protection 2 ContractsPlumbing 4 ContractsSanitation Systems 4 ContractsLimited Specialty Contracts (C61) 6 ContractsRegion 9:General Building 8 Contracts
Rev. 4/2023 Sourcewell IFB #CA101723Indefinite DeliveryIndefinite Quantity Construction Contracts in the State of CaliforniaPage 10 Electrical 4 ContractsMechanical/HVAC 4 ContractsPaving 4 ContractsRoofing/Waterproofing 4 ContractsFlooring 4 ContractsAbatement Services 4 ContractsPainting 2 ContractsPlumbing 4 ContractsLandscaping 2 ContractsSolar 2 ContractsRegion 10:General Building 4 ContractsElectrical 2 ContractsMechanical/HVAC 2 ContractsPainting 2 ContractsRoofing/Waterproofing 2 ContractsSourcewell reserves the right to award additional contracts from this solicitation, above the statedmaximum number, if it is determined to be in the best interests of Sourcewell and participatingentities, for a period of 180 Days (or longer, if mutually agreeable to both the bidder and Sourcewell).Sourcewell retains the right to waive any informality in a Bidders response. Sourcewell reserves theright to reject all bids and advertise again if, in Sourcewells opinion, the bids received do not meet orexceed the minimum needs and expectations of Sourcewell and its participating entities.Competitive Range.If Sourcewellreceives a wide margin of bid Adjustment Factors, either too high ortoo low, then the Sourcewell Bid evaluation committee may establish a Competitive Range for the IFB. Ifit is determined that a Bidders Combined Adjustment Factor is too far outside the Competitive Range,then the Bidder can be removed from consideration. The Bidder will be notified that it was determinedto be outside the Competitive Range after award of the contracts.Unbalanced Bid.A Bid may be removed from consideration if it is determined that the Bidder hasmathematically unbalanced its Bid to gain a competitive advantage. The Bid will be considered to beunbalanced if any Adjustment Factor is found to not cover the contractors reasonable actual cost.Those costs would include a reasonable prorated share of its anticipated profit, overhead cost, andother indirect costs that the bidder anticipates for the performance of the work as determined by theSourcewell Bid Review Committee.
Rev. 4/2023 Sourcewell IFB #CA101723Indefinite DeliveryIndefinite Quantity Construction Contracts in the State of CaliforniaPage 11 Other Than Normal Working Hours Adjustment Factors. A Bidders Other Than Normal Working HoursAdjustment Factors must be higher or equal to its Normal Working Hours Adjustment Factors.IX. ASSIGNMENT OF WORKSee the Contract, and General Terms and Conditions for a detailed description of how work will beassigned.X. PROTESTS OF AWARDSAny protest made under this IFB by a Bidder must be in writing, addressed to Sourcewells ExecutiveDirector, and delivered to the Sourcewell office located at 202 12th Street NE, P.O. Box 219, Staples, MN56479. All documents that comprise the complete protest package must be received no later than 10calendar days following Sourcewells notice of contract award(s) or nonaward and must be timestamped by Sourcewell no later than 4:30 p.m., Central Time.A protest must allege a procedural or technical defect, with supporting documentation. A request for reevaluation of a bids content will not be entertained.A protest must include the following items: The name, address, and telephone number of the protester The original signature of the protester or its representative Identification of the solicitation by IFB number A precise statement of the relevant facts Identification of the alleged breakdown in procedure or technical issues Identification of the legal or factual basis Any additional supporting documentation Protest bond in the amount of $20,000, except where prohibited by law or treatyProtests that do not address these elements will not be reviewed.XI. RIGHTS RESERVEDThis IFB does not commit Sourcewell to award any contract, and a bid may be rejected if it isnonresponsive, conditional, incomplete, conflicting, or misleading. Bids that contain false statements ordo not support an attribute or condition stated by the Bidder may be rejected.Sourcewell reserves the right to: Modify or cancel this IFB at any time Reject any and all bids received Reject bids that do not comply with the provisions of this IFB Independently verify any information provided in a Bid Disqualify any Bidder that does not meet the requirements of this IFB, is debarred orsuspended by the United States or Canada, State of Minnesota, participating entitys state;has an officer, or other key personnel, who have been charged with a serious crime; or isbankrupt, insolvent, or where bankruptcy or insolvency are a reasonable prospect; Waive or modify any informalities, irregularities, or inconsistencies in the bids received Clarify any part of a bid
Rev. 4/2023 Sourcewell IFB #CA101723Indefinite DeliveryIndefinite Quantity Construction Contracts in the State of CaliforniaPage 12 Award a contract if only one responsive bid is received if it is in the best interest ofparticipating entities Award a contract to one or more Bidders if it is in the best interest of participating entitiesXII. DISPOSITION OF BIDSAll materials submitted in response tothis IFB will become property of Sourcewell and will becomepublic record in accordance with Minnesota Statutes Section 13.591. It is the Bidders responsibility toclearly identify any data submitted that it considers to be protected. Bidder must also include ajustification for the classification citing the applicable Minnesota law.Sourcewell will not consider the prices submitted by the Bidder to be confidential, proprietary, or tradesecret materials. Financial information, including financial statements, provided by a Bidder is notconsidered trade secret under the statutory definition.The Bidder understands that Sourcewell will reject bids that are marked confidential nonpublic, eithersubstantially or in their entirety.[Map of Regions to Follow]
Rev. 4/2023 Sourcewell IFB #CA101723Indefinite DeliveryIndefinite Quantity Construction Contracts in the State of CaliforniaPage 13 MAP OFSOURCEWELL CONTRACTREGIONSSolicitation #CA101723
Region 1Colusa Humboldt TehamaDel Norte Lake TrinityGlenn Mendocino
Rev. 4/2023 Sourcewell IFB #CA101723Indefinite DeliveryIndefinite Quantity Construction Contracts in the State of CaliforniaPage 14 Region 2Butte Plumas SierraLassen Shasta SiskiyouModacRegion 3El Dorado Placer SutterNevada Sacramento YubaRegion 4Contra Costa Napa SonomaMarin Solano YoloRegion 5Fresno Merced StanislausKings San Joaquin TulareMaderaRegion 6Alameda San Francisco Santa ClaraMonterey San Mateo Santa CruzSan BenitoRegion 7Kern Santa Barbara VenturaSan Luis ObispoRegion 8Los Angeles Riverside San BernardinoOrangeRegion 9Imperial San DiegoRegion 10Alpine Inyo MonoAmador Mariposa TuolumneCalaveras
09/13/2023Addendum No. 1Solicitation Number: IFB #CA101723Solicitation Name: Indefinite DeliveryIndefinite Quantity ConstructionCaliforniaConsider the following to be part of the abovetitled solicitation documents. The remainder of thedocuments remain unchanged.Updated San Diego Housing Commission Provisions, Terms and Conditions, Forms, have beenuploaded to the document section of the bid details page. The document originally posted for this IFBas a .ZIP file entitled San_Diego_Housing_Commission_Provisions,_Terms_and_Conditions,_Formshas been removed and the updated Provisions, Terms and Conditions, and Forms have been uploadedto the Sourcewell Procurement Portal. Please download the .ZIP folder again, now entitled Updated_ San_Diego_Housing_Commission_Provisions,_Terms_and_Conditions,_Forms to ensure you have thecorrect documents.The following listed original files has been removed from the IFB:San_Diego_Housing_Commission_Provisions,_Terms_and_Conditions,_FormsThe following listed files have been inserted in the IFB and are found in the revised .ZIP file:Updated_ San_Diego_Housing_Commission_Provisions,_Terms_and_Conditions,_FormsEnd of AddendumAcknowledgement of this Addendum to IFB CA101723 posted to the Sourcewell Procurement Portalon 09/13/2023, is required at the time of proposal submittal.
09/13/2023Addendum No. 2Solicitation Number: IFB #CA-101723Solicitation Name: Indefinite Delivery-Indefinite Quantity Construction - CaliforniaConsider the following to be part of the above-titled solicitation documents. The remainder of thedocuments remain unchanged.Question 1:CTC specs for region 4,6,7,8 appear to be damaged files and are unable to be opened. Can new filesplease be uploaded?Answer 1:An error in downloading the files contained in ZIP folder IFB_CA-101723_CTC(s),_Contract_Template,_Technical_Specifications,_Terms_and_Conditions has beenidentified.The folder posted to the documents section for this IFB entitled “IFB_CA-101723_CTC(s),_Contract_Template,_Technical_Specifications,_Terms_and_Conditions.zip” has beenupdated with new CTC’s for Region’s 4, 5, 6, and 7. Please redownload the folder to access these newCTC documents.End of AddendumAcknowledgement of this Addendum to IFB CA-101723 posted to the Sourcewell Procurement Portalon 09/13/2023, is required at the time of proposal submittal.
09/19/2023Addendum No. 3Solicitation Number: IFB #CA-101723Solicitation Name: Indefinite Delivery-Indefinite Quantity Construction - CaliforniaConsider the following Questions and Answers to be part of the above-titled solicitationdocuments. The remainder of the documents remain unchanged.Question 1:Can past awarded adjustment factors be provided?Answer 1:Contract documentation, including the bid tabulation, for past solicitations is maintainedon the Sourcewell website. For examples of current Sourcewell-awarded IDIQ contracts,navigate to the page on the Sourcewell website at the following address:https://www.sourcewell-mn.gov/cooperative-purchasing-eziqc/search.Question 2:The ZIP folder titled“Updated_San_Diego_Housing_Commission_Provisions,_Terms_and_Conditions,_Forms”cannot be opened, the error states that the path is too long. Is it possible to shorten thename of the file so it can be opened?Answer 2:An error in downloading the files contained in ZIP folder“Updated_San_Diego_Housing_Commission_Provisions,_Terms_and_Conditions,_Forms”has been identified.The file name under the heading“Updated_San_Diego_Housing_Commission_Provisions,_Terms_and_Conditions,_Forms”has been shortened and can now be opened. Download this file to access the documents.
Question 3:We have reviewed the IFB documents but do not find any bid submissiondocuments? Are the bid documents going to be released at a later date?Answer 3: All solicitation documents have been uploaded to the Sourcewell Procurement Portal. Allbids must be submitted through the Sourcewell Procurement Portal. End of Addendum Acknowledgement of this Addendum to IFB #CA-101723 posted to the SourcewellProcurement Portal on 09/19/2023, is required at the time of proposal submittal.
09/25/2023Addendum No. 4Solicitation Number: IFB #CA-101723Solicitation Name: Indefinite Delivery-Indefinite Quantity Construction - CaliforniaConsider the following to be part of the above-titled solicitation documents. Theremainder of the documents remain unchanged.***Due to a technical error, Table 1: Bidder Identity, was omitted. This table has nowbeen added to the Sourcewell Procurement Portal.***Question 1:I am unclear on the bonding requirement necessary for this bid. What are the bondingrequirements to submit a bid to this solicitation? Do we present our current bondingcapability, and then Sourcewell determines if it is sufficient for the contract?Or is there a given level of bonding capability that we need to show?Answer 1:The bonding requirement to submit a bid for this solicitation is to simply provide acurrent letter from your bonding company stating what your capacity is. It is up to youand the bonding company to determine how best to present this information, buttypically a single and aggregate total is provided.On a per project basis, additional bonds may be required by the Participating Entity.Refer to General Terms and Conditions, specifically article IV, L, Bonds: Payment andPerformance or Material and Workmanship.End of AddendumAcknowledgement of this Addendum to IFB #CA-101723 posted to the SourcewellProcurement Portal on 09/25/2023, is required at the time of proposal submittal.
09/29/2023 Addendum No. 5 Solicitation Number: IFB #CA-101723Solicitation Name: Indefinite Delivery-Indefinite Quantity Construction - CaliforniaConsider the following Questions and Answers to be part of the above-titled solicitationdocuments. The remainder of the documents remain unchanged. Question 1:If a Parent Company has multiple trade subsidiaries with separate tax identification numbers and business licenses, should they submit as the Parent Company listing the subsidiary groups and ID numbers? Should the subsidiaries all submit separately?Answer 1:A Parent Company may demonstrate its willingness and capability of providing all or a majority of the work as specified in the Construction Task Catalog through subcontracts with its subsidiary companies. Article III, Part C requires Bidders responding to the trade-specific contract opportunities listed in the IFB to perform at least 51% of the contracted work through its own forces.If any Bidder for a trade-specific contract opportunity cannot itself complete at least51% of the contracted work, the Bidder may be deemed nonresponsive. Article IV, Part B states a Bid is a representation of the Bidder that "its Bid is premisedupon performing and furnishing the Work required by this IFB.” If a Bidder is not able to perform or furnish the Work as demonstrated through the requirements of Article III, the Bidder may be deemed nonresponsive. Bidders should ensure it is responsive to the requirements as defined in Article III basedupon the type of contract opportunity for which it intends to Bid. Question 2:What is the local office requirement?
Answer 2:Bidders must demonstrate a physical presence within the geographic boundary of the region(s), or adjacent region(s) to which they are bidding as ” Question 3: The general contractor is to provide adjustment factors for self-performed tasks. Do we provide adjustment factors for subcontracted work as well? Answer 3:The general contractor will provide an adjustment factor to cover all tasks in theConstruction Task Catalog. The adjustment factor includes work that may be self-performed or completed by a subcontractor. Question 4: Will as-built drawings be required in a specific format? i.e. CAD, Revit, Acrobat, basic hand drawn?Answer 4: The necessity and format of as-built drawings will be determined on a project-by-project basis and determined during the Joint Scope Question 5: Regarding construction trailers, if the contractor does not need a trailer, but the owner is stating they want one for the project, then we use the catalog to add the trailer to the proposal? Does the catalog include power, furniture, etc.? Answer 5:If the owner is requiring an on-site construction trailer, then costs for the trailer, equipment, furniture, power can be pulled out of line items from the CTC. Determinations on this are often made during the Joint Scope Question 6: We have a headquarter office in Los Angeles County and have a branch trailer office inSanta Barbara County. Can we use that trailer office address and bid the contract for Region 7? Answer 6: Refer to question two of this addendum and IFB Article III, D.
Question 7:Is there an estimated number of bidders that you're expecting?Answer 7: No. End of Addendum Acknowledgement of this Addendum to IFB #CA-101723 posted to the Sourcewell Procurement Portal on 09/29/2023, is required at the time of proposal submittal.
10/02/2023Addendum No. 6Solicitation Number: IFB #CA-101723Solicitation Name: Indefinite Delivery-Indefinite Quantity Construction - CaliforniaConsider the following Questions and Answers to be part of the above-titled solicitationdocuments. The remainder of the documents remain unchanged.Question 1:Can you please clarify if the bid opening on 10/17 is virtual and open for bidders toattend?Answer 1:Refer to Article V, Part G of the IFB also noted below for reference.OPENING. The Opening of Bids will be conducted electronically through theSourcewell Procurement Portal. A list of all Bidders will be made publiclyavailable in the Sourcewell Procurement Portal after the Bid Due Date, but nolater than the Opening time listed in the Solicitation Schedule.Question 2:What is the procedure for bidding on multiple contract opportunities within aregion? For example there are 20 General Building contracts available in Region 8. Tobid all 20 contracts do you change the factor for each contract and submit?Answer 2:You will only enter one set of adjustment factors for each trade per region being bid.The same adjustment factors are used for all the same trade opportunities. For example,there are 20 contract opportunities available for General Building in Region 8 and youwill use one adjustment factor for all. The 20 lowest bids based on combinedadjustment factors will receive a contract.
End of AddendumAcknowledgement of this Addendum to IFB #CA-101723 posted to the SourcewellProcurement Portal on 10/02/2023, is required at the time of proposal submittal.
10/11/2023Addendum No. 7Solicitation Number: IFB #CA-101723Solicitation Name: Indefinite Delivery-Indefinite Quantity Construction - CaliforniaConsider the following Questions and Answers to be part of the above-titled solicitationdocuments. The remainder of the documents remain unchanged.Question 1:Is there a self performance requirement for bidders responding to a General Buildingsolicitation?Answer 1:Refer to IFB Article III, Part B. “Bidders responding to a General Building solicitation mustbe willing and capable of providing all or a majority of the various types of constructionwork as specified in the Construction Task Catalog either through its own forces or byusing subcontractors. Bidder must provide documentation of all applicable requiredlicensure(s).”Question 2:For Table 3: Office Address(s), is the Contractor required to have a fully operating officein each region that its submitting the bids for? For example, would a physical officeaddress of a Contractor's headquarter in Los Angeles County be suitable to submit for abid for Region 9 (San Diego, Imperial)?Answer 2:Refer to IFB Article III, Part D. Each bidder must have a physical presence in or adjacentto each region to which they are submitting a bid. In the example, Los Angeles County isin Region 8 which is adjacent to Region 9 on the Map of Sourcewell Contract Regionsmaking the office location in Los Angeles County suitable to bid in Region 9.
Question 3:Can a contractor make a request to see a sample bid package?Answer 3:Contract documentation, including the bid tabulation, for past solicitations is maintained on the Sourcewell website. For examples of current Sourcewell-awarded IDIQ contracts, navigate to the page on the Sourcewell website at the following address: https://www.sourcewell-mn.gov/cooperative-purchasing-eziqc/search. End of AddendumAcknowledgement of this Addendum to IFB #CA-101723 posted to the SourcewellProcurement Portal on 10/11/2023, is required at the time of proposal submittal.
Solicitation Opening RecordDate of opening: October 17, 2023Sourcewell posted Invitation for Bids #CA-101723, for the procurement of Indefinite Delivery IndefiniteQuantity Construction Contracts in the State of California, on the Sourcewell Procurement Portal [proportal.sourcewell-mn.gov] on Tuesday, September 12, 2023, and the solicitation remained in an open status within the portal until October 17, 2023, at 4:30 pm CT. The Invitation for Bids required that all bids be submitted through the Sourcewell Procurement Portal no later than 4:30 pm CT on October 17, 2023, the date and time specified in the Solicitation Schedule.The undersigned certify that all responses received on Invitation for Bids #CA-101723 were submitted through the Sourcewell Procurement Portal, and that each Bidder’s response material was digitally sealed upon submission and remained inaccessible until the due date and time specified in the Solicitation Schedule.Responses were received from the following:ABM Building Solutions, LLC - Submitted - Mon Oct 16, 2023 2:45:35 PMABM Electrical and Lighting Solutions - Submitted - Mon Oct 16, 2023 2:45:35 PMACCO Engineered Systems, Inc - Submitted - Mon Oct 16, 2023 6:30:55 PMAccurate Construction Company Inc - Submitted - Tue Oct 17, 2023 3:19:32 PMAir Systems, Inc. - Submitted - Tue Oct 17, 2023 3:19:32 PMAlco Building Solutions - Submitted - Tue Oct 17, 2023 3:22:47 PMAll Source Coatings Inc. - Submitted - Mon Oct 16, 2023 6:17:59 PMAll Source Tile Inc. - Submitted - Mon Oct 16, 2023 7:26:21 PMAME Builders Inc - Submitted - Tue Oct 17, 2023 11:22:08 AMAMTEK Construction - Submitted - Tue Oct 17, 2023 1:48:25 PMAngeles Contractor, Inc. - Submitted - Mon Oct 16, 2023 7:00:43 PMAusonio Inc. - Submitted - Tue Oct 17, 2023 1:01:34 PMBalleza Painting Inc - Submitted - Tue Oct 17, 2023 2:21:57 PMCalifornia Coast Carpet & Flooring - Submitted - Mon Oct 16, 2023 7:33:37 PMCapitol Carpet Company, Inc. - Submitted - Mon Oct 16, 2023 8:32:59 PMCORE West, Inc. - Submitted - Tue Oct 17, 2023 8:12:50 AMDewberry Design-Builders Inc. - Submitted - Tue Oct 17, 2023 2:00:46 PMDurham Construction Company, Inc. - Submitted - Tue Oct 17, 2023 4:29:16 PMElegant Construction Inc. - Submitted - Sat Oct 14, 2023 6:19:23 PMExpress Energy Services Inc. - Submitted - Tue Oct 17, 2023 12:24:01 PMGrondin Construction Inc - Submitted - Thu Oct 12, 2023 12:19:09 PMHarry H. Joh Construction Inc. - Submitted - Mon Oct 16, 2023 2:51:32 PMHorizons Construction Company Int'l Inc. - Submitted - Tue Oct 17, 2023 2:58:59 PMJ & H Engineering General Contractors, Inc. - Submitted - Mon Oct 16, 2023 3:22:51 PMJ G CONTRACTING - Submitted - Mon Oct 16, 2023 1:18:49 PMLDCo., Inc - Submitted - Tue Oct 17, 2023 2:37:23 PM
Mackone Development Inc - Submitted - Tue Oct 17, 2023 1:46:37 PM Mak Construction & Project Management - Submitted - Tue Oct 17, 2023 12:38:24 PM MDJ Management, LLC - Submitted - Mon Oct 16, 2023 9:48:29 PM Mesa Energy Systems, Inc. - Submitted - Tue Oct 17, 2023 10:48:33 AM MIK Construction Inc. - Submitted - Tue Oct 17, 2023 1:23:33 PM Newton Construction and Management, Inc. - Submitted - Fri Oct 13, 2023 12:27:22 PM North Star Construction and Engineering, Inc. - Submitted - Tue Oct 17, 2023 4:21:41 PM Pacific Building Group - Submitted - Tue Oct 17, 2023 3:37:17 PM QUINCON, INC. - Submitted - Tue Oct 17, 2023 4:16:45 PM Rite-Way Roof Corporation - Submitted - Tue Oct 17, 2023 2:33:23 PM - SJD&B, Inc. - Submitted - Tue Oct 17, 2023 2:33:54 PM Staples Construction - Submitted - Mon Oct 16, 2023 5:10:21 PM Strategic Mechanical, Inc. - Submitted - Tue Oct 17, 2023 1:32:43 PM Terra West Construction Inc. - Submitted - Tue Oct 17, 2023 3:58:30 PM Turelk, Inc. - Submitted - Tue Oct 17, 2023 2:03:29 PM Vincor Construction, Inc. - Submitted - Mon Oct 16, 2023 1:55:43 PM Vortex Construction - Submitted - Tue Oct 17, 2023 4:10:47 PM Wildscape Restoration Inc., dba Urban Greening - Submitted - Tue Oct 17, 2023 4:21:01 PM World Wide Construction - Submitted - Tue Oct 17, 2023 2:45:15 PM Wyatt Trapp, Inc. - Submitted - Mon Oct 16, 2023 1:08:19 PM The Bids were opened electronically, and a list of all Bidders was made publicly available in the Sourcewell Procurement Portal, on October 17, 2023, at 4:30:00 pm CT. All responsive bids were then submitted for review by the Sourcewell Bid Evaluation Committee. Brandon Town, NIGP-CPP, CPSM, CPSD, Procurement Analyst Craig West, Procurement Analyst
,)%&$,QGHILQLWH'HOLYHU\,QGHILQLWH4XDQWLW\&RQVWUXFWLRQ&DOLIRUQLD9HQGRU'HWDLOV&RPSDQ\1DPH +RUL]RQV&RQVWUXFWLRQ&RPSDQ\,QW
O,QF$GGUHVV
:0HDWV$YHQXH2UDQJH&DOLIRUQLD
&RQWDFW
0LFKDHO2UWHJD(PDLO
PLNH#KRUL]RQVFFLFRP3KRQH
)D[
+67
6XEPLVVLRQ'HWDLOV&UHDWHG2Q
7XHVGD\6HSWHPEHU
6XEPLWWHG2Q
7XHVGD\2FWREHU
6XEPLWWHG%\
0LFKDHO2UWHJD(PDLO
PLNH#KRUL]RQVFFLFRP7UDQVDFWLRQ
EII
EDHEIHFEI6XEPLWWHU
V,3$GGUHVV
Bid Number: IFB #CA-101723 Vendor Name: Horizons Construction Company Int'l Inc. Page 1493 of 1995 6FKHGXOHRI3ULFHV7KH&RQWUDFWRUKHUHE\ELGVDQGRIIHUVWRHQWHULQWRWKHFRQWUDFWUHIHUUHGWRDQGWRVXSSO\DQGGRDOORUDQ\SDUWRIWKH:RUNZKLFKLVVHWRXWRUFDOOHGIRUDVSDUWRIWKHVHVROLFLWDWLRQV,I\RXGRQRWZLVKWRELGRQDSDUWLFXODUFRQWUDFWVROLFLWDWLRQ\RXPXVWVHOHFWWKHER[VWDWLQJWKDW\RXDUHQRWVXEPLWWLQJIRUWKDWSDUWLFXODURSSRUWXQLW\ 'HQRWHVD0$1'$725<ILHOG&DOLIRUQLD5HJLRQ(DFK%LGGHUPXVWVXEPLWILYH
$GMXVWPHQW)DFWRUVWREHDSSOLHGWRWDVNVZLWKLQWKH&RQVWUXFWLRQ7DVN&DWDORJ &7&
6RXUFHZHOO&DOLIRUQLD5HJLRQ%LGGHUVUHVSRQGLQJWRD*HQHUDO%XLOGLQJVROLFLWDWLRQPXVWEHZLOOLQJDQGFDSDEOHRISURYLGLQJDOORUDPDMRULW\RIWKHYDULRXVW\SHVRIFRQVWUXFWLRQZRUNDVVSHFLILHGLQWKH&RQVWUXFWLRQ7DVN&DWDORJ%LGGHUPD\SURYLGHWKHZRUNXVLQJLWVRZQIRUFHVRUE\XVLQJVXEFRQWUDFWRUV%LGGHUVUHVSRQGLQJWRWKH(OHFWULFDO3DYLQJDQGRU0HFKDQLFDO+9$&VROLFLWDWLRQVZLOOSHUIRUPDWOHDVWRIDOOFRQWUDFWHGZRUNZLWKLWVRZQRUJDQL]DWLRQDQGIRUFHV7KHELGGHUPXVWLQFOXGHWKHDGPLQLVWUDWLYHIHHLQFDOFXODWLQJWKH&RQWUDFWRU¶V$GMXVWPHQW)DFWRUV'HWDLOHGLQIRUPDWLRQDERXW6RXUFHZHOO¶VDGPLQLVWUDWLYHIHHFDQEHIRXQGLQWKH*HQHUDO7HUPVDQG&RQGLWLRQV:HZLOOQRWEHVXEPLWWLQJIRU&DOLIRUQLD5HJLRQ6ROLFLWDWLRQ7UDGH6ROLFLWDWLRQ1XPEHU%LGGLQJ $GMXVWPHQW)DFWRU1250$/:25.O1*+285635(9$O/O1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU27+(57+$11250$/:25.,1*+285635(9$,/,1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU6(&85(')$&,/,7,(626+3'35(9$,/,1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU$//81,21:$*(352-(&76$GMXVWPHQW)DFWRU12135(35,&('&RPELQHG$GMXVWPHQW)DFWRU*HQHUDOௐ%XLOGLQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ(OHFWULFDO<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ3DYLQJ<HV1R
7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ0HFKDQLFDO+9$&<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ&DOLIRUQLD5HJLRQ(DFK%LGGHUPXVWVXEPLWILYH
$GMXVWPHQW)DFWRUVWREHDSSOLHGWRWDVNVZLWKLQWKH&RQVWUXFWLRQ7DVN&DWDORJ &7&
6RXUFHZHOO&DOLIRUQLD5HJLRQ%LGGHUVUHVSRQGLQJWRD*HQHUDO%XLOGLQJVROLFLWDWLRQPXVWEHZLOOLQJDQGFDSDEOHRISURYLGLQJDOORUDPDMRULW\RIWKHYDULRXVW\SHVRIFRQVWUXFWLRQZRUNDVVSHFLILHGLQWKH&RQVWUXFWLRQ7DVN&DWDORJ%LGGHUPD\SURYLGHWKHZRUNXVLQJLWVRZQIRUFHVRUE\XVLQJVXEFRQWUDFWRUV%LGGHUVUHVSRQGLQJWRWKH(OHFWULFDO3DYLQJDQGRU0HFKDQLFDO+9$&VROLFLWDWLRQVZLOOSHUIRUPDWOHDVWRIDOOFRQWUDFWHGZRUNZLWKLWVRZQRUJDQL]DWLRQDQGIRUFHV7KHELGGHUPXVWLQFOXGHWKHDGPLQLVWUDWLYHIHHLQFDOFXODWLQJWKH&RQWUDFWRU¶V$GMXVWPHQW)DFWRUV'HWDLOHGLQIRUPDWLRQDERXW6RXUFHZHOO¶VDGPLQLVWUDWLYHIHHFDQEHIRXQGLQWKH*HQHUDO7HUPVDQG&RQGLWLRQV:HZLOOQRWEHVXEPLWWLQJIRU&DOLIRUQLD5HJLRQ6ROLFLWDWLRQ7UDGH6ROLFLWDWLRQ1XPEHU%LGGLQJ $GMXVWPHQW)DFWRU1250$/:25.O1*+285635(9$O/O1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU27+(57+$11250$/:25.,1*+285635(9$,/,1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU6(&85(')$&,/,7,(626+3'35(9$,/,1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU$//81,21:$*(352-(&76$GMXVWPHQW)DFWRU12135(35,&('&RPELQHG$GMXVWPHQW)DFWRU*HQHUDOௐ%XLOGLQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ(OHFWULFDO<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ3DYLQJ<HV1R
7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ0HFKDQLFDO+9$&<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJBid Number: IFB #CA-101723 Vendor Name: Horizons Construction Company Int'l Inc. Page 1494 of 1995 &DOLIRUQLD5HJLRQ(DFK%LGGHUPXVWVXEPLWILYH
$GMXVWPHQW)DFWRUVWREHDSSOLHGWRWDVNVZLWKLQWKH&RQVWUXFWLRQ7DVN&DWDORJ &7&
6RXUFHZHOO&DOLIRUQLD5HJLRQ%LGGHUVUHVSRQGLQJWRD*HQHUDO%XLOGLQJVROLFLWDWLRQPXVWEHZLOOLQJDQGFDSDEOHRISURYLGLQJDOORUDPDMRULW\RIWKHYDULRXVW\SHVRIFRQVWUXFWLRQZRUNDVVSHFLILHGLQWKH&RQVWUXFWLRQ7DVN&DWDORJ%LGGHUPD\SURYLGHWKHZRUNXVLQJLWVRZQIRUFHVRUE\XVLQJVXEFRQWUDFWRUV%LGGHUVUHVSRQGLQJWRWKH(OHFWULFDO3DYLQJDQGRU0HFKDQLFDO+9$&VROLFLWDWLRQVZLOOSHUIRUPDWOHDVWRIDOOFRQWUDFWHGZRUNZLWKLWVRZQRUJDQL]DWLRQDQGIRUFHV7KHELGGHUPXVWLQFOXGHWKHDGPLQLVWUDWLYHIHHLQFDOFXODWLQJWKH&RQWUDFWRU¶V$GMXVWPHQW)DFWRUV'HWDLOHGLQIRUPDWLRQDERXW6RXUFHZHOO¶VDGPLQLVWUDWLYHIHHFDQEHIRXQGLQWKH*HQHUDO7HUPVDQG&RQGLWLRQV:HZLOOQRWEHVXEPLWWLQJIRU&DOLIRUQLD5HJLRQ6ROLFLWDWLRQ7UDGH6ROLFLWDWLRQ1XPEHU%LGGLQJ $GMXVWPHQW)DFWRU1250$/:25.O1*+285635(9$O/O1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU27+(57+$11250$/:25.,1*+285635(9$,/,1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU6(&85(')$&,/,7,(626+3'35(9$,/,1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU$//81,21:$*(352-(&76$GMXVWPHQW)DFWRU12135(35,&('&RPELQHG$GMXVWPHQW)DFWRU*HQHUDOௐ%XLOGLQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ(OHFWULFDO<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ3DYLQJ<HV1R
7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ0HFKDQLFDO+9$&<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ&DOLIRUQLD5HJLRQ(DFK%LGGHUPXVWVXEPLWILYH
$GMXVWPHQW)DFWRUVWREHDSSOLHGWRWDVNVZLWKLQWKH&RQVWUXFWLRQ7DVN&DWDORJ &7&
6RXUFHZHOO&DOLIRUQLD5HJLRQ%LGGHUVUHVSRQGLQJWRD*HQHUDO%XLOGLQJVROLFLWDWLRQPXVWEHZLOOLQJDQGFDSDEOHRISURYLGLQJDOORUDPDMRULW\RIWKHYDULRXVW\SHVRIFRQVWUXFWLRQZRUNDVVSHFLILHGLQWKH&RQVWUXFWLRQ7DVN&DWDORJ%LGGHUPD\SURYLGHWKHZRUNXVLQJLWVRZQIRUFHVRUE\XVLQJVXEFRQWUDFWRUV%LGGHUVUHVSRQGLQJWRWKH(OHFWULFDO3DYLQJDQGRU0HFKDQLFDO+9$&VROLFLWDWLRQVZLOOSHUIRUPDWOHDVWRIDOOFRQWUDFWHGZRUNZLWKLWVRZQRUJDQL]DWLRQDQGIRUFHV7KHELGGHUPXVWLQFOXGHWKHDGPLQLVWUDWLYHIHHLQFDOFXODWLQJWKH&RQWUDFWRU¶V$GMXVWPHQW)DFWRUV'HWDLOHGLQIRUPDWLRQDERXW6RXUFHZHOO¶VDGPLQLVWUDWLYHIHHFDQEHIRXQGLQWKH*HQHUDO7HUPVDQG&RQGLWLRQV:HZLOOQRWEHVXEPLWWLQJIRU&DOLIRUQLD5HJLRQ6ROLFLWDWLRQ7UDGH6ROLFLWDWLRQ1XPEHU%LGGLQJ $GMXVWPHQW)DFWRU1250$/:25.O1*+285635(9$O/O1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU27+(57+$11250$/:25.,1*+285635(9$,/,1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU6(&85(')$&,/,7,(626+3'35(9$,/,1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU$//81,21:$*(352-(&76$GMXVWPHQW)DFWRU12135(35,&('&RPELQHG$GMXVWPHQW)DFWRU*HQHUDOௐ%XLOGLQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ(OHFWULFDO<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ3DYLQJ<HV1R
7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ0HFKDQLFDO+9$&<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJBid Number: IFB #CA-101723 Vendor Name: Horizons Construction Company Int'l Inc. Page 1495 of 1995 &DOLIRUQLD5HJLRQ(DFK%LGGHUPXVWVXEPLWILYH
$GMXVWPHQW)DFWRUVWREHDSSOLHGWRWDVNVZLWKLQWKH&RQVWUXFWLRQ7DVN&DWDORJ &7&
6RXUFHZHOO&DOLIRUQLD5HJLRQ%LGGHUVUHVSRQGLQJWRD*HQHUDO%XLOGLQJVROLFLWDWLRQPXVWEHZLOOLQJDQGFDSDEOHRISURYLGLQJDOORUDPDMRULW\RIWKHYDULRXVW\SHVRIFRQVWUXFWLRQZRUNDVVSHFLILHGLQWKH&RQVWUXFWLRQ7DVN&DWDORJ%LGGHUPD\SURYLGHWKHZRUNXVLQJLWVRZQIRUFHVRUE\XVLQJVXEFRQWUDFWRUV%LGGHUVUHVSRQGLQJWRWKH(OHFWULFDO3DYLQJ0HFKDQLFDO+9$&DQGRU5RRILQJ:DWHUSURRILQJVROLFLWDWLRQVZLOOSHUIRUPDWOHDVWRIDOOFRQWUDFWHGZRUNZLWKLWVRZQRUJDQL]DWLRQDQGIRUFHV7KHELGGHUPXVWLQFOXGHWKHDGPLQLVWUDWLYHIHHLQFDOFXODWLQJWKH&RQWUDFWRU¶V$GMXVWPHQW)DFWRUV'HWDLOHGLQIRUPDWLRQDERXW6RXUFHZHOO¶VDGPLQLVWUDWLYHIHHFDQEHIRXQGLQWKH*HQHUDO7HUPVDQG&RQGLWLRQV:HZLOOQRWEHVXEPLWWLQJIRU&DOLIRUQLD5HJLRQ6ROLFLWDWLRQ7UDGH6ROLFLWDWLRQ1XPEHU%LGGLQJ $GMXVWPHQW)DFWRU1250$/:25.O1*+285635(9$O/O1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU27+(57+$11250$/:25.,1*+285635(9$,/,1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU6(&85(')$&,/,7,(626+3'35(9$,/,1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU$//81,21:$*(352-(&76$GMXVWPHQW)DFWRU12135(35,&('&RPELQHG$GMXVWPHQW)DFWRU*HQHUDOௐ%XLOGLQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ(OHFWULFDO<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ3DYLQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ0HFKDQLFDO+9$&<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ5RRILQJ:DWHUSURRILQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ&DOLIRUQLD5HJLRQ(DFK%LGGHUPXVWVXEPLWILYH
$GMXVWPHQW)DFWRUVWREHDSSOLHGWRWDVNVZLWKLQWKH&RQVWUXFWLRQ7DVN&DWDORJ &7&
6RXUFHZHOO&DOLIRUQLD5HJLRQ%LGGHUVUHVSRQGLQJWRD*HQHUDO%XLOGLQJVROLFLWDWLRQPXVWEHZLOOLQJDQGFDSDEOHRISURYLGLQJDOORUDPDMRULW\RIWKHYDULRXVW\SHVRIFRQVWUXFWLRQZRUNDVVSHFLILHGLQWKH&RQVWUXFWLRQ7DVN&DWDORJ%LGGHUPD\SURYLGHWKHZRUNXVLQJLWVRZQIRUFHVRUE\XVLQJVXEFRQWUDFWRUV%LGGHUVUHVSRQGLQJWRWKH(OHFWULFDO3DYLQJ0HFKDQLFDO+9$&DQGRU5RRILQJ:DWHUSURRILQJVROLFLWDWLRQVZLOOSHUIRUPDWOHDVWRIDOOFRQWUDFWHGZRUNZLWKLWVRZQRUJDQL]DWLRQDQGIRUFHV7KHELGGHUPXVWLQFOXGHWKHDGPLQLVWUDWLYHIHHLQFDOFXODWLQJWKH&RQWUDFWRU¶V$GMXVWPHQW)DFWRUV'HWDLOHGLQIRUPDWLRQDERXW6RXUFHZHOO¶VDGPLQLVWUDWLYHIHHFDQEHIRXQGLQWKH*HQHUDO7HUPVDQG&RQGLWLRQV:HZLOOQRWEHVXEPLWWLQJIRU&DOLIRUQLD5HJLRQ6ROLFLWDWLRQ7UDGH6ROLFLWDWLRQ1XPEHU%LGGLQJ $GMXVWPHQW)DFWRU1250$/:25.O1*+285635(9$O/O1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU27+(57+$11250$/:25.,1*+285635(9$,/,1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU6(&85(')$&,/,7,(626+3'35(9$,/,1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU$//81,21:$*(352-(&76$GMXVWPHQW)DFWRU12135(35,&('&RPELQHG$GMXVWPHQW)DFWRU*HQHUDOௐ%XLOGLQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ(OHFWULFDO<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ3DYLQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ0HFKDQLFDO+9$&<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ5RRILQJ:DWHUSURRILQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJBid Number: IFB #CA-101723 Vendor Name: Horizons Construction Company Int'l Inc. Page 1496 of 1995 &DOLIRUQLD5HJLRQ(DFK%LGGHUPXVWVXEPLWILYH
$GMXVWPHQW)DFWRUVWREHDSSOLHGWRWDVNVZLWKLQWKH&RQVWUXFWLRQ7DVN&DWDORJ &7&
6RXUFHZHOO&DOLIRUQLD5HJLRQ%LGGHUVUHVSRQGLQJWRD*HQHUDO%XLOGLQJVROLFLWDWLRQPXVWEHZLOOLQJDQGFDSDEOHRISURYLGLQJDOORUDPDMRULW\RIWKHYDULRXVW\SHVRIFRQVWUXFWLRQZRUNDVVSHFLILHGLQWKH&RQVWUXFWLRQ7DVN&DWDORJ%LGGHUPD\SURYLGHWKHZRUNXVLQJLWVRZQIRUFHVRUE\XVLQJVXEFRQWUDFWRUV%LGGHUVUHVSRQGLQJWRWKH(OHFWULFDO3DYLQJ0HFKDQLFDO+9$&5RRILQJ:DWHUSURRILQJ)ORRULQJ$EDWHPHQW6HUYLFHV/DQGVFDSLQJDQGRU3DLQWLQJVROLFLWDWLRQVZLOOSHUIRUPDWOHDVWRIDOOFRQWUDFWHGZRUNZLWKLWVRZQRUJDQL]DWLRQDQGIRUFHV7KHELGGHUPXVWLQFOXGHWKHDGPLQLVWUDWLYHIHHLQFDOFXODWLQJWKH&RQWUDFWRU¶V$GMXVWPHQW)DFWRUV'HWDLOHGLQIRUPDWLRQDERXW6RXUFHZHOO¶VDGPLQLVWUDWLYHIHHFDQEHIRXQGLQWKH*HQHUDO7HUPVDQG&RQGLWLRQV:HZLOOQRWEHVXEPLWWLQJIRU&DOLIRUQLD5HJLRQ6ROLFLWDWLRQ7UDGH6ROLFLWDWLRQ1XPEHU%LGGLQJ $GMXVWPHQW)DFWRU1250$/:25.O1*+285635(9$O/O1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU27+(57+$11250$/:25.,1*+285635(9$,/,1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU6(&85(')$&,/,7,(626+3'35(9$,/,1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU$//81,21:$*(352-(&76$GMXVWPHQW)DFWRU12135(35,&('&RPELQHG$GMXVWPHQW)DFWRU*HQHUDOௐ%XLOGLQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ(OHFWULFDO<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ3DYLQJ<HV1R
7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ0HFKDQLFDO+9$&<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ5RRILQJ:DWHUSURRILQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ)ORRULQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ$EDWHPHQWௐ6HUYLFHV<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ/DQGVFDSLQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ3DLQWLQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ Bid Number: IFB #CA-101723 Vendor Name: Horizons Construction Company Int'l Inc. Page 1497 of 1995 &DOLIRUQLD5HJLRQ(DFK%LGGHUPXVWVXEPLWILYH
$GMXVWPHQW)DFWRUVWREHDSSOLHGWRWDVNVZLWKLQWKH&RQVWUXFWLRQ7DVN&DWDORJ &7&
6RXUFHZHOO&DOLIRUQLD5HJLRQ%LGGHUVUHVSRQGLQJWRD*HQHUDO%XLOGLQJVROLFLWDWLRQPXVWEHZLOOLQJDQGFDSDEOHRISURYLGLQJDOORUDPDMRULW\RIWKHYDULRXVW\SHVRIFRQVWUXFWLRQZRUNDVVSHFLILHGLQWKH&RQVWUXFWLRQ7DVN&DWDORJ%LGGHUPD\SURYLGHWKHZRUNXVLQJLWVRZQIRUFHVRUE\XVLQJVXEFRQWUDFWRUV%LGGHUVUHVSRQGLQJWRWKH/RZ9ROWDJH6\VWHPV(OHFWULFDO3DYLQJ)ORRULQJ)LUH3URWHFWLRQ0HFKDQLFDO+9$&$EDWHPHQW6HUYLFHV5RRILQJ:DWHUSURRILQJ3DLQWLQJ3OXPELQJ6DQLWDWLRQ6\VWHPDQGRU/LPLWHG6SHFLDOW\&RQWUDFWV &
VROLFLWDWLRQVZLOOSHUIRUPDWOHDVWRIDOOFRQWUDFWHGZRUNZLWKLWVRZQRUJDQL]DWLRQDQGIRUFHV7KHELGGHUPXVWLQFOXGHWKHDGPLQLVWUDWLYHIHHLQFDOFXODWLQJWKH&RQWUDFWRU¶V$GMXVWPHQW)DFWRUV'HWDLOHGLQIRUPDWLRQDERXW6RXUFHZHOO¶VDGPLQLVWUDWLYHIHHFDQEHIRXQGLQWKH*HQHUDO7HUPVDQG&RQGLWLRQV:HZLOOQRWEHVXEPLWWLQJIRU&DOLIRUQLD5HJLRQ6ROLFLWDWLRQ7UDGH6ROLFLWDWLRQ1XPEHU%LGGLQJ $GMXVWPHQW)DFWRU1250$/:25.O1*+285635(9$O/O1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU27+(57+$11250$/:25.,1*+285635(9$,/,1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU6(&85(')$&,/,7,(626+3'35(9$,/,1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU$//81,21:$*(352-(&76$GMXVWPHQW)DFWRU12135(35,&('&RPELQHG$GMXVWPHQW)DFWRU*HQHUDOௐ%XLOGLQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ(OHFWULFDO<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ3DYLQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ0HFKDQLFDO+9$&<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ5RRILQJ:DWHUSURRILQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ)ORRULQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ$EDWHPHQWௐ6HUYLFHV<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ3DLQWLQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ/RZௐ9ROWDJHௐ6\VWHPV<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ)LUHௐ3URWHFWLRQ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ3OXPELQJ<HV1R
7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ6DQLWDWLRQௐ6\VWHP<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ/LPLWHGௐ6SHFLDOW\ௐ&RQWUDFWVௐ &
<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ Bid Number: IFB #CA-101723 Vendor Name: Horizons Construction Company Int'l Inc. Page 1498 of 1995 &DOLIRUQLD5HJLRQ
(DFK%LGGHUPXVWVXEPLWILYH
$GMXVWPHQW)DFWRUVWREHDSSOLHGWRWDVNVZLWKLQWKH&RQVWUXFWLRQ7DVN&DWDORJ &7&
6RXUFHZHOO&DOLIRUQLD5HJLRQ
%LGGHUVUHVSRQGLQJWRD*HQHUDO%XLOGLQJVROLFLWDWLRQPXVWEHZLOOLQJDQGFDSDEOHRISURYLGLQJDOORUDPDMRULW\RIWKHYDULRXVW\SHVRIFRQVWUXFWLRQZRUNDVVSHFLILHGLQWKH&RQVWUXFWLRQ7DVN&DWDORJ%LGGHUPD\SURYLGHWKHZRUNXVLQJLWVRZQIRUFHVRUE\XVLQJVXEFRQWUDFWRUV%LGGHUVUHVSRQGLQJWRWKH(OHFWULFDO3DYLQJ)ORRULQJ$EDWHPHQW6HUYLFHV/DQVFDSLQJ3DLQWLQJ3OXPELQJ6RODU5RRILQJ:DWHUSURRILQJDQGRU0HFKDQLFDO+9$&VROLFLWDWLRQVZLOOSHUIRUPDWOHDVWRIDOOFRQWUDFWHGZRUNZLWKLWVRZQRUJDQL]DWLRQDQGIRUFHV7KHELGGHUPXVWLQFOXGHWKHDGPLQLVWUDWLYHIHHLQFDOFXODWLQJWKH&RQWUDFWRU¶V$GMXVWPHQW)DFWRUV'HWDLOHGLQIRUPDWLRQDERXW6RXUFHZHOO¶VDGPLQLVWUDWLYHIHHFDQEHIRXQGLQWKH*HQHUDO7HUPVDQG&RQGLWLRQV:HZLOOQRWEHVXEPLWWLQJIRU&DOLIRUQLD5HJLRQ 6ROLFLWDWLRQ7UDGH6ROLFLWDWLRQ1XPEHU%LGGLQJ
$GMXVWPHQW)DFWRU1250$/:25.O1*+285635(9$O/O1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU27+(57+$11250$/:25.,1*+285635(9$,/,1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU6(&85(')$&,/,7,(626+3'35(9$,/,1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU$//81,21:$*(352-(&76$GMXVWPHQW)DFWRU12135(35,&('&RPELQHG$GMXVWPHQW)DFWRU*HQHUDOௐ%XLOGLQJ<HV1R
7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ(OHFWULFDO<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ3DYLQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ0HFKDQLFDO+9$&<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ)ORRULQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ$EDWHPHQWௐ6HUYLFHV<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ/DQGVFDSLQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ3DLQWLQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ3OXPELQJ<HV1R
7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ5RRILQJ:DWHUSURRILQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ6RODU<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ Bid Number: IFB #CA-101723 Vendor Name: Horizons Construction Company Int'l Inc. Page 1499 of 1995 &DOLIRUQLD5HJLRQ(DFK%LGGHUPXVWVXEPLWILYH
$GMXVWPHQW)DFWRUVWREHDSSOLHGWRWDVNVZLWKLQWKH&RQVWUXFWLRQ7DVN&DWDORJ &7&
6RXUFHZHOO&DOLIRUQLD5HJLRQ%LGGHUVUHVSRQGLQJWRD*HQHUDO%XLOGLQJVROLFLWDWLRQPXVWEHZLOOLQJDQGFDSDEOHRISURYLGLQJDOORUDPDMRULW\RIWKHYDULRXVW\SHVRIFRQVWUXFWLRQZRUNDVVSHFLILHGLQWKH&RQVWUXFWLRQ7DVN&DWDORJ%LGGHUPD\SURYLGHWKHZRUNXVLQJLWVRZQIRUFHVRUE\XVLQJVXEFRQWUDFWRUV%LGGHUVUHVSRQGLQJWRWKH(OHFWULFDO3DLQWLQJ5RRILQJ:DWHUSURRILQJDQGRU0HFKDQLFDO+9$&VROLFLWDWLRQVZLOOSHUIRUPDWOHDVWRIDOOFRQWUDFWHGZRUNZLWKLWVRZQRUJDQL]DWLRQDQGIRUFHV7KHELGGHUPXVWLQFOXGHWKHDGPLQLVWUDWLYHIHHLQFDOFXODWLQJWKH&RQWUDFWRU¶V$GMXVWPHQW)DFWRUV'HWDLOHGLQIRUPDWLRQDERXW6RXUFHZHOO¶VDGPLQLVWUDWLYHIHHFDQEHIRXQGLQWKH*HQHUDO7HUPVDQG&RQGLWLRQV:HZLOOQRWEHVXEPLWWLQJIRU&DOLIRUQLD5HJLRQ6ROLFLWDWLRQ7UDGH6ROLFLWDWLRQ1XPEHU%LGGLQJ $GMXVWPHQW)DFWRU1250$/:25.O1*+285635(9$O/O1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU27+(57+$11250$/:25.,1*+285635(9$,/,1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU6(&85(')$&,/,7,(626+3'35(9$,/,1*:$*(5$7(352-(&76$GMXVWPHQW)DFWRU$//81,21:$*(352-(&76$GMXVWPHQW)DFWRU12135(35,&('&RPELQHG$GMXVWPHQW)DFWRU*HQHUDOௐ%XLOGLQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ(OHFWULFDO<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ3DLQWLQJ<HV1R
7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ0HFKDQLFDO+9$&<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ5RRILQJ:DWHUSURRILQJ<HV1R 7RௐEHௐFDOFXODWHGௐE\ௐ6RXUFHZHOOௐDVௐGHVFULEHGௐLQௐ,)%ௐ6HFWLRQௐ9ௐ%LGௐ3ULFLQJ6SHFLILFDWLRQV7DEOH %LGGHU,GHQWLW\*HQHUDO,QVWUXFWLRQV
DSSOLHVWRDOO7DEOHV
6RXUFHZHOOSUHIHUVDEULHIEXWWKRURXJKUHVSRQVHWRHDFKTXHVWLRQ'RQRWPHUHO\DWWDFKDGGLWLRQDOGRFXPHQWVWR\RXUUHVSRQVHZLWKRXWDOVRSURYLGLQJDVXEVWDQWLYHUHVSRQVH'RQRWOHDYHDQVZHUVEODQN UHVSRQG³1$´LIWKHTXHVWLRQGRHVQRWDSSO\WR\RX
SUHIHUDEO\ZLWKDQH[SODQDWLRQ
/LQH,WHP4XHVWLRQ 5HVSRQVH
%LGGHUௐ/HJDOௐ1DPHௐ
RQHௐOHJDOௐHQWLW\ௐRQO\
ௐௐ
,QௐWKHௐHYHQWௐRIௐDZDUGௐZLOOௐH[HFXWHௐWKHௐUHVXOWLQJௐFRQWUDFWௐDVௐ6XSSOLHU +RUL]RQVௐ&RQVWUXFWLRQௐ&Rௐ,QW
Oௐ,QF
,GHQWLI\ௐDOOௐVXEVLGLDU\ௐHQWLWLHVௐRIௐWKHௐ%LGGHUௐZKRVHௐHTXLSPHQWௐSURGXFWVௐRUௐVHUYLFHVௐDUHௐLQFOXGHGௐLQௐWKHௐ%LGௐ5HVSRQVH1$ ,GHQWLI\ௐDOOௐDSSOLFDEOHௐDVVXPHGௐQDPHVௐRUௐ'%$ௐQDPHVௐRIௐWKHௐ%LGGHUௐRUௐ%LGGHU VௐVXEVLGLDULHVௐLQௐ/LQHௐௐRUௐ/LQHௐௐDERYH1$
3URYLGHௐ\RXUௐ&$*(ௐFRGHௐRUௐ8QLTXHௐ(QWLW\ௐ,GHQWLILHUௐ
6$0
=/0-0'&.-0
%LGGHUௐ3K\VLFDOௐ$GGUHVV
ௐ:ௐ0HDWVௐ$YHௐ2UDQJHௐ&$ௐ
%LGGHUௐZHEVLWHௐDGGUHVVௐ
RUௐDGGUHVVHV
ZZZKRUL]RQVFFLFRP
%LGGHU
VௐSULPDU\ௐFRQWDFWௐIRUௐWKLVௐELGௐUHVSRQVHௐ
QDPHௐWLWOHௐDGGUHVVௐHPDLOௐDGGUHVVௐ ௐSKRQH
.LQDQௐ.RWUDVKௐ9ௐ3UHVLGHQWNLQDQ#KRUL]RQVFFLFRP %LGGHU
VௐRWKHUௐFRQWDFWVௐIRUௐWKLVௐELGௐUHVSRQVHௐLIௐDQ\ௐ
QDPHௐWLWOHௐDGGUHVVௐHPDLOௐDGGUHVVௐ ௐSKRQH
0LNHௐ2UWHJDௐ(VWLPDWRU0LNH#KRUL]RQVFFLFRP7DEOHD 0DQDJHPHQW3ODQ0DQDJHPHQW7HDPDQG:RUN&DSDELOLWLHV6RXUFHZHOOSUHIHUVDEULHIEXWWKRURXJKUHVSRQVHWRHDFKTXHVWLRQ'RQRWPHUHO\DWWDFKDGGLWLRQDOGRFXPHQWVWR\RXUUHVSRQVHZLWKRXWDOVRSURYLGLQJDVXEVWDQWLYHUHVSRQVH'RQRWOHDYHDQVZHUVEODQN UHVSRQG³1$´LIWKHTXHVWLRQGRHVQRWDSSO\WR\RX
SUHIHUDEO\ZLWKDQH[SODQDWLRQ
/LQH,WHP4XHVWLRQ %LGGHU
V5HVSRQVH
%LGGHUV
Vௐ$XWKRUL]HGௐ5HSUHVHQWDWLYHௐ
QDPHௐWLWOHDGGUHVVௐHPDLOௐDGGUHVVௐ ௐSKRQH
ௐ
7KHௐUHSUHVHQWDWLYHௐPXVWௐKDYHௐDXWKRULW\ௐWRௐVLJQௐWKHௐ³$VVXUDQFHௐRIௐ&RPSOLDQFH´ௐRQௐEHKDOIௐRIௐWKHௐ%LGGHUௐDQGௐLQௐWKHௐHYHQWௐRIௐDZDUGௐZLOOௐEHௐH[SHFWHGௐWRௐH[HFXWHௐWKHௐUHVXOWLQJௐFRQWUDFW .LQDQௐ.RWUDVKௐ9LFHௐ3UHVLGHQWௐRIௐ+RUL]RQVௐ&RQVWUXFWLRQௐ&RPSDQ\ௐ,QW¶Oௐ,QFௐௐ:ௐ0HDWVௐ$YHQXHௐ2UDQJHௐ&$ௐ (PDLO
ௐ.LQDQ#KRUL]RQVFFLFRP3
ௐௐௐ)
ௐௐBid Number: IFB #CA-101723 Vendor Name: Horizons Construction Company Int'l Inc. Page 1500 of 1995 6WDWHௐWKHௐQXPEHUௐRIௐ\HDUVௐ\RXUௐFRPSDQ\ௐKDVௐEHHQௐLQௐWKHௐFRQVWUXFWLRQௐLQGXVWU\ௐWKHௐW\SHௐRIௐZRUNௐ\RXUௐFRPSDQ\ௐVHOISHUIRUPVௐDQGௐWKHௐW\SHௐRIௐZRUNௐ\RXUௐFRPSDQ\ௐW\SLFDOO\ௐVXEFRQWUDFWV+RUL]RQVௐ&RQVWUXFWLRQௐ&RPSDQ\ௐKDVௐEHHQௐLQௐEXVLQHVVௐVLQFHௐௐDQGௐZHௐKDYHௐௐ\HDUVௐRIௐFRQVWUXFWLRQௐH[SHULHQFHௐௐ2YHUௐWKHௐ\HDUVௐZHௐKDYHௐGRQHௐFRQVWUXFWLRQௐSURMHFWVௐIURPௐGLIIHUHQWௐDVSHFWVௐRIௐFRQVWUXFWLRQௐOLNHௐVFKRROVௐSDUNVௐSDUNLQJௐORWVௐDQGௐURDGZRUNௐௐ:HௐKDYHௐDOVRௐGRQHௐSXEOLFௐEXLOGLQJVௐOLNHௐ1HZௐ&ODVVURRPௐ%XLOGLQJVௐ)LUHௐ6WDWLRQVௐ3ROLFHௐ6WDWLRQVௐ&RXUWKRXVHௐDQGௐ3DUNVௐௐ2XUௐVLQJOHௐSURMHFWௐERQGLQJௐFDSDFLW\ௐH[FHHGVௐௐPLOOLRQௐௐௐ2YHUௐWKHௐODVWௐIHZௐ\HDUVௐZHௐDOVRௐKDYHௐEHHQௐFRPSOHWLQJௐ-REௐ2UGHUௐ&RQWUDFWVௐIRUௐVHYHUDOௐFRXQWLHVௐOLNHௐ6DQௐ%HUQDUGLQRௐௐ6DQWDௐ%DUDEUDௐ&RXQW\ௐRIௐ5LYHUVLGHௐ&DOLIRUQLDௐ6WDWHௐ8QLYHUVLW\ௐ3RPRQDௐDQGௐ6DQௐ%HUQDUGLQRௐDVௐDௐ*HQHUDOௐ&RQWUDFWRUௐIRUௐDௐWRWDOௐYDOXHௐRIௐDERXWௐௐPLOOLRQௐSHUௐ\HDUௐௐௐௐௐ:Hௐ6SHFLDOL]HௐLQௐWKHௐIROORZLQJௐDVSHFWVௐRIௐZRUN ௐFRQFUHWHௐJUDGLQJௐGHPROLWLRQௐJHQHUDOௐVLWHௐZRUNௐSOXPELQJௐGU\ZDOOௐIUDPLQJௐSDLQWLQJௐDQGௐFHLOLQJVௐௐ+RUL]RQVௐKROGVௐWKHௐVSHFLDOWLHVௐOLFHQVHௐIRUௐWKHVHௐWDVNVௐ+RUL]RQVௐ&RQVWUXFWLRQௐDOVRௐKROGVௐWKHௐIROORZLQJௐOLFHQVHௐௐ$ௐ%ௐ&ௐ&ௐ&ௐ&ௐ&ௐ&:HௐXVXDOO\ௐVXEௐRXWௐWKHௐIROORZLQJௐWUDGHVௐௐ(OHFWULFDOௐ+9$&ௐXWLOLWLHVௐSDLQWLQJௐLQWHULRUௐGHPROLWLRQௐURXJKௐFDUSHQWU\ௐDQGௐVWUXFWXUDOௐVWHHO 3URYLGHௐDOOௐQDPHVௐDQGௐFRQWDFWௐLQIRUPDWLRQௐIRUௐDQ\ௐNH\ௐSHUVRQQHOௐWKDWௐZLOOௐEHௐDVVLJQHGௐWRௐWKLVௐFRQWUDFW.LQDQௐ.RWUDVKௐ±ௐ
ௐௐௐ.LQDQ#KRUL]RQVFFLFRPௐ(ULFௐ&KRௐ±ௐ
ௐௐௐHULF#KRUL]RQVFFLFRPௐ0LFKDHOௐ2UWHJDௐௐௐ
ௐ
ௐௐPLNH#KRUL]RQVFFLFRPௐ1LGDOௐ%UDQERௐௐௐ
ௐ
ௐௐௐௐ1LGDO#KRUL]RQVFFLFRPௐ$PPDUௐ$OMLMDNOLௐௐ
ௐௐௐௐDPPDU#KRUL]RQVFFLFRPௐ0LNHௐ6DQGHUVௐ±ௐௐ
ௐ
ௐௐௐPVDQGHUV#KRUL]RQVFFLFRPௐௐௐ0XOKDPௐ*KDLDௐௐௐ
ௐ
ௐௐௐௐ0ROKDP#KRUL]RQVFFLFRPௐ5LJREHUWRௐ0DUWLQH]ௐ
ௐௐௐ5LJRP#KRUL]RQVFFLFRPௐ*KDQGLௐ,QQDELௐௐ
ௐ
ௐௐ*KDQGL#KRUL]RQVFFLFRP 'HVFULEHௐWKHௐUHVSRQVLELOLWLHVௐDQGௐGXWLHVௐIRUௐ\RXUௐNH\ௐSHUVRQQHOௐWKDWௐZLOOௐEHௐDVVLJQHGௐWRௐWKLVௐFRQWUDFW.LQDQௐ.RWUDVKௐ±ௐ9LFHௐ3UHVLGHQWௐௐௐ.LQDQௐZLOOௐEHௐWKHௐPDLQௐSRLQWௐRIௐFRQWDFWௐIRUௐWKHௐ-2&ௐFRQWUDFW ௐKHௐZLOOௐEHௐWKHௐNH\ௐSHUVRQQHOௐWRௐDWWHQGௐMRLQWௐVFRSHௐPHHWLQJVௐDQGௐVLJQௐDOOௐQHHGHGௐ173ௐGRFXPHQWDWLRQௐௐ+HௐZLOOௐDOVRௐEHௐFRRUGLQDWLQJௐZRUNௐDQGௐVFKHGXOLQJௐZLWKௐRZQHUVDJHQFLHVௐௐ(ULFௐ&KRௐ±ௐ3URMHFWௐ0DQDJHUௐௐ(VWLPDWRUௐ±ௐ(ULFௐZLOOௐEHௐLQௐFKDUJHௐRIௐDOOௐZRUNௐUHODWHGௐWRௐVLWHௐZRUNௐGHPROLWLRQௐJUDGLQJௐDQGௐH[FDYDWLRQௐ-2&ௐ:RUNௐRUGHUVௐௐ+HௐZLOOௐEHௐDWWHQGLQJௐ-REௐ:DONVௐWKDWௐDUHௐUHODWHGௐWRௐWKLVௐVFRSHௐDQGௐKHௐZLOOௐEHௐSURYLGLQJௐSULFLQJௐIRUௐWKLVௐVFRSHௐRIௐZRUNௐௐ+HௐZLOOௐDOVRௐEHௐVFKHGXOLQJௐKLVௐFUHZௐWRௐSHUIRUPௐWKHௐZRUNௐ0LFKDHOௐ2UWHJDௐ±ௐ3URMHFWௐ0DQDJHUௐௐ(VWLPDWRUௐௐ3URMHFWௐ&RRUGLQDWRUௐ±ௐ0LFKDHOௐZLOOௐKDQGOHௐDOOௐWKHௐGHWDLOHGௐVFRSHௐRIௐZRUNௐDQGௐEXLOGௐSURSRVDOVௐIRUௐ-2&ௐFRQWUDFWௐZRUNௐௐ+HௐZLOOௐEHௐDWWHQGLQJௐWKHௐPHHWLQJVௐUHODWHGௐWRௐWKHௐSURSRVDOௐUHYLHZௐDQGௐFRUUHFWLRQV1LGDOௐ%UDQERௐ±ௐ3URMHFWௐ0DQDJHUௐௐௐ1LGDOௐZLOOௐEHௐUHVSRQVLEOHௐIRUௐYDULRXVௐRIௐRXUௐ-2&ௐFRQWUDFWௐZRUNௐௐ+HௐZLOOௐEHௐUHVSRQVLEOHௐIRUௐPDQDJLQJௐDQGௐDUUDQJLQJௐFUHZVௐIRUௐKLVௐVFRSHௐRIௐZRUNௐௐ3URYLGHௐQHHGHGௐGRFXPHQWDWLRQௐIRUௐWKHVHௐSURMHFWVௐDQGௐKDQGOHௐDOOௐQHFHVVDU\ௐFRQVWUXFWLRQௐSURMHFWUHODWHGௐLVVXHVௐ$PPDUௐ$OMLMDNOLௐௐ3URMHFWௐ0DQDJHUௐ±ௐ$PPDUௐZLOOௐEHௐUHVSRQVLEOHௐIRUௐYDULRXVௐRIௐRXUௐ-2&ௐFRQWUDFWௐZRUNௐௐ+HௐZLOOௐYHULI\ௐDQGௐSXUFKDVHௐLWHPVௐVFKHGXOHௐDௐFUHZௐWRௐZRUNௐRQVLWHௐDQGௐSHUIRUPௐYDULRXVௐGDLO\ௐFRQVWUXFWLRQௐLWHPVௐOLNHௐ6XEPLWWDOVௐ6FKHGXOLQJௐ5),Vௐ'DLO\ௐ5HSRUWVௐHWFௐௐ0ROKDPௐ*KDLD±ௐ3URMHFWௐ(QJLQHHUௐ±ௐ0ROKDPௐZLOOௐEHௐWDNLQJௐFDUHௐRIௐYDULRXVௐRIௐRXUௐ-2&ௐ&RQWUDFWVௐௐ+HௐZLOOௐEHௐPDQDJLQJௐWKHௐSURMHFWௐGRFXPHQWDWLRQௐDQGௐDWWHQGLQJௐPHHWLQJௐDQGௐVFRSHௐPHHWLQJVௐௐ+HௐZLOOௐDOVRௐEHௐUHVSRQVLEOHௐIRUௐSURMHFWௐFORVHRXWV0LNHௐ6DQGHUVௐௐ6LWHௐ6XSHULQWHQGHQWௐ±ௐ0LNHௐZLOOௐKDQGOHௐLWHPVௐUHODWHGௐRQVLWHௐDVௐYHULI\LQJௐGHOLYHULHVௐௐ+HௐLVௐFRPPXQLFDWLQJௐZLWKௐWKHௐIRUHPDQௐDQGௐWKHௐODERUHUVௐRQௐWKHௐZRUNௐWKDWௐQHHGVௐWRௐEHௐGRQHௐௐ0DNHௐVXUHௐWKHௐSURMHFWௐLVௐJHWWLQJௐGRQHௐLQௐDௐWLPHO\ௐDQGௐHIILFLHQWௐPDQQHU 7KHௐFRQWUDFWRUௐLVௐH[SHFWHGௐWRௐSDUWLFLSDWHௐLQௐWKHௐGHYHORSPHQWௐDQGௐGRFXPHQWDWLRQௐRIௐWKHௐGHWDLOHGௐ6FRSHௐRIௐ:RUNௐIRUௐHDFKௐ3XUFKDVHௐ2UGHUௐ([SODLQௐLQௐGHWDLOௐ\RXUௐSURSRVHGௐSDUWLFLSDWLRQௐDQGௐWKHௐVSHFLILFௐTXDOLWLHVௐRIௐ\RXUௐSHUVRQQHOௐWKDWௐZLOOௐDGGௐEHQHILWௐWRௐWKLVௐSURFHVV+RUL]RQVௐZLOOௐILUVWௐDWWHQGௐDௐMRLQWௐVFRSHௐPHHWLQJௐDQGௐEULQJௐLQௐLWVௐRZQௐVXEFRQWUDFWRUVௐWRௐWKHௐPHHWLQJௐDQGௐ:HௐZLOOௐJRௐRYHUௐWKHௐVFRSHௐDQGௐFUHDWHௐDௐEULHIௐUHSRUWௐRIௐWKHௐMRLQWௐVFRSHௐPHHWLQJௐௐ:HௐZLOOௐKDYHௐVXEFRQWUDFWRUVௐVXEPLWௐSULFLQJௐZLWKௐWKHLUௐVFRSHௐVSHFLILHGௐௐ0LFKDHOௐZLOOௐWKHQௐFUHDWHௐDௐGRFXPHQWௐZLOOௐDOOௐWKHௐQHHGHGௐLQIRUPDWLRQௐDERXWௐWKHௐVFRSHௐRIௐZRUNௐIURPௐWKHௐEULHIௐVFRSHௐRIௐZRUNௐUHSRUWௐDQGௐLQIRUPDWLRQௐZHௐJHWௐIURPௐVXEFRQWUDFWRUVௐௐ7KLVௐZLOOௐLQFOXGHௐEUHDNLQJௐGRZQௐWKHௐSURMHFWௐZRUNௐDQGௐJLYLQJௐTXDQWLWLHVௐDQGௐWDNHRIIVௐRIௐLWHPVௐௐ7KHQௐZHௐZLOOௐXSORDGௐRQௐWRௐHJRUGLDQௐௐௐ:HௐZLOOௐWKHQௐEXLOGௐRXUௐSURSRVDOௐEDVHௐRQௐWKHௐ'HWDLOHGௐ6FRSHௐRIௐ:RUNௐௐௐௐ+RUL]RQVௐEHOLHYHVௐLWௐLPSRUWDQWௐWRௐSURYLGHௐDௐZHOOZULWWHQௐGHWDLOHGௐVFRSHௐRIௐZRUNௐVRௐWKDWௐWKHௐZRUNௐLVௐFOHDUHGௐZLWKௐWKHௐRZQHUௐDQGௐDJHQFLHVௐDQGௐWKHௐZRUNHUVௐDQGௐWKHௐSURMHFWௐPDQDJHUV 3URYLGHௐ\RXUௐDSSURDFKௐWRௐWKHௐH[SHGLWLRXVௐFORVHௐRXWௐRIௐ3URMHFWVௐFRUUHFWLRQௐRIௐXQDFFHSWDEOHௐ:RUNௐDQGௐSXQFKௐOLVWௐSURFHGXUHV%HIRUHௐFRPSOHWLRQௐRIௐDௐSURMHFWௐ+RUL]RQVௐ&RQVWUXFWLRQௐZLOOௐEHJLQௐWKHௐFORVHRXWௐSURFHGXUHௐIRUௐWKHௐSURMHFWௐDQGௐSXQFKௐOLVWௐLWHPVௐLQௐDௐWLPHO\ௐPDQQHUௐௐௐௐௐ+RUL]RQVௐZLOOௐSURYLGHௐWKHௐIROORZLQJௐLWHPVௐDQGௐVHUYLFHVௐWRௐWKHௐRZQHUௐௐௐௐ)LQLVKௐDQGௐ&RPSOHWHௐDOOௐ3XQFKௐ/LVWௐ,WHPVௐௐௐௐ3URYLGHௐDOOௐ&ORVHRXWௐ'RFXPHQWVௐDQGௐ:DUUDQW\ௐ0DQXDOௐௐௐௐ6XEPLWWHGௐQHHGௐ&HUWLILFDWLRQVௐௐௐௐௐ3URYLGHௐ(TXLSPHQWௐ6WDUWXSௐDQGௐ7UDLQLQJௐௐௐௐ3URYLGHௐ3URMHFWௐ'RFXPHQWௐ$V%XLOWVௐ$Wௐ+RUL]RQVௐZHௐEHOLHYHௐWKDWௐSURYLGLQJௐWKHௐSURMHFWௐFORVHRXWVௐDQGௐWXUQLQJௐRYHUௐWKHௐSURMHFWௐEDFNௐWRௐWKHௐRZQHUௐRQௐWLPHௐWRௐHQVXUHௐWKDWௐWKHௐRZQHUௐLVௐKDSS\ௐZLWKௐWKHௐSURMHFW VௐRXWFRPHௐDQGௐWKDWௐZHௐVDWLVI\ௐDOOௐWKHௐRZQHU
VௐQHHGV &RQWUDFWRUௐLVௐH[SHFWHGௐWRௐDVVLVWௐ6RXUFHZHOOௐLQௐWKHௐPDUNHWLQJௐRIௐWKHௐ,',4ௐVHUYLFHVௐXQGHUௐWKHௐH]O4&ௐEUDQGௐ3OHDVHௐSURYLGHௐDௐVSHFLILFௐVDOHVௐDQGௐPDUNHWLQJௐSODQௐLQFOXGLQJௐ\RXUௐVWUDWHJ\ௐIRUௐVDOHVௐDQGௐPDUNHWLQJௐWKHௐSHUVRQQHOௐDQGௐWKHLUௐTXDOLILFDWLRQVௐIRUௐVDOHVௐDQGௐPDUNHWLQJௐDQGௐWKHௐIUHTXHQF\ௐDQGௐGXUDWLRQௐRIௐWKHௐHIIRUWV,Iௐ\RXௐKHOGௐDௐSUHYLRXVௐH],4&ௐ&RQWUDFWௐSOHDVHௐGHVFULEHௐKRZௐ\RXௐPDUNHWHGௐDQGௐVROGௐWKHௐFRQWUDFWௐDQGௐOLVWௐ\RXUௐDFFRPSOLVKPHQWV+RUL]RQVௐ&RQVWUXFWLRQௐ&RPSDQ\ௐKDVௐDௐJUHDWௐUHODWLRQVKLSௐZLWKௐPDQ\ௐFLWLHVௐDQGௐFRXQWLHVௐWKURXJKRXWௐWKHௐ6WDWHௐRIௐ&DOLIRUQLDௐௐ2XUௐFRPSDQ\ௐLVௐZHOOௐNQRZQௐIRUௐLWVௐSURIHVVLRQDOௐKDQGOLQJௐRIௐDOOௐGLIIHUHQWௐW\SHVௐRIௐDVSHFWVௐRIௐFRQVWUXFWLRQௐௐ2XUௐSURSRVDOௐVXEPLVVLRQௐSURFHVVௐLVௐNQRZQௐWRௐEHௐRQHௐRIௐWKHௐIDVWHVWௐDQGௐPRVWௐDFFXUDWHௐVHUYLFHVௐFRPSDUHGௐWRௐRWKHUVௐௐ+RUL]RQVௐZDVௐDEOHௐWRௐPD[LPL]HௐLWVௐFRQWUDFWௐZLWKௐWKHௐFLW\ௐRIௐ,UYLQHௐIRUௐWKUHHௐ\HDUVௐLQௐDௐURZௐௐ+RUL]RQVௐHQFRXUDJHGௐWKHௐFLW\ௐWRௐXVHௐVRXUFHZHOOௐIRUௐGLIIHUHQWௐSURMHFWVௐUHODWHGௐWRௐSDUNௐUHKDELOLWDWLRQௐDQGௐDOOௐRWKHUௐ7HQDQWௐ,PSURYHPHQWVௐWKURXJKRXWௐWKHௐFLW\ௐௐௐ+RUL]RQVௐDOVRௐHQFRXUDJHGௐWKHௐ&LW\ௐRIௐ$QDKHLPௐWRௐDGRSWௐWKHௐ6RXUFHZHOOௐSURJUDPௐGXHௐWRௐRXUௐXQLTXHௐUHODWLRQVKLSௐZLWKௐWKHௐFLW\ ௐDௐFRQIHUHQFHௐFDOOௐZDVௐPDGHௐE\ௐ9LFHௐ3UHVLGHQWௐ.LQDQௐ.RWUDVKௐWRௐWKHௐPDQDJHUௐRIௐFRQVWUXFWLRQௐIDFLOLWLHVௐLQௐWKHௐFLW\ௐWU\LQJௐWRௐPDUNHWௐWKHௐ6RXUFHZHOOௐSURJUDPௐWRௐKDQGOHௐFLW\ௐQHHGVௐௐ2QௐWKHௐRWKHUௐKDQGௐ+RUL]RQVௐVHWௐXSௐDௐPHHWLQJௐEHWZHHQௐVRXUFHZHOOௐUHSUHVHQWDWLYHVௐDQGௐWKHௐ&LW\ௐRIௐ3ODFHQWLDௐWRௐLQWURGXFHௐWKHௐVRXUFHZHOOௐSURJUDPௐௐ2WKHUௐHIIRUWVௐLQFOXGHGௐWKHௐ&RXQW\ௐRIௐ5LYHUVLGH ௐGXHௐWRௐ+RUL]RQ
VௐH[FHSWLRQDOௐUHODWLRQVKLSௐZLWKௐWKHௐ&RXQW\ௐRIௐ5LYHUVLGHௐௐ+RUL]RQVௐZDVௐDEOHௐWRௐFRQYLQFHௐWKHௐFRXQW\ௐWRௐGXHௐPXOWLSOHௐSURMHFWVௐXQGHUௐVRXUFHZHOOVௐZKHQௐWKHௐEXGJHWௐGLGௐQRWௐDOORZௐWRௐGRௐLWௐXQGHUௐWKHௐ&RXQW\ௐRIௐ5LYHUVLGHVௐUHJXODUௐ-2&ௐFRQWUDFWௐௐ+RUL]RQVௐZLOOௐSODQௐWRௐLQFRUSRUDWHௐRXUௐHIIRUWVௐWRௐJHWௐRWKHUௐFLWLHVௐDQGௐDJHQFLHVௐWRௐDGDSWௐWRௐWKHௐVRXUFZHOOௐSURJUDP $OOௐ:RUNௐKDVௐDௐPLQLPXPௐZDUUDQW\ௐSHULRGௐRIௐRQHௐ\HDUௐ3OHDVHௐGHVFULEHௐ\RXUௐSURFHVVௐIRUௐWUDFNLQJௐDQGௐSHUIRUPLQJௐZDUUDQW\ௐZRUN+RUL]RQVௐ:LOOௐ&UHDWHௐDௐORJௐRIௐLWHPVௐZLWKௐDௐZDUUDQW\ௐSHULRGௐDQGௐFUHDWHௐDௐWLPHௐIURPௐWKHௐQRWLFHௐRIௐFRPSOHWLRQௐWRௐRQHௐ\HDUௐDIWHUௐWKDWௐGDWHௐௐ:KHQௐWKHௐRZQHUௐQHHGVௐUHSDLUௐRUௐPDLQWHQDQFHௐWRௐZRUNௐSHUIRUPHGௐXQGHUௐFRQWUDFWௐZHௐKDYHௐKRXUௐQRWLFHௐWRௐJRௐRXWௐDQGௐSHUIRUPௐWKHௐUHTXLUHGௐZRUNௐDVௐUHTXHVWHGௐE\ௐWKHௐRZQHUௐRUௐDJHQF\ௐௐௐ$OOௐZDUUDQW\ௐSHULRGௐZRUNௐZLOOௐEHௐGRFXPHQWHGௐDQGௐSODFHGௐLQௐWKHௐRULJLQDOௐORJ 3URYLGHௐDௐFXUUHQWௐOLVWௐRIௐWKHௐQXPEHUௐDQGௐFODVVLILFDWLRQௐRIௐ\RXUௐIXOOௐWLPHௐHPSOR\HHV2ZQHUVௐ±ௐ3URMHFWௐ0DQDJHUVௐௐௐ3URMHFWௐ(QJLQHHULQJௐௐௐ2SHUDWRUVௐௐௐ&HPHQWௐ0DVRQVௐ±ௐௐ3OXV/DERUHUVௐௐௐௐ3OXVBid Number: IFB #CA-101723 Vendor Name: Horizons Construction Company Int'l Inc. Page 1501 of 1995 7DEOHE
0DQDJHPHQW3ODQ&RQWUDFWRU/LFHQVLQJDQG&HUWLILFDWLRQV6RXUFHZHOOSUHIHUVDEULHIEXWWKRURXJKUHVSRQVHWRHDFKTXHVWLRQ'RQRWPHUHO\DWWDFKDGGLWLRQDOGRFXPHQWVWR\RXUUHVSRQVHZLWKRXWDOVRSURYLGLQJDVXEVWDQWLYHUHVSRQVH'RQRWOHDYHDQVZHUVEODQN UHVSRQG³1$´LIWKHTXHVWLRQGRHVQRWDSSO\WR\RX
SUHIHUDEO\ZLWKDQH[SODQDWLRQ
/LQH,WHP4XHVWLRQ %LGGHUV5HVSRQVH
'RHVௐ\RXUௐFRPSDQ\ௐPDLQWDLQௐDௐFXUUHQWௐFRQWUDFWRUௐOLFHQVHௐLQௐWKHௐW\SHௐRIௐZRUNௐ\RXௐDUHௐELGGLQJ"ௐ,IௐVRௐSOHDVHௐXSORDGHGௐDOOௐFRQWUDFWRUௐOLFHQVLQJௐLQௐWKHௐXSORDGௐWDEௐXQGHUௐ&RQWUDFWRUௐ/LFHQVH<(6 'RHVௐ\RXUௐRUJDQL]DWLRQௐKDYHௐDQ\ௐRIௐWKHௐIROORZLQJௐEXVLQHVVௐFHUWLILFDWLRQV ௐ6PDOOௐ%XVLQHVVௐ(QWHUSULVHௐ0LQRULW\ௐ2ZQHGௐ%XVLQHVVௐ(QWHUSULVHௐ:RPDQௐ2ZQHGௐ%XVLQHVVௐ(QWHUSULVHௐ'LVDELOLW\ௐ2ZQHGௐ%XVLQHVVௐ(QWHUSULVHௐ9HWHUDQௐ2ZQHGௐ%XVLQHVVௐ(QWHUSULVHௐ6HUYLFHௐ'LVDEOHGௐ9HWHUDQௐ2ZQHGௐ%XVLQHVVௐ(QWHUSULVHௐ+8%=RQHௐRUௐVLPLODUௐEXVLQHVVௐFHUWLILFDWLRQVFODVVLILFDWLRQV"ௐ3OHDVHௐXSORDGௐDQ\ௐGRFXPHQWDWLRQௐ\RXௐKDYHௐUHJDUGLQJௐWKHVHௐFHUWLILFDWLRQVFODVVLILFDWLRQVௐLQௐWKHௐXSORDGௐWDEௐXQGHUௐ6%('%(5HODWHGௐ&HUWLILFDWLRQ127DEOH 2IILFH$GGUHVV
V
,QDFFRUGDQFHZLWK,)%&$6HFWLRQ,,,'³%LGGHUVPXVWGHPRQVWUDWHDSK\VLFDOSUHVHQFHZLWKLQWKHJHRJUDSKLFERXQGDU\RIWKHUHJLRQ V
RUDGMDFHQWUHJLRQ
V
WRZKLFKWKH\DUHELGGLQJDVLGHQWLILHGLQWKH0DSRI6RXUFHZHOO&RQWUDFW5HJLRQV3OHDVHSURYLGH\RXURIILFHDGGUHVV V
ZLWKLQRUDGMDFHQWWRWKHUHJLRQ
V
\RXDUHELGGLQJ/LQH,WHP 5HJLRQ 2IILFH$GGUHVV
V
5HJLRQௐ 5HJLRQௐ 5HJLRQௐ 5HJLRQௐ 5HJLRQௐ 5HJLRQௐ 5HJLRQௐ 5HJLRQௐ 5HJLRQௐ
5HJLRQௐ 7DEOH
3UHFOXGHGIURP3DUWLFLSDWLQJLQDQ\3XEOLF3URFXUHPHQW$FWLYLWLHVOIZLWKLQWKHSDVWILYH\HDUVWKH%LGGHUKDVEHHQODZIXOO\SUHFOXGHGIURPSDUWLFLSDWLQJLQDQ\SXEOLFSURFXUHPHQWDFWLYLW\ZLWKDIHGHUDOVWDWHRUORFDOJRYHUQPHQWWKHQWKH%LGGHUPXVWSURYLGHDOHWWHUZLWKLWVUHVSRQVHVHWWLQJIRUWKWKHQDPHDQGDGGUHVVRIWKHSXEOLFSURFXUHPHQWXQLWWKHHIIHFWLYHGDWHRIWKHVXVSHQVLRQRUGHEDUPHQWWKHGXUDWLRQRIWKHVXVSHQVLRQRUGHEDUPHQWDQGWKHUHOHYDQWFLUFXPVWDQFHVUHODWLQJWRWKHVXVSHQVLRQRUGHEDUPHQWOIDSSOLFDEOHWKH%LGGHUVKRXOGGHVFULEHVWHSVWDNHQWRLPSURYHDQGHQVXUHWKHVHLVVXHVGRQRWFRQWLQXHWREHDEXUGHQOIWKH%LGGHUKDVKHOGD6RXUFHZHOO,',4&RQWUDFWDQGKDVUHTXHVWHGWKDWWKHFRQWUDFWEHWHUPLQDWHGWKHQWKH%LGGHUPXVWSURYLGHWKHUHDVRQIRUWKHUHTXHVW3OHDVHGHVFULEHRQDVHSDUDWHGRFXPHQWDQGLIDSSOLFDEOHGHVFULEHVWHSVWDNHQWRLPSURYHDQGHQVXUHWKHVHLVVXHVGRQRWFRQWLQXHWREHDEXUGHQ)DLOXUHWRSURYLGHWKLVLQIRUPDWLRQPD\EHJURXQGVIRUGLVTXDOLILFDWLRQ3OHDVH6HOHFWWKH$SSURSULDWH5HVSRQVH%HORZ 12:HKDYHQRWEHHQSUHFOXGHGIURPSDUWLFLSDWLQJLQDQ\SXEOLFSURFXUHPHQWDFWLYLW\ZLWKDIHGHUDOVWDWHRUORFDOJRYHUQPHQW7DEOH $JUHHPHQWWR:RUN2XWVLGHRIWKH*HRJUDSKLF5HJLRQ7KHUHDUHWLPHVWKDWD&RQWUDFWRUPD\EHDVNHGWRSHUIRUPZRUNIRUFHUWDLQ6RXUFHZHOO3DUWLFLSDWLQJ(QWLWLHVWKDWKDYHIDFLOLWLHVLQDUHDVRXWVLGHRIWKHJHRJUDSKLFUHJLRQ%\DFNQRZOHGJLQJ\RXUDFFHSWDQFHEHORZWKH%LGGHULVVD\LQJWKDWWKH\ZLOOFRQVLGHUSHUIRUPLQJZRUNLQVXFKDUHDVLQWKH&RPPRQZHDOWKRURWKHU6WDWHV&RPPRQZHDOWKV7KH&RQWUDFWRUZLOOKDYHWKHRSWLRQWRGHFOLQH3URMHFWVRXWVLGHRIWKH*HRJUDSKLF$UHDLIWKH\VRGHVLUH3OHDVH6HOHFWWKH$SSURSULDWH5HVSRQVH%HORZ <(6&RQWUDFWRUDJUHHVWRFRQVLGHUZRUNLQJLQDUHDVRXWVLGHRIWKH*HRJUDSKLF$UHD Bid Number: IFB #CA-101723 Vendor Name: Horizons Construction Company Int'l Inc. Page 1502 of 1995 7DEOHD
3URMHFW([SHULHQFH7KHDZDUGHG&RQWUDFWRUPXVWKDYHWKHFDSDFLW\DQGFDSDELOLW\WRSHUIRUPPXOWLSOHSURMHFWVDWPXOWLSOHORFDWLRQVVLPXOWDQHRXVO\'HPRQVWUDWHWKLVFDSDFLW\DQGFDSDELOLW\E\SURYLGLQJVL[SURMHFWVWKDWPHHWWKHIROORZLQJLQIRUPDWLRQIRUHDFKSURMHFWRYHUFRPSOHWHGLQWKHODVWWKUHH\HDUV3DVWSXEOLF PXQLFLSDOFRXQW\FRPPRQZHDOWKVWDWHHGXFDWLRQDOLQVWLWXWLRQRUVLPLODU SURMHFWVZLWKLQWKH6WDWHRI&DOLIRUQLDDUHSUHIHUUHG'HVFULSWLRQ 3URMHFW([SHULHQFH 3URMHFW([SHULHQFH
3URMHFW([SHULHQFH
&XVWRPHUௐ&RQWDFWௐ,QIRUPDWLRQௐ
1DPHௐ7LWOHௐ$GGUHVVௐ(PDLOௐ3KRQH
$QGUHௐ6FKPLGWௐௐ'LYLVLRQௐ(QJLQHHULQJௐ/$ௐ&RXQW\ௐ6DQLWDWLRQௐ'LVWULFW ௐ:RUNPDQௐ0LOOௐ5Gௐ:KLWWLHUௐ&$ௐ
DVFKPLGW#ODFVGRUJௐௐௐௐ
ௐ0LFKDHOௐ&RXUWQH\ௐௐ0DQDJHPHQWௐ$QDO\VWௐ,,ௐ&LW\ௐRIௐ,UYLQHௐௐ2DNVௐ&DQ\RQௐௐ,UYLQHௐ&$ௐ PFRXUWQH\#FLW\RILUYLQHRUJௐௐௐௐ
ௐ
*ORULDௐ/RRIERXUURZௐௐ3URMHFWௐ0DQDJHUௐ,,&RXQW\ௐRIௐ6DQௐ%HUQDUGLQRௐ1ௐ$UURZKHDGௐ$YHௐௐ6DQௐ%HUQDUGLQRௐ&$ௐ *ORULD/RRIERXUURZ#UHVVEFRXQW\JRYௐௐ
ௐ3URMHFWௐ7LWOH /$ௐ&RXQW\ௐ6DQLWDWLRQௐ)DFLOLWLHVௐ3DYHPHQWௐDQGௐ)HQFLQJௐ,PSURYHPHQWV&LW\ௐRIௐ,UYLQHௐ8QLYHUVLW\ௐ+LFNVௐ+DUYDUGௐ6DQௐ0DUFRVௐ&ROODJHௐ ௐ3OD]Dௐ3DUNௐ5HVWURRPௐ,PSURYHPHQWV3UDGRௐ3DUNௐ3KDVHௐ,,,ௐ(OHFWULFDOௐ8SJUDGHV3URMHFWௐ/RFDWLRQ ௐ:ௐ6HSXOYHGDௐ%OYGௐௐௐ&DUVRQௐ&$ௐ 9DULRXVௐ/RFDWLRQVௐWKURXJKRXWௐ,UYLQHௐ&$ ௐ(XFOLGௐ$YHௐ&KLQRௐ&$ௐ 3URMHFWௐ'ROODUௐ$PRXQW
3URMHFWௐ6WDUWௐ'DWH
3URMHFWௐ&RPSOHWLRQௐ'DWH %LGGHUVௐNH\ௐSHUVRQQHOௐLQYROYHGௐZLWKௐWKHௐSURMHFW0LNHௐ6DQGHUVௐ
ௐ
.LQDQௐ.RWUDVKௐ
ௐ 1LGDOௐ%UDQERௐ
ௐ
'HVFULSWLRQௐRIௐWKHௐZRUNௐFRPSOHWHG'HPROLWLRQௐRIௐH[LVWLQJௐURDGௐUHJUDGHௐLQVWDOOௐQHZௐJDWHVௐDQGௐIHQFLQJௐSODFHௐQHZௐFODVVௐௐEDVH9DULRXVௐ3DUNௐ,PSURYHPHQWVௐWRௐ3OD\JURXQGௐVXUIDFLQJௐ5HVWURRPௐ,PSURYHPHQWVௐௐ([WHULRUௐ,PSURYHPHQWVௐDQGௐ&RPPXQLW\ௐ%XLOGLQJௐ,PSURYHPHQWV8SJUDGHௐ1HZௐ+LJKௐ9ROWDJHௐ&DEOHVௐDQGௐ7UDQVIRUPHUVௐZLWKVXEVWDWLRQVௐ'LVWULEXWLRQௐ%RDUGVௐWKURXJKௐRXWௐWKHௐ3DUNௐௐ$GGLWLRQDOௐ(OHFWULFDOௐ8SJUDGHVௐWRௐ6QDFNௐ%DUௐ$UHD7DEOHE 3URMHFW([SHULHQFH7KHDZDUGHG&RQWUDFWRUPXVWKDYHWKHFDSDFLW\DQGFDSDELOLW\WRSHUIRUPPXOWLSOHSURMHFWVDWPXOWLSOHORFDWLRQVVLPXOWDQHRXVO\'HPRQVWUDWHWKLVFDSDFLW\DQGFDSDELOLW\E\SURYLGLQJVL[SURMHFWVWKDWPHHWWKHIROORZLQJLQIRUPDWLRQIRUHDFKSURMHFWRYHUFRPSOHWHGLQWKHODVWWKUHH\HDUV3DVWSXEOLF PXQLFLSDOFRXQW\FRPPRQZHDOWKVWDWHHGXFDWLRQDOLQVWLWXWLRQRUVLPLODU SURMHFWVZLWKLQWKH6WDWHRI&DOLIRUQLDDUHSUHIHUUHG'HVFULSWLRQ 3URMHFW([SHULHQFH 3URMHFW([SHULHQFH
3URMHFW([SHULHQFH
&XVWRPHUௐ&RQWDFWௐ,QIRUPDWLRQௐ
1DPHௐ7LWOHௐ$GGUHVVௐ(PDLOௐ3KRQH
5L]DOGௐ%DOX\RWௐ)DFLOLWLHVௐ2SHUDWLRQVௐ0DQDJHU&RXQW\ௐRIௐ5LYHUVLGHௐWKௐ6WUHHWௐQGௐ)ORRUௐௐௐ5LYHUVLGHௐ&$ௐ 5EDOX\RW#ULYFRRUJௐௐௐ
ௐ
(OV\ௐ%DQNVௐௐ3URMHFWௐ0DQDJHUௐ,,&RXQW\ௐRIௐ6DQௐ%HUQDUGLQRௐ1ௐ$UURZKHDGௐ$YHௐௐ6DQௐ%HUQDUGLQRௐ&$ௐ (OV\EDQNV#SIPVEFRXQW\JRYௐௐௐ
ௐ$QQDௐ5RGULJXH]ௐௐ3URMHFWௐ0DQDJHU&RXQW\ௐRIௐ5LYHUVLGHௐ
ௐ0RQURHௐ6WUHHWௐௐ6XLWHௐ%ௐௐௐ,QGLRௐ&$ௐ
DDURGULJXHV#ULYFRRUJௐௐ
ௐ3URMHFWௐ7LWOH 57&ௐ6LWHௐ3HULPHWHUௐ)HQFLQJௐ ௐ/DQGVFDSLQJௐ5HYLVLRQ*OHQௐ+HOHQௐ5HJLRQDOௐ3DUNௐ3UHIDEULFDWHGௐ5HVWURRPௐ,QVWDOODWLRQ,QGLRௐ)DLUJURXQGVௐ6KDOLPDUௐ%XLOGLQJௐ6WUXFWXUDOௐ5RRIௐ5HSDLUV3URMHFWௐ/RFDWLRQ
ௐ&RXQW\ௐ)DUPௐ5Gௐௐ5LYHUVLGHௐ&$ௐ
ௐ*OHQௐ+HOHQௐ3NZ\ௐ6DQௐ%HUQDUGLQRௐ&$ௐ
ௐ$UDELDௐ6WUHHWௐௐ,QGLRௐ&$ௐ
3URMHFWௐ'ROODUௐ$PRXQW
3URMHFWௐ6WDUWௐ'DWH 3URMHFWௐ&RPSOHWLRQௐ'DWH %LGGHUVௐNH\ௐSHUVRQQHOௐLQYROYHGௐZLWKௐWKHௐSURMHFW)D\VDOௐ(VUHEௐௐௐ
ௐ
$PPDUௐ$OMLMDNOLௐ
ௐ +DWHPௐ,EUDKLPௐௐ
ௐ'HVFULSWLRQௐRIௐWKHௐZRUNௐFRPSOHWHG&RQVWUXFWLRQௐ6HFXULW\ௐ)HQFHௐ$URXQGௐHQWLUHௐSHULPHWHUௐRIௐ/RWௐ5HSODFHௐDOOௐJUDVVௐDUHDௐZLWKௐ6\QWKHWLFௐ7XUIௐZLWKௐJUDYHOௐDQGௐGUDLQDJHௐXQGHUQHDWKௐௐௐ&RQVWUXFWௐQHZௐ$'$ௐ5DPSௐDWௐHQWUDQFH&RQVWUXFWLRQௐRIௐ%DVHௐSDGௐDQGௐFRQFUHWHௐDURXQGௐ3UH)DEௐ%XLOGLQJௐௐ,QVWDOOௐE\ௐ8WLOLWLHVௐ3OXPELQJௐDQGௐ(OHLFWULFDOௐ5RXJKௐ,QௐIRUௐ
ௐ3UHௐ)DEௐ%XLOGLQJௐௐௐ,QVWDOOௐE\ௐ&UDQHௐ
ௐSUHௐIDEௐUHVWURRPௐ%XLOGLQJ3HUIRUPௐ6HLVPLFௐ6WUXFWXUDOௐ5HSDLUௐDQGௐ)UDPLQJௐ5HSDLUWRௐWKHௐ6KDOLPDUௐ%XLOGLQJௐ$VVHVVLYHௐ5HSDLUVௐQHHGௐWRௐEHௐPDGHௐWRௐWKHௐURRIௐDQGௐ6WUXFWXUDOௐ&RPSRQHQWVௐௐ5HPRYHௐRIௐWKHௐ&HLOLQJௐWRௐDFFHVVௐWKHௐ6WUXFWXUDOௐIUDPLQJௐௐLQVWDOOௐQHZௐFHLOLQJௐDQGௐOLJKWௐIL[WXUHV'RFXPHQWV(QVXUH\RXUVXEPLVVLRQGRFXPHQW V
FRQIRUPVWRWKHIROORZLQJ
'RFXPHQWVLQ3')IRUPDWDUHSUHIHUUHG'RFXPHQWVLQ:RUG([FHORUFRPSDWLEOHIRUPDWVPD\DOVREHSURYLGHG'RFXPHQWVVKRXOG127KDYHDVHFXULW\SDVVZRUGDV6RXUFHZHOOPD\QRWEHDEOHWRRSHQWKHILOH,WLV\RXUVROHUHVSRQVLELOLW\WRHQVXUHWKDWWKHXSORDGHGGRFXPHQW V
DUHQRWHLWKHUGHIHFWLYHFRUUXSWHGRUEODQNDQGWKDWWKHGRFXPHQWVFDQEHRSHQHGDQGYLHZHGE\6RXUFHZHOO6RXUFHZHOOPD\UHMHFWDQ\UHVSRQVHZKHUHDQ\GRFXPHQW V
FDQQRWEHRSHQHGDQGYLHZHGE\6RXUFHZHOO,I\RXQHHGWRXSORDGPRUHWKDQRQH
GRFXPHQWIRUDVLQJOHLWHP\RXVKRXOGFRPELQHWKHGRFXPHQWVLQWRRQH]LSSHGILOH,IWKH]LSSHGILOHFRQWDLQVPRUHWKDQRQH
GRFXPHQWHQVXUHHDFKGRFXPHQWLVQDPHGLQUHODWLRQWRWKHVXEPLVVLRQIRUPDWLWHPUHVSRQGLQJWR)RUH[DPSOHLIUHVSRQGLQJWRWKH0DUNHWLQJ3ODQFDWHJRU\VDYHWKHGRFXPHQWDV³0DUNHWLQJ3ODQ´8SORDG,QVWUXFWLRQV5HTXLUHG'RFXPHQWV'RFXPHQW&HUWLILFDWHRI*RRG6WDQGLQJ3URYLGHD&HUWLILFDWHRI*RRG6WDQGLQJIRU\RXUEXVLQHVVIURPWKHVWDWHLQZKLFK\RXDUHRUJDQL]HG,IQRVXFKFHUWLILFDWHLVDYDLODEOHDELGGHUPD\XSORDGDVWDWHPHQWWRWKDWHIIHFWWRPHHWWKHPDQGDWRU\XSORDGUHTXLUHPHQW'RFXPHQW%RQGLQJ&RPSDQ\/HWWHU3URYLGHDFXUUHQWOHWWHUIURP\RXUERQGLQJFRPSDQ\VHWWLQJIRUWK\RXUFRPSDQ\¶VDYDLODEOHERQGLQJFDSDFLW\DQGDYDLODELOLW\DQGFRQILUPLQJWKDWLIUHTXLUHG\RXUFRPSDQ\FRXOGSURYLGHODERUDQGPDWHULDOSD\PHQWERQGVDQGSHUIRUPDQFHERQGVIRUFHUWDLQSURMHFWVXSWRWKHERQGLQJFDSDFLW\&HUWLILFDWHRI*RRG6WDQGLQJ&HUWLILFDWHRI6WDWXVZHEVLWHGRZQSGI7XHVGD\2FWREHU
%RQGLQJ&RPSDQ\/HWWHU6XUHW\/HWWHU6RXUFHZHOOSGI7XHVGD\2FWREHU
6%('%(5HODWHG&HUWLILFDWLRQ
RSWLRQDO
&RQWUDFWRU/LFHQVH
RSWLRQDO
$GGLWLRQDO'RFXPHQW
RSWLRQDO
Bid Number: IFB #CA-101723 Vendor Name: Horizons Construction Company Int'l Inc. Page 1503 of 1995 $GGHQGD7HUPVDQG&RQGLWLRQV%,''(5$)),'$9,7$1'$6685$1&(2)&203/,$1&(,FHUWLI\WKDW,DPWKHDXWKRUL]HGUHSUHVHQWDWLYHRIWKH%LGGHUVXEPLWWLQJWKHIRUHJRLQJ%LGZLWKWKHOHJDODXWKRULW\WRELQGWKH%LGGHUWRWKLV$IILGDYLWDQG$VVXUDQFHRI&RPSOLDQFH 7KH%LGGHULVVXEPLWWLQJWKLV%LGXQGHULWVIXOODQGFRPSOHWHOHJDOQDPHDQGWKH%LGGHUOHJDOO\H[LVWVLQJRRGVWDQGLQJLQWKHMXULVGLFWLRQRILWVUHVLGHQFH 7KH%LGGHUZDUUDQWVWKDWWKHLQIRUPDWLRQSURYLGHGLQWKLV%LGLVWUXHFRUUHFWDQGUHOLDEOHIRUSXUSRVHVRIHYDOXDWLRQIRUFRQWUDFWDZDUG 7KH%LGGHULQFOXGLQJDQ\SHUVRQDVVLVWLQJZLWKWKHFUHDWLRQRIWKLV%LGKDVDUULYHGDWWKLV%LGLQGHSHQGHQWO\DQGWKH%LGKDVEHHQFUHDWHGZLWKRXWFROOXGLQJZLWKDQ\RWKHUSHUVRQFRPSDQ\RUSDUWLHVWKDWKDYHRUZLOOVXEPLWD%LGXQGHUWKLVVROLFLWDWLRQ DQGWKH%LGKDVLQDOOUHVSHFWVEHHQFUHDWHGIDLUO\ZLWKRXWDQ\IUDXGRUGLVKRQHVW\7KH%LGGHUKDVQRWGLUHFWO\RULQGLUHFWO\HQWHUHGLQWRDQ\DJUHHPHQWRUDUUDQJHPHQWZLWKDQ\SHUVRQRUEXVLQHVVLQDQHIIRUWWRLQIOXHQFHDQ\SDUWRIWKLVVROLFLWDWLRQRURSHUDWLRQVRIDUHVXOWLQJFRQWUDFW DQGWKH%LGGHUKDVQRWWDNHQDQ\DFWLRQLQUHVWUDLQWRIIUHHWUDGHRUFRPSHWLWLYHQHVVLQFRQQHFWLRQZLWKWKLVVROLFLWDWLRQ$GGLWLRQDOO\LIWKH%LGGHUKDVZRUNHGZLWKDFRQVXOWDQWRQWKHELGWKHFRQVXOWDQW DQLQGLYLGXDORUDFRPSDQ\
KDVQRWDVVLVWHGDQ\RWKHUHQWLW\WKDWKDVVXEPLWWHGRUZLOOVXEPLWDELGIRUWKLVVROLFLWDWLRQ 7RWKHEHVWRILWVNQRZOHGJHDQGEHOLHIDQGH[FHSWDVRWKHUZLVHGLVFORVHGLQWKH%LGWKHUHDUHQRUHOHYDQWIDFWVRUFLUFXPVWDQFHVZKLFKFRXOGJLYHULVHWRDQRUJDQL]DWLRQDOFRQIOLFWRILQWHUHVW$QRUJDQL]DWLRQDOFRQIOLFWRILQWHUHVWH[LVWVZKHQDYHQGRUKDVDQXQIDLUFRPSHWLWLYHDGYDQWDJHRUWKHYHQGRU¶VREMHFWLYLW\LQSHUIRUPLQJWKHFRQWUDFWLVRUPLJKWEHLPSDLUHG 7KHFRQWHQWVRIWKH%LGKDYHQRWEHHQFRPPXQLFDWHGE\WKH%LGGHURULWVHPSOR\HHVRUDJHQWVWRDQ\SHUVRQQRWDQHPSOR\HHRUOHJDOO\DXWKRUL]HGDJHQWRIWKH%LGGHUDQGZLOOQRWEHFRPPXQLFDWHGWRDQ\VXFKSHUVRQVSULRUWR'XH'DWHRIWKLVVROLFLWDWLRQ ,IDZDUGHGDFRQWUDFWWKH%LGGHUZLOOSURYLGHWR6RXUFHZHOO3DUWLFLSDWLQJ(QWLWLHVWKHHTXLSPHQWSURGXFWVDQGVHUYLFHVLQDFFRUGDQFHZLWKWKHWHUPVFRQGLWLRQVDQGVFRSHRIDUHVXOWLQJFRQWUDFW 7KH%LGGHUSRVVHVVHVRUZLOOSRVVHVVEHIRUHGHOLYHULQJDQ\HTXLSPHQWSURGXFWVRUVHUYLFHVDOODSSOLFDEOHOLFHQVHVRUFHUWLILFDWLRQVQHFHVVDU\WRGHOLYHUVXFKHTXLSPHQWSURGXFWVRUVHUYLFHVXQGHUDQ\UHVXOWLQJFRQWUDFW 7KH%LGGHUDJUHHVWRGHOLYHUHTXLSPHQWSURGXFWVDQGVHUYLFHVWKURXJKYDOLGFRQWUDFWVSXUFKDVHRUGHUVRUPHDQVWKDWDUHDFFHSWDEOHWR6RXUFHZHOO3DUWLFLSDWLQJ(QWLWLHV8QOHVVRWKHUZLVHDJUHHGWRWKH%LGGHUPXVWSURYLGHRQO\QHZDQGILUVWTXDOLW\SURGXFWVDQGUHODWHGVHUYLFHVWR6RXUFHZHOO3DUWLFLSDWLQJ(QWLWLHVXQGHUDQDZDUGHG&RQWUDFW 7KH%LGGHUZLOOFRPSO\ZLWKDOODSSOLFDEOHSURYLVLRQVRIIHGHUDOVWDWHDQGORFDOODZVUHJXODWLRQVUXOHVDQGRUGHUV 7KH%LGGHUXQGHUVWDQGVWKDW6RXUFHZHOOZLOOUHMHFW,)%%LGVWKDWDUHPDUNHGFRQILGHQWLDO RUQRQSXEOLFHWF
HLWKHUVXEVWDQWLDOO\RULQWKHLUHQWLUHW\8QGHU0LQQHVRWD6WDWXWHV6HFWLRQ VXEGLYLVLRQDOOSURSRVDOVDUHFRQVLGHUHGQRQSXEOLFGDWDXQWLOWKHHYDOXDWLRQLVFRPSOHWHDQGD&RQWUDFWLVDZDUGHG$WWKDWSRLQWSURSRVDOVEHFRPHSXEOLFGDWD0LQQHVRWD6WDWXWHV6HFWLRQSHUPLWVRQO\FHUWDLQQDUURZO\GHILQHGGDWDWREHFRQVLGHUHGDWUDGHVHFUHWDQGWKXVQRQSXEOLFGDWDXQGHU0LQQHVRWD V'DWD3UDFWLFHV$FW %LGGHUVLWVHPSOR\HHVDJHQWVDQGVXEFRQWUDFWRUVDUHQRW ,QFOXGHGRQWKH³6SHFLDOO\'HVLJQDWHG1DWLRQDOVDQG%ORFNHG3HUVRQV´OLVWPDLQWDLQHGE\WKH2IILFHRI)RUHLJQ$VVHWV&RQWURORIWKH8QLWHG6WDWHV'HSDUWPHQWRIWKH7UHDVXU\IRXQGDW KWWSV
ZZZWUHDVXU\JRYRIDFGRZQORDGVVGQOLVWSGI
,QFOXGHGRQWKHJRYHUQPHQWZLGHH[FOXVLRQVOLVWVLQWKH8QLWHG6WDWHV6\VWHPIRU$ZDUG0DQDJHPHQWIRXQGDW KWWSV
VDPJRY6$0
RU 3UHVHQWO\GHEDUUHGVXVSHQGHGSURSRVHGIRUGHEDUPHQWGHFODUHGLQHOLJLEOHRUYROXQWDULO\H[FOXGHGIURPSURJUDPVRSHUDWHGE\WKH6WDWHRI0LQQHVRWD WKH8QLWHG6WDWHVIHGHUDOJRYHUQPHQWDVDSSOLFDEOH
RUDQ\3DUWLFLSDWLQJ(QWLW\9HQGRUFHUWLILHVDQGZDUUDQWVWKDWQHLWKHULWQRULWVSULQFLSDOVKDYHEHHQFRQYLFWHGRIDFULPLQDORIIHQVHUHODWHGWRWKHVXEMHFWPDWWHURIWKLVVROLFLWDWLRQ%\FKHFNLQJWKLVER[,DFNQRZOHGJHWKDW,DPERXQGE\WKHWHUPVRIWKH3URSRVHU¶V$IILGDYLWKDYHWKHOHJDODXWKRULW\WRVXEPLWWKLV3URSRVDORQEHKDOIRIWKH3URSRVHUDQGWKDWWKLVHOHFWURQLFDFNQRZOHGJPHQWKDVWKHVDPHOHJDOHIIHFWYDOLGLW\DQGHQIRUFHDELOLW\DVLI,KDGKDQGVLJQHGWKH3URSRVDO7KLVVLJQDWXUHZLOOQRWEHGHQLHGVXFKOHJDOHIIHFWYDOLGLW\RUHQIRUFHDELOLW\VROHO\EHFDXVHDQHOHFWURQLFVLJQDWXUHRUHOHFWURQLFUHFRUGZDVXVHGLQLWVIRUPDWLRQ.LQDQ.RWUDVK93UHVLGHQW+RUL]RQV&RQVWUXFWLRLQ&R,QW O,QF7KH3URSRVHUGHFODUHVWKDWWKHUHLVDQDFWXDORUSRWHQWLDO&RQIOLFWRI,QWHUHVWUHODWLQJWRWKHSUHSDUDWLRQRILWVVXEPLVVLRQDQGRUWKH3URSRVHUIRUHVHHVDQDFWXDORUSRWHQWLDO&RQIOLFWRI,QWHUHVWLQSHUIRUPLQJWKHFRQWUDFWXDOREOLJDWLRQVFRQWHPSODWHGLQWKHELG<HV1R7KH%LGGHUDFNQRZOHGJHVDQGDJUHHVWKDWWKHDGGHQGXPDGGHQGDEHORZIRUPSDUWRIWKH%LG'RFXPHQW&KHFNWKHER[LQWKHFROXPQ,KDYHUHYLHZHGWKLVDGGHQGXPEHORZWRDFNQRZOHGJHHDFKRIWKHDGGHQGDBid Number: IFB #CA-101723 Vendor Name: Horizons Construction Company Int'l Inc. Page 1504 of 1995 )LOH1DPH,KDYHUHYLHZHGWKHEHORZDGGHQGXPDQGDWWDFKPHQWV
LIDSSOLFDEOH
3DJHV$GGHQGXPBB,)%B&$B,',4B&DOLIRUQLD:HG2FWREHU $0$GGHQGXPBB,)%B&$B,',4B&DOLIRUQLD7XH2FWREHU
30$GGHQGXPBB,)%B&$B,',4B&DOLIRUQLD)UL6HSWHPEHU
30$GGHQGXPBB,)%B&$B,',4B&DOLIRUQLD0RQ6HSWHPEHU 30$GGHQGXPBB,)%B&$B,',4B&DOLIRUQLD7XH6HSWHPEHU
30$GGHQGXPBB,)%B&$B,',4B&DOLIRUQLD:HG6HSWHPEHU 30$GGHQGXPBB,)%B&$B,',4B&DOLIRUQLD:HG6HSWHPEHU $0
Bid Number: IFB #CA-101723 Vendor Name: Horizons Construction Company Int'l Inc. Page 1505 of 1995 Bid Number: IFB #CA-101723 Vendor Name: Horizons Construction Company Int'l Inc. Page 1506 of 1995 AGREEMENT TO MODIFY AND EXTEND SOURCEWELL CONTRACT #CA-R8-GB-101723-HRZ THIS AGREEMENT TO MODIFY AND EXTEND, Sourcewell Contract #CA-R8-GB-101723-HRZ, is effective upon the date of the last signature below. Sourcewell and Horizons Construction Company Int'l Inc. (“Contractor”) have entered into an Indefinite Delivery-Indefinite Quantity Construction Contract, Contract Number CA-R8-GB-101723-HRZ, with an initial term ending December 5, 2024, and five bilateral options to extend for an additional one-year term (“Contract”). The parties agree to modify and extend the Contract as stated below. CONTRACT MODIFICATION The following is adopted as the new CTC for the Contract effective December 6, 2024: Sourcewell California - Region 8 Pursuant to the Contract, Contractor’s Adjustment Factors remain fixed for the duration of the contract term and are unaffected by this modification. EXERCISE OF OPTION: EXTENSION Contractor and Sourcewell hereby desire and agree to extend the Contract, with the above modification, for the period of December 6, 2024 through December 5, 2025. Sourcewell Horizons Construction Company Int'l Inc. By: __________________________ By: __________________________ Jeremy Schwartz Kinan Kotrash Title: Chief Procurement Officer Title: Vice President Date: Date:
DocusignEnvelopeID:2A9A2EA6-8071-40D2-A3ED-7F956BB8563C 11/15/2024|10:09AMPST11/15/2024|6:11PMCST
Rev. 4/2021 Sourcewell IFB #CA-101723 Indefinite Delivery-Indefinite Quantity Construction Contracts in the State of California Page 1 Indefinite Delivery-Indefinite Quantity Construction Contract Contract Number: CA-R8-GB-101723-HRZ Service Type: General Building This Indefinite Delivery-Indefinite Quantity Construction Contract (Contract) is between Sourcewell, 202 12th Street Northeast, P.O. Box 219, Staples, MN 56479 and Horizons Construction Company Int'l Inc., 432 W Meats Avenue, Orange , California 92865 (Contractor). Sourcewell is a State of Minnesota local government agency and service cooperative created under the laws of the State of Minnesota (Minnesota Statutes Section 123A.21) that offers cooperative procurement solutions to government entities. Participation is open to federal, state and municipal governmental entities, K-12 and higher education entities, nonprofit entities, tribal governments, and other public entities located within the United States. The Contractor desires to contract with Sourcewell to provide construction services to entities that access Sourcewell’s indefinite delivery-indefinite quantity (IDIQ) construction contracts within the Service Region. I. TERM OF CONTRACT A. EFFECTIVE DATE. This Contract, including the General Terms and Conditions incorporated by reference, is effective upon the later of December 6, 2023 or the date of the final signature below. B. EXPIRATION DATE AND EXTENSION. This Contract expires December 5, 2024, unless it is terminated sooner pursuant to Article XX of the General Terms and Conditions, which are incorporated into this Contract by reference. This Contract allows up to five additional one-year extensions upon the request of Sourcewell and written agreement with Contractor. Sourcewell retains the right to consider additional extensions beyond six years as required under exceptional circumstances. II. REGION AND SERVICES The Contractor’s Region is: Region 8. The Contractor’s IDIQ construction service type is: General Building. The Contractor has agreed to perform work outside the Region. III. ADJUSTMENT FACTORS The Contractor will perform any or all Tasks in the Construction Task Catalog for the Unit Price appearing therein multiplied by the following Adjustment Factors. See the General Terms and Conditions for additional information. A. Normal Working Hours – Prevailing Wage Rate Projects: Work performed from 7:00 a.m. until 4:00 p.m. Monday to Friday, except Holidays. The Contractor will perform Tasks during Normal Working Hours for the Unit Price set forth in the CTC multiplied by the Adjustment Factor of: 1.0300.
Rev. 4/2021 Sourcewell IFB #CA-101723 Indefinite Delivery-Indefinite Quantity Construction Contracts in the State of California Page 2 B. Other Than Normal Working Hours – Prevailing Wage Rate Projects: Work performed from 4:00 p.m. to 7:00 a.m. Monday to Friday, and any time Saturday, Sunday and Holidays. The Contractor will perform Tasks during Other Than Normal Working Hours for the Unit Price set forth in the CTC multiplied by the Adjustment Factor of: 1.0700. C. Secured Facilities/OSHPD Prevailing - Wage Rate Projects: Work performed from 7:00 a.m. until 4:00 p.m. Monday to Friday, except Holidays. The Contractor will perform Tasks during Normal Working Hours for the Unit Price set forth in the CTC multiplied by the Adjustment Factor of: 1.0700. D. All Union Wage Projects: Work performed from 7:00 a.m. until 4:00 p.m. Monday to Friday, except Holidays. The Contractor will perform Tasks during Normal Working Hours for the Unit Price set forth in the CTC multiplied by the Adjustment Factor of: 1.0700. E. Non pre-priced Adjustment Factor: To be applied to Work determined not to be included in the CTC but within the general scope of the work: 1.1500. VI. AUTHORIZED REPRESENTATIVE A. Sourcewell's Authorized Representative is its Chief Procurement Officer. B. The Contractor’s Authorized Representative is Kinan Kotrash. If the Contractor’s Authorized Representative changes at any time during this Contract, Contractor must promptly notify Sourcewell in writing. Sourcewell Horizons Construction Company Int'l Inc. By: __________________________ By: __________________________ Jeremy Schwartz Kinan Kotrash Title: Chief Procurement Officer Title: Vice President Date: Date:
CITY OF BELL GARDENS
OFFICE OF THE CITY MANAGER
EXECUTIVE SUMMARY
TO:Honorable Mayor and City Council Members
FROM: Michael B. O’Kelly, City Manager
BY:Bernardo Iniguez, Director of Public Works/Facilities Douglas Benash, P.E., City Engineer
SUBJECT:Consideration of a Resolution Authorizing the Installation of Red Curb “No Parking” Restrictions fronting 7604 Garfield Avenue MEETING DATE:June 9, 2025
RECOMMENDATION: It is staff’s recommendation that the City Council:
1. Adopt the attached Resolution authorizing the installation of 15 feet of red curb “no parking” restrictions fronting 7604 Garfield Avenue; and
2. Rescind Resolution No. 2025-05
BACKGROUND/DISCUSSION:
The Public Works Department received a request from a resident to install red curb at 7604 Garfield Avenue to allow better sight distance while exiting the property. There are multiple units on the property consisting of commercial vehicle repair services in the front units with residential units in the rear that enter and exit from a central driveway. The City addresses these types of requests on a case-by-case basis. Each case is to be evaluated to address safety concerns and maximize parking in residential neighborhoods.
In accordance with City policy, the City Engineer reviewed the request and conducted a field review of the site. Access and sight distance issues are considered as part of the California Manual of Uniform Traffic Control Devices (MUTCD) guidelines. Staff uses this information as a baseline when considering requests for parking restrictions due to sight distance issues from private property. The commercial vehicle repair facilities that front Garfield Avenue utilize on-site and off-site parking. The off-site parking of vehicles near the driveway impacts sight distance for vehicles exiting the property onto Garfield Avenue.
The exiting vehicles are required to make right-turns only due to the landscaped median island on Garfield Avenue.
Following the review, the City Engineer determined that in order to improve line-of-sight conditions, approval of the request for installation of 15 feet of red curb parking restrictions fronting 7604 Garfield Avenue on the southerly portion of the driveway from the top of
curb, is recommended. Only one (1) compact parking space would be eliminated on Garfield Avenue.
On May 6, 2025, the Traffic and Safety Commission approved a recommendation to the City Council for consideration of installation of red curb ‘no parking’ restrictions fronting 7604 Garfield Avenue.
CONCLUSION:
If the City Council adopts the attached resolution, Public Works will proceed with the installation of 15 feet of red curb parking restrictions fronting 7604 Garfield Avenue.
FISCAL IMPACT:
The estimated cost for the installation of red curb is approximately $500, which is available in the current Street Maintenance Budget.
APPROVED ELECTRONICALLY BY:
Michael B. O'Kelly, City Manager
Stephanie Vasquez, City Attorney
Manuel Carrillo, Director of Finance and Administrative Services
RESOLUTION NO. 2025-52
A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF BELL
GARDENS, CALIFORNIA, ESTABLISHING PARKING RESTRICTIONS
IN THE CITY OF BELL GARDENS IN ACCORDANCE WITH CHAPTER
13.20 (PARKING) OF THE BELL GARDENS MUNICIPAL CODE AND
RESCINDING AND SUPERSEDING RESOLUTION NO. 2025-05
WHEREAS, the City Council desires to reaffirm and ratify and re-establish those parking restrictions presently in effect in the City of Bell Gardens as adopted by Resolution No. 2025-05; and
WHEREAS, the City Council desires to install 15 feet of red curb “No Parking” restrictions fronting 7604 Garfield Avenue described in Section (1)(A)(179) of the Parking Restrictions which are attached and incorporated hereto as Exhibit “A.”
NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Bell Gardens as follows:
SECTION 1. The City Council, after consideration of the staff report and presentation, discussion, oral testimony and evidence presented to the City Council, hereby finds that the above recitals are true and correct and incorporated herein.
SECTION 2. Resolution No. 2025- 05 is hereby rescinded, repealed, replaced and superseded in its entirety by this Resolution.
SECTION 3. The City Council hereby approves the Parking Restrictions attached and incorporated hereto as Exhibit “A.”
SECTION 4. The City Clerk shall attest and certify to the passage and adoption of this Resolution and enter it into the book of original resolutions, and it shall become effective immediately upon its approval.
[Signatures on the following page]
Resolution No. 2025-52
2 of 3
PASSED, APPROVED, and ADOPTED this 9th, day of June 2025.
THE CITY OF BELL GARDENS
___________________________
Jorgel Chavez, Mayor
APPROVED AS TO FORM: ATTEST:
____________________________ ___________________________ Stephanie Vasquez Daisy Gomez
City Attorney City Clerk
Resolution No. 2025-52
3 of 3
I, ____________________, City Clerk of the City of Bell Gardens, hereby CERTIFY that City Council Resolution No. ___________was adopted by the Bell Gardens City Council at a regular meeting of the City Council held on ___________________, and was approved and passed by the following vote:
AYES:
NOES:
ABSTAIN:
ABSENT:
__________________________
Daisy Gomez
City Clerk
Exhibit 2 – 7604 Garfield Avenue
Red Curb Restrictions
CITY OF BELL GARDENS
OFFICE OF THE CITY MANAGER
EXECUTIVE SUMMARY
TO:Honorable Mayor and City Council Members
FROM: Michael B. O’Kelly, City Manager
BY:Bernardo Iniguez, Director of Public Works/Facilities Douglas Benash, P.E., City Engineer
SUBJECT:Consideration of a Resolution Authorizing the Placement of Removable Traffic Delineators on Jaboneria Road Fronting the Bell Gardens Elementary School Student Drop Off Zone Exit to be Placed During Drop-Off and Pick-Up Time
MEETING DATE:June 9, 2025
RECOMMENDATION:
It is staff’s recommendation that the City Council adopt the attached Resolution authorizing the placement of removable traffic delineators along the centerline of Jaboneria Road in front of the exit of the Bell Gardens Elementary School student drop- off zone to be placed during drop-off and pick-up time.
BACKGROUND/DISCUSSION:
Bell Gardens Elementary School has been working on site improvements to the campus.
One key component has been the development and construction of an on-site student drop-off and pick-up zone, which was completed in 2024, to allow parents to drive into the school property from Jaboneria Road, south of Quinn Street. With the start of student drop off, school and City staff observed parents making left and right turns when exiting the school, and that vehicles trying to make left turns caused significant delays in the student drop-off zone.
The City Engineer completed a site investigation to confirm the traffic conditions of the site and determined that drop-off and pick-up time resulted in brief traffic impacts Monday through Friday. Since the school is located within a residential neighborhood, permanent devices are unsuitable because residents would face year-round traffic restrictions, even though school traffic only impacts the area briefly twice a day, Monday through Friday, during the school year. Therefore, the City Engineer recommends allowing the placement and removal of temporary delineators along the centerline of Jaboneria Road, fronting the
student drop-off zone for a distance of 24 feet to prevent left turns out of the on-site drop- off zone, and make the exit right-turn only during these peak times.
While on-site traffic management is typically the responsibility of property owners, this is a collaborative effort between the City and Bell Gardens Elementary School. The City will assist in marking the street for placement and removal of 14 delineators, starting at a point in the street in line with the northerly driveway gate opening, while the school will be responsible for placing the temporary delineators prior to the start of the school day, removing them at the end of the school day, and monitoring the gate to maximize the effectiveness of the delineators.
On May 6, 2025, the Traffic and Safety Commission approved a recommendation be made to the City Council for consideration of placement of temporary traffic delineators on Jaboneria Road at the Bell Gardens Elementary School student drop-off zone.
CONCLUSION:
If the City Council adopts the attached Resolution, Bell Gardens Elementary School will be authorized to place removeable delineators to prevent left turns out of the on-site drop- off zone, making the exit right-turn only during peak school traffic hours.
FISCAL IMPACT:
The estimated cost is $500 for materials and labor and is available in the current Street Maintenance Budget.
APPROVED ELECTRONICALLY BY:
Michael B. O'Kelly, City Manager
Stephanie Vasquez, City Attorney
Manuel Carrillo, Director of Finance and Administrative Services
RESOLUTION NO. 2025-53
A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF BELL
GARDENS, CALIFORNIA, AUTHORIZING THE PLACEMENT OF
REMOVABLE TRAFFIC DELINEATORS ON JABONERIA ROAD
FRONTING THE BELL GARDENS ELEMENTARY SCHOOL STUDENT
DROP OFF ZONE EXIT TO BE PLACED DURING SCHOOL DROP-
OFF AND PICK-UP TIME
WHEREAS, Bell Gardens Elementary School has been working on site improvements to its campus, including the construction of an on-site student drop-off and pick-up zone, which was completed in 2024, to allow parents to drive into the school property from Jaboneria Road, south of Quinn Street; and
WHEREAS, vehicles trying to make left turns from the student drop-off zone exit cause significant delays in the student drop-off zone; and
WHEREAS, to reduce delays and traffic impacts into Jaboneria Road, the City Engineer recommended the placement of removable delineators along the centerline of Jaboneria Road, fronting the student drop-off zone for a distance of 24 feet, which would prevent left turns out of the on-site drop-off zone, making the exit right-turn only during these peak times; and
WHEREAS, on May 6, 2025, the Traffic and Safety Commission approved a recommendation be made to the City Council for consideration of authorizing the placement of removable traffic delineators on Jaboneria Road at the Bell Gardens Elementary School student drop-off zone.
NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Bell Gardens as follows:
SECTION 1. The City Council, after consideration of the staff report and presentation, discussion, oral testimony and evidence presented to the City Council, hereby finds that the above recitals are true and correct and incorporated herein.
SECTION 2. The City Council hereby authorizes the placement of removable traffic delineators on Jaboneria Road fronting the Bell Gardens Elementary School student drop off zone exit, for a distance of 24 feet to prevent left turns out of the on- site drop-off zone, during school drop-off and pick-up times, as depicted in Exhibit “1”.
SECTION 3. The City Clerk shall attest and certify to the passage and adoption of this Resolution and enter it into the book of original resolutions, and it shall become effective immediately upon its approval.
[Signatures on the following page]
Resolution No. 2025-53
2 of 4
PASSED, APPROVED and ADOPTED this 9th day of June, 2025.
THE CITY OF BELL GARDENS
________________________________
Mayor Jorgel Chavez
APPROVED AS TO FORM: ATTEST:
__________________________ _____________________________ Stephanie Vasquez Daisy Gomez
City Attorney City Clerk
Resolution No. 2025-53
3 of 4
EXHIBIT 1 – BELL GARDENS ELEMENTARY DELINEATORS
Resolution No. 2025-53
4 of 4
I, ____________________, City Clerk of the City of Bell Gardens, hereby CERTIFY that City Council Resolution No. ___________was adopted by the Bell Gardens City Council at a regular meeting of the City Council held on ___________________, and was approved and passed by the following vote:
AYES:
NOES:
ABSTAIN:
ABSENT:
__________________________
Daisy Gomez
City Clerk
CITY OF BELL GARDENS
OFFICE OF THE CITY MANAGER
EXECUTIVE SUMMARY
TO:Honorable Mayor and City Council Members
FROM:Michael B. O’Kelly, City Manager
BY:Elizabeth Nava, Director of Recreation and Community Services SUBJECT:Consideration of Approval of a USDA TEFAP Agreement and a Memorandum of Understanding between the City of Bell Gardens and the Los Angeles Regional Food Bank for the City’s Family Food Program
MEETING DATE:June 9, 2025
RECOMMENDATION:
It is staff’s recommendation that the City Council adopt the attached Resolution approving a USDA Temporary Emergency Food Assistance Program Agreement (“TEFAP Agreement”) and a Memorandum of Understanding (“MOU”) between the City of Bell Gardens (“City”) and the Los Angeles Regional Food Bank (“Food Bank”) for the City’s Family Food Program, through which the Food Bank will provide food supplies.
BACKGROUND/DISCUSSION:
In 2020, the City partnered with the Food Bank to create the Family Food Program. This free program was developed to provide boxes of perishable and nonperishable food items for those in need.
The Food Bank supplies the City with food resources on a monthly basis. On the third Saturday of each month, the Recreation and Community Services (“RCS”) Department coordinates a drive-through event at Bell Gardens Veterans Park.
During each event, approximately 500 families are able to drive up and receive a free box of food every month, with no proof of income required.
RCS Staff will continue to partner with the Food Bank and register families to receive food on the third Saturday of each month. Additionally, Staff is proposing to provide 500 food boxes monthly, with capacity to increase to 700 food boxes monthly, if necessary. During the months of November and December the capacity for these distributions will increase to 1500 food boxes.
The California Department of Social Services requires the City to enter into a Temporary Emergency Food Assistance Program (TEFAP) Agreement prior to executing a Memorandum of Understanding (MOU) with the Food Bank. Approval
of both agreements will allow the City to continue administering the Family Food Program in partnership with the Food Bank.
CONCLUSION:
Staff recommends the City enter into a TEFAP Agreement and an MOU with the Food Bank to continue to provide the food resources on a monthly basis for the families in the City and surrounding communities.
FISCAL IMPACT:
Funding for this program is proposed for the Fiscal Year 2025-2026 Budget, in the amount of $25,000.
APPROVED ELECTRONICALLY BY:
Michael B. O'Kelly, City Manager
Stephanie Vasquez, City Attorney
Manuel Carrillo, Director of Finance and Administrative Services
RESOLUTION NO. 2025-54
A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF BELL
GARDENS, CALIFORNIA APPROVING A MEMORANDUM OF
UNDERSTANDING BY AND BETWEEN THE CITY OF BELL GARDENS
AND THE LOS ANGELES REGIONAL FOOD BANK
WHEREAS, the City of Bell Gardens (“City”) desires to partner with the Los Angeles Regional Food Bank (“Food Bank”) to support the City’s Family Food Program, a monthly food distribution program serving the City’s residents; and
WHEREAS, the California Department of Social Services requires the City to enter into a USDA Temporary Emergency Food Assistance Program agreement (“TEFAP Agreement”) before the City can enter into a Memorandum of Understanding (“MOU”) with the Food Bank; and
WHEREAS, the City wishes to enter into both a TEFAP Agreement and an MOU with the Food Bank to facilitate the of the Family Food Program.
NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF BELL GARDENS DOES RESOLVE, DECLARE, DETERMINE AND ORDER AS FOLLOWS:
SECTION 1. The City Council of the City of Bell Gardens hereby finds that the above recitals are true and correct and incorporates them herein by this reference.
SECTION 2. Based upon the above recitals, the staff report accompanying this Resolution, and such other oral and written evidence, the City Council approves the TEFAP Agreement and the MOU with the Food Bank and authorizes and directs the City Manager to execute the TEFAP Agreement and the MOU, which are attached to the Staff Report as Exhibit 2 and Exhibit 3, respectively.
SECTION 3. The City Council further authorizes and directs the City Manager and staff to execute the TEFAP Agreement and the MOU with the Food Bank on the City’s behalf along with any other ancillary documents relating thereto, including any other documents consistent with and necessary to and effectuate the intent of the City Council as set forth in this Resolution
SECTION 4. The City Clerk shall attest and certify to the passage and adoption of this Resolution and enter it into the book of original resolutions, and it shall become effective immediately upon its approval.
[Signatures on the following page]
Resolution No. 2025-54
2 of 3
PASSED, APPROVED AND ADOPTED this 9 th day of June, 2025.
THE CITY OF BELL GARDENS
_____________________________
Jorgel Chavez, Mayor
APPROVED AS TO FORM: ATTEST:
______________________________ ________________________________ Stephanie Vasquez Daisy Gomez
City Attorney City Clerk
Resolution No. 2025-54
3 of 3
I, ____________________, City Clerk of the City of Bell Gardens, hereby CERTIFY that City Council Resolution No. ___________was adopted by the Bell Gardens City Council at a regular meeting of the City Council held on ___________________, and was approved and passed by the following vote:
AYES:
NOES:
ABSTAIN:
ABSENT:
__________________________
Daisy Gomez
City Clerk
1 Revised 9/2024
CALIFORNIA DEPARTMENT OF SOCIAL SERVICES
CalFresh Bureau
Food Distribution Unit
Eligible Recipient Agency (ERA) Agreement with Sub-Distributing Agency (SDA)
USDA TEFAP AGENCY AGREEMENT
This Agreement is entered, on this date ___________by and between _the Los Angeles Regional Food Bank,_____ Eligible Recipient Agency (ERA) and __________________________________, Sub-Distributing Agency (hereafter referred to as SDA).
This agreement is for the distribution of the contracted United State Department of Agriculture (USDA) donated food under The Emergency Food Assistance Program (TEFAP) by the ERA in the following county/counties: Los Angeles County .
AGREEMENT PERIOD:
The agreement is considered permanent, with amendments to be made as necessary [7 CFR 251(c)(2)]. In consideration of the mutual premises hereinafter contained, the parties agree that this Agreement will be performed in accordance with the following conditions:
SDA Information:
Agency Name &
Agency No.:
Contact
Person(s):
Distribution
Address:
Agency Phone
No.:
Cell Phone No.
Email Address:
Eligibility Information:
Note: A copy of your IRS determination letter must be attached and submitted with this form for all new agencies applying for the TEFAP program..
Applicant is a: (check all that apply):
☐ Nonprofit Organization ☐ Public Institution ☐ Faith-Based Organization ☐ Provides Food Assistance to needy persons for household ☐ Provides Food Assistance to needy persons in the form of prepared meals
2 Revised 9/2024
FNS Civil Rights Assurance – (Adapted from FNS-74 Federal State Agreement):
This institution is an equal opportunity provider.
“The agency hereby agrees that it will comply with: i. Title VI of the Civil Rights Act of 1964 (42 U.S.C. 2000d et seq.); ii. Title IX of the Education Amendments of 1972 (20 U.S.C. 1681 et seq.); iii. Section 504 of the Rehabilitation Act of 1973 (29 U.S.C. 794); iv. Age Discrimination Act of 1975 (42 U.S.C. 6101 et seq.); v. Title II and Title III of the Americans with Disabilities Act (ADA) of 1990 as amended by the ADA Amendment Act of 2008 (42 U.S.C. 12131-12189); vi. Executive Order 13166, "Improving Access to Services for Persons with Limited English Proficiency." (August 11, 2000); vii. All provisions required by the implementing regulations of the Department of Agriculture (USDA) (7 CFR Part 15 et seq.); viii. Department of Justice Enforcement Guidelines (28 CFR Parts 35, 42 and 50.3); ix. Food and Nutrition Service (FNS) directives and guidelines to the effect that, no person shall, on the grounds of race, color, national origin, sex, age, or disability, be excluded from participation in, be denied the benefits of, or otherwise be subject to discrimination under any program or activity for which the Program applicant receives Federal financial assistance from USDA; and hereby gives assurance that it will immediately take measures necessary to effectuate this Agreement.; x. The USDA non- discrimination statement that in accordance with Federal civil rights law and U.S. Department of Agriculture (USDA) civil rights regulations and policies, the USDA, its Agencies, offices, and employees, and institutions participating in or administering USDA programs are prohibited from discriminating based on race, color, national origin, religion, sex, gender identity (including gender expression), sexual orientation, disability, age, marital status, family/parental status, income derived from a public assistance program, political beliefs, or reprisal or retaliation for prior civil rights activity, in any program or activity conducted or funded by USDA (not all bases apply to all programs). This assurance is given in consideration of and for the purpose of obtaining any and all Federal financial assistance, grants, and loans of Federal funds, reimbursable expenditures, grant, or donation of Federal property and interest in property, the detail of Federal personnel, the sale and lease of, and the permission to use Federal property or interest in such property or the furnishing of services without consideration or at a nominal consideration, or at a consideration that is reduced for the purpose of assisting the recipient, or in recognition of the public interest to be served by such sale, lease, or furnishing of services to the recipient, or any improvements made with Federal financial assistance extended to the Program applicant by USDA. This includes any Federal agreement, arrangement, or other contract that has as one of its purposes the provision of cash assistance for the purchase of food, and cash assistance for purchase or rental of food service equipment or any other financial assistance extended in reliance on the representations and agreements made in this assurance. By accepting this assurance, the agency agrees to compile data, maintain records, and submit records and reports as required, to permit effective enforcement of nondiscrimination laws and permit authorized USDA personnel during hours of program operation to review and copy such records, books, and accounts, access such facilities and interview such personnel as needed to ascertain compliance with the nondiscrimination laws. If there are any violations of this assurance, the Department of Agriculture, FNS, shall have the right to seek judicial enforcement of this assurance.
This assurance is binding on the agency, its successors, transferees and assignees as long as it receives assistance or retains possession of any assistance from USDA. The person or persons whose signatures appear below are authorized to sign this assurance on behalf of the agency.” This agreement is between the Los Angeles Regional Food Bank (ERA) and (SDA).
3 Revised 9/2024
The Agency (SDA) Agrees:
1. The agreement is considered permanent, with amendments to be made as necessary [7 CFR 251(c)(2)];
2. The site agrees to distribute United States Department of Agriculture (USDA) commodities, hereafter referred to as TEFAP food(s), to eligible recipients who live within the site’s defined geographical service area. Agencies that only serve residents from specific zip codes or cities, must post the zip codes or cities that they serve at every food distribution.
3. If a recipient from out of the site’s service area requests food, the site will serve them on a one-time exception basis and will advise the recipient of their proper distribution site or to a referral agency.
4. Proof of household income shall not be required for a client to receive TEFAP food. Income eligibility is a self-declaration by clients after reviewing posted current income eligibility guidelines. The site may require further client information for use with other programs; however, clients shall not be denied TEFAP food if they refuse to reveal any information that is not a requirement of TEFAP (e.g. demographics).
5. The site agrees to provide TEFAP food free-of-charge to eligible individuals. The site agrees not to request donations of any kind in conjunction with a food distribution. No supporting documentation is required for income eligibility determination. Individuals receiving commodities will self-certify they meet the income guidelines, by signing their names on the TEFAP Household Distribution Sign-In Sheet (EFA-7).
6. The site agrees to register and obtain a Unique Entity Identification number at SAM.gov. Your agency is considered a Sub-Eligible Recipient Agency that receives federal assistance in the form of TEFAP food commodities. As such, your agency is required to obtain a SAM.gov UEI in order to continue to receive TEFAP commodities. This regulation applies to all TEFAP participating agencies.
7. The site agrees that all recipients will sign their own name on the EFA-7 sign in sheet or will be signed in by a volunteer proxy. Provisions for people incapable of signing in their own name will be provided.
8. The site agrees to require an Alternate Pick Up form (EFA-15) from income eligible recipients unable to attend the physical distribution. The individual picking up commodities for these recipients must possess the form, and/or any other documents the distribution site or food bank may require. The form should be maintained with the EFA-7 sign in sheet. When referring to the Alternate Pick-Up request form (EFA-15), the form is no longer required to be provided for each distribution & can be renewed annually.
9. In the event the site is providing commodities to homebound recipients, the site agrees to ensure that these recipients sign the EFA-7 sign-in sheet.
4 Revised 9/2024
10. The site agrees to have prominently displayed in clear sight of recipients the following signage at times whenever commodities are distributed:
a. “And Justice for All” poster Form AD-475A
b. Notice to the Public
c. No Selling Sign
d. Current CDSS established Income Guidelines next to the EFA-7 e. TEFAP Written Notice of Beneficiary Rights
f. No Application sign (This only applies to agencies that request an application for other food and/or services)
11. The site agrees to notify the food bank immediately of any changes in distribution location(s), distribution hours, or days of operation. A representative of the Site must be present during the scheduled hours of each distribution to direct recipients to an alternate emergency food pantry in the event all the available food is distributed before the scheduled end time.
12. The site agrees to never to sell or trade commodities.
13. The site agrees not to redistribute commodities to other sites, or any other entity without prior written approval from the food bank.
14. The site agrees to make available any accounts and records pertaining to operations under this agreement to the California Department of Social Services, the United States Department of Agriculture (USDA) or any other state entity or statutory authorized person conducting an inspection, review, or audit. The site agrees to keep TEFAP reports and sign-in sheets on file at agency site for four years.
15. The sites must be open to the general population, unless written approval from the food bank is obtain prior before conducting closed distributions.
16. The site agree that no political or religious activity will be conducted in conjunction with a food distribution.
17. The site agrees to submit to the Food Bank a monthly participation report by the 5th business day of the month for the previous month detailing the total duplicated and unduplicated households and persons served at each TEFAP site. Unless, the agency is participating in the Oasis platform. If the site is unable to provide reports by the designated due date, the ERA has the authority to suspend or terminate this agreement.
18. The site agrees to submit to the Food Bank a monthly inventory report of TEFAP commodities showing what is on hand, received and distributed by case. The report is due to the Food Bank by the 5th business day of every month for the previous month. If the site is unable to provide reports by the designated due date, the ERA has the authority to suspend or terminate this agreement.
19. The site agrees to check quality and quantities received, and to sign for receipt of commodities when delivered or picked up from the food bank.
20. The site agrees to store and maintain food to allow for proper ventilation, with commodities stored off the floor and away from walls
21. The site agrees to store and maintain food at proper temperatures to prevent loss.
5 Revised 9/2024
22. The site agrees to comply with all requirements relating to food safety and food recalls.
23. The site agrees to ensure proper pest control measures are in place.
24. The site agrees to immediately, upon discovery, report theft, loss, infestation or other spoilage of any commodities to the Food Bank.
25. The site agrees to conduct at the least a monthly inventory of USDA foods, if storing food.
26. The site agrees to not request or accept more commodities than can be distributed.
27. The site agrees to follow first in-first out inventory practices.
28. The Food bank, USDA and TEFAP representatives retain the right to visit and inspect the site without prior notice. This may occur at any time, however, if the agency is not distributing during the agreed day/time, this agreement may be terminated.
29. The site agrees to operate the program in accordance with Title 7, Code of Federal Regulations (CFR), Parts 250 and 251 (see attached excerpt from Section 5 of the TEFAP Policy and Procedure Manual) that pertain to the Emergency Food Assistance Program.
30. The site agrees to train all agency staff and volunteers annually who handle personal information and/or interact with TEFAP food recipients regarding Civil Rights. The site agrees to only use the established Civil Rights training approved and provided by the CDSS Office. If the site is unable to provide reports by the designated due date, the ERA has the authority to suspend or terminate this agreement.
31. The site agrees to ensure that under no circumstances will they discriminate due to race, color, national origin, sex, age, religion, political beliefs or disability. Sites must print the following statement on all printed outreach materials that advertise a TEFAP distribution.
In accordance with Federal civil rights law and U.S. Department of Agriculture (USDA) civil rights regulations and policies, the USDA, its Agencies, offices, and employees, and institutions participating in or administering USDA programs are prohibited from discriminating based on race, color, national origin, sex, disability, age, or reprisal or retaliation for prior civil rights activity in any program or activity conducted or funded by USDA.
Persons with disabilities who require alternative means of communication for program information (e.g.
Braille, large print, audiotape, American Sign Language, etc.), should contact the Agency (State or local) where they applied for benefits. Individuals who are deaf, hard of hearing or have speech disabilities may contact USDA through the Federal Relay Service at (800) 877-8339. Additionally, program information may be made available in languages other than English.
To file a program complaint of discrimination, complete the USDA Program Discrimination Complaint Form, (AD-3027) found online at: How to File a Complaint, and at any USDA office, or write a letter addressed to USDA and provide in the letter all of the information requested in the form. To request a copy of the complaint form, call (866) 632-9992. Submit your completed form or letter to USDA by:
(1) mail: U.S. Department of Agriculture
Office of the Assistant Secretary for Civil Rights
6 Revised 9/2024
1400 Independence Avenue, SW Washington,
D.C. 20250-9410;
(2) fax: (202) 690-7442; or
(3) email: [email protected].
32. The site agrees that in case of disaster or during post disaster recovery, the following may be required but not limited to: distribute food and/or supplies to people affected by the disaster, operate distribution site outside of normal hours of operation and/or provide short term storage for USDA foods, other food items and/or supplies.
33. The site agrees to abide by any addendums the ERA/Food Bank requires.
7 Revised 9/2024
Name of Sub-Distributing Agency: ________________________________________________ Agency #: _______________
Please indicate days and times of distributions:
Day(s) of Distribution Start Time End Time Start Time End Time Monday _________ _________ ________ ________
Tuesday _________ _________ ________ ________
Wednesday _________ _________ ________ ________
Thursday _________ _________ ________ ________
Friday _________ _________ ________ ________
Saturday _________ _________ ________ ________
Sunday _________ _________ ________ ________
Please circle if your distribution is:
● WEEKLY
● BI-WEEKLY (Schedule of dates must be attached for the next 12 months) ● BI- WEEKLY: 1st 2nd 3rd 4th ● MONTHLY: 1st 2nd 3rd 4th
This agreement may be canceled upon (30) days’ notice in writing by either party.
Notwithstanding the foregoing, the ERA, may cancel this agreement immediately upon receipt of evidence that the terms hereof have not been complied with by the SDA.
SDA signing below certifies that the information provided herein is true and correct to the best of their knowledge and that my facility is in full compliance with all Federal, State, County and Local health codes and ordinances regarding food storage.
Sub-Distributing Agency Rep. Name (print or type) Sub- Distributing Agency Rep. Title
Sub-Distributing Agency Rep. Signature Date
By signing below, the ERA has approved the TEFAP USDA Commodity Food Service Application and Agreement as completed.
ERA Representative’s Name (print or type) ERA Representative’s Title
ERA Representative’s Signature Date
1 MEMORANDUM OF UNDERSTANDING
BETWEEN THE
LOS ANGELES REGIONAL FOOD BANK AND THE CITY OF BELL GARDENS
REGARDING THE BELL GARDENS FAMILY FOOD PROGRAM
This Memorandum of Understanding (“MOU” or “Agreement”) is made by and between the Los Angeles Regional Food Bank (“Subrecipient”) and the City of Bell Gardens (“City”) for the purpose of partnering on the Bell Gardens Family Food Program (“Project”), to be conducted from July 1, 2025 through June 30, 2026, within the City and County of Los Angeles. The City and Subrecipient may be referred to herein individually as a “Party” and may be collectively referred to herein as “Parties.”
RECITALS
WHEREAS, the City wishes to engage the Subrecipient to assist the City with facilitating the Project;
WHEREAS, the City has clearance to release the funds for this Project; and WHEREAS, the purpose of this MOU is to describe the roles and responsibilities of the Parties, and shall supersede and replace any previous agreements between Subrecipient and the City related to the Project described herein.
NOW THEREFORE, IN CONSIDERATION OF THESE RECITALS, AND THE MUTUAL COVENANTS CONTAINED HEREIN, THE PARTIES AGREE AS FOLLOWS:
1. MOU Contents and Objective
A. This MOU is comprised of the terms and conditions contained herein, together with any attached Exhibits and may be amended only by written agreement between Subrecipient and the City. Such terms and conditions are subject to change. The Recitals to this Agreement are also incorporated herein by this reference.
B. The Subrecipient certifies that the activities carried out with funds provided under this MOU will meet the needs of the Project, serving the residents of Bell Gardens and Los Angeles County.
2. Scope of Work
A. Subject to the terms and conditions of this Agreement, Subrecipient agrees to provide the services and tasks described in that certain proposal entitled “Scope of Services” (hereinafter, the “Scope of Work”) which is attached and incorporated hereto as Exhibit “A”.
3. Term
The Term of this Agreement shall begin on the date of execution by both Parties (“Effective Date”) and continue until June 30, 2026 (“Completion Date”) unless
2 terminated earlier as provided herein (hereinafter “Term”). Time is of the essence in the performance of services under this MOU.
4. Compensation
A. City has allocated General Funds in a not-to-exceed amount of Twenty-Five Thousand Dollars ($25,000) (hereinafter “Not-to-Exceed Amount”) to the Subrecipient to assist with the program costs for activities described in the Scope of Work.
B. Subrecipient shall submit to the City a "Reimbursement Request" within thirty (30) calendar days after signing the agreement.
5. Project Management
A. For purposes of this MOU, Subrecipient designates the following Project Managers:
Los Angeles Regional Food Bank
Elizabeth Cervantes
Director of Agency Relations & Product Acquisitions
1734 East 41st Street
Los Angeles, California 90058
323.234.3030 x132
[email protected]
Recipient reserves the right to change this designation upon written notice to City.
B. For purposes of this MOU, City designates the following individual as its Project Managers:
Elizabeth Nava
City of Bell Gardens
Director of Recreation and Community Services
8000 Park Lane
Bell Gardens, California 90201
562.806.7650
[email protected]
City reserves the right to change this designation upon written notice to Recipient.
6. MOU Changes
A. No alteration or deviation of the terms of this MOU shall be valid unless made in writing and properly executed by both Parties.
7. Records Retention
A. Unless otherwise notified by the City, the Subrecipient shall retain all financial records, supporting documents and statistical reports related to the project identified under this Agreement. All records subject to an audit finding must be
3 retained for five (5) years from the date the finding is made or until the finding has been cleared by appropriate officials and the Subrecipient has been given official written notice.
B. The Subrecipient shall furnish and cause each of its own subrecipients or subcontractors to furnish all information and reports required hereunder and will permit access to its books, records and accounts.
8. Notices
Any notice or notices required or permitted to be given pursuant to this MOU may be personally served on the other Party by the Party giving such notice, or may be served by certified mail, return receipt requested, to the following addresses:
To Subrecipient: Los Angeles Regional Food Bank
Elizabeth Cervantes
Director of Agency Relations & Product Acquisitions
1734 East 41st Street
Los Angeles, California 90058
323.234.3030 x132
[email protected]
To City: City of Bell Gardens
Elizabeth Nava
Director of Recreation and Community Services
8000 Park Lane
Bell Gardens, California 90201
562.806.7650
[email protected]
9. Compliance with Laws
The Parties shall comply with all Federal, State, County and City laws, ordinances, rules and regulations applicable to the production of the Project.
10.Disputes
Except as otherwise provided in this MOU, if a dispute arises between the Parties to this MOU, the Parties hereto agree to use the following procedure to resolve such dispute, prior to pursuing other legal remedies:
A. A meeting shall be held promptly between the Parties that will be attended by individuals with decision-making authority (to the extent reasonably possible), who will attempt in good faith to negotiate a resolution of the dispute.
B. If the parties are unsuccessful in resolving the dispute under (a) above, they may:
1. agree to submit the matter to mediation, binding judicial reference, or a private adjudicator (if all Parties so agree); or
4 2. initiate litigation following advance written notice to the other Party of not less than thirty (30) days.
C. If any party should bring a legal action against the other to enforce the terms of this MOU, the prevailing party shall be entitled to recover reasonable attorneys’ fees and costs, as determined by a court of competent jurisdiction in said proceeding.
11.Noncompliance
In addition to such other remedies as provided by law, in the event of noncompliance with any grant condition or specific requirement of this MOU, this MOU may be terminated.
12.Termination of MOU
A. Termination for Convenience. Either Party may terminate this MOU at any time by giving written notice to the other party of such termination at least ten (10) calendar days before the effective date of such termination.
B. Termination for Cause. If through any cause, Subrecipient shall fail to timely and adequately fulfill its obligations under this MOU, or if Subrecipient violates any of the covenants, agreements, or stipulations of this MOU, City shall thereupon have the right to terminate the MOU by giving not less than ten (10) calendar days written notice to Subrecipient of the intent to terminate and specifying the effective date thereof. The City shall provide a reasonable opportunity for Subrecipient to cure prior to termination. In no event shall such opportunity to cure extend beyond the term of the MOU. In the event that City invokes this termination clause, all finished or unfinished documents and other materials as described in the MOU that belong to City shall be returned to City at its option.
13.Non-Assignment
A. Neither Party shall assign this MOU, or any part thereof, without the written consent of each Party to this MOU. Any assignment without such written consent shall be void and unenforceable.
B. The covenants and agreement of this MOU shall inure to the benefit of and shall be binding upon each of the Parties and their respective successors and assignees.
14.Indemnity
Except for the negligence or willful misconduct of the City and any of its officers, agents, employees, assigns, and successors in interest, Subrecipient undertakes and agrees to defend, indemnify, and hold harmless the City and any of its directors, officers, agents, employees, assigns, and successors in interest from and against any and all suits and causes of action, claims, losses, demands and expenses, including, but not limited to, attorney's fees and cost of litigation, damage or liability of any nature whatsoever, for death or injury to any person,
5 including the Subrecipient’s employees and agents, or damage or destruction of any property of either party hereto or of third parties, arising in any manner out of, pertaining to, or incident to any alleged acts, errors or omissions of Subrecipient, its officials, officers, employees, or agents in connection with the performance of the Project or this MOU, including without limitation the payment of all consequential damages, expert witness fees and attorneys’ fees and other related costs and expenses.
A. Except for the negligence or willful misconduct of Subrecipient and any of its directors, officers, agents, employees, assigns, and successors in interest, City undertakes and agrees to defend, indemnify, and hold harmless Subrecipient and any of its directors, officers, agents, employees, assigns, and successors in interest from and against all suits and causes of action, claims, losses, demands and expenses, including, but not limited to, attorney's fees and cost of litigation, damage or liability of any nature whatsoever, for death or injury to any person, including the Subrecipient’s employees and agents, or damage or destruction of any property of either party hereto or of third parties, arising rising in any manner out of, pertaining to, or incident to any alleged acts, errors or omissions of City, its officials, officers, employees, or agents in connection with the performance of the Project or this MOU, including without limitation the payment of all consequential damages.
15.Insurance
Subrecipient shall, at its own expense, procure and maintain policies of insurance of the types and amounts identified under paragraphs (a) through (g) of this Section 11, below, for the duration of the MOU. The policies shall state they afford primary coverage.
A. Minimum Scope of Insurance – Coverage shall be at least as broad as:
1. Insurance Services Office Commercial General Liability coverage (Occurrence form CG0001), or its equivalent.
2. Insurance Services Office form number CA0001 (Ed. 1/87) covering Automobile Liability, code 1 (any auto) or its equivalent.
3. Workers’ Compensation insurance as required by the State of California and Employer’s Liability Insurance.
4. Professional Liability (Errors and Omissions) insurance.
B. Minimum Limits of Insurance – Subrecipient shall maintain limits no less than:
1. General Liability: $1,000,000 per occurrence for bodily injury, personal injury and property damage. If Commercial General Liability Insurance or other form with a general aggregate limit is used, either the general aggregate limit shall apply separately to this project/location or the general aggregate limit shall be twice the required occurrence limit.
6 2. Automobile Liability: Including contractual liability insuring owned, non-owned, hired and all vehicles by Subrecipient with a combined single limit of not less than $1,000,000 applicable to bodily injury, or death, and loss of or damage to property in any one occurrence.
3. Workers’ Compensation Liability: Including Occupational Diseases in accordance with California Law and Employers’ Liability Insurance with a limit of not less than $1,000,000 each accident.
4. Professional Liability Insurance: With limits of not less than $1,000,000 per occurrence. In addition, it shall be required that the professional liability insurance policy remain in effect for six (6) months after the Completion Date of this Agreement.
C. Other Insurance Provisions –The general liability and automobile liability policies procured by Subrecipient are to contain, or be endorsed to contain, the following provisions:
1. City, its elected and appointed officials, officers, employees, agents and volunteers are to be covered as additional insureds of Subrecipient, with respect to liability arising out of the activities performed by Subrecipient.
2. For any claims related to this Project, Subrecipient’s insurance coverage shall be primary insurance as it relates to City, its elected and appointed officials, officers, employees, agents and volunteers. Any insurance or self-insurance maintained by City shall be excess of Subrecipient’s insurance.
3. Any failure to comply with reporting or other provisions of the policies including breaches of warranties shall not affect coverage provided to City its elected and appointed officials, officers, employees, agents and volunteers.
D. Acceptability of Insurers – Insurance is to be placed with California admitted insurers with a current A.M. Best’s rating of no less than A and be admitted, unless otherwise approved by Subrecipient and City.
E. Verification of Coverage – Subrecipient shall furnish City with original endorsements and certificates of insurance evidencing coverage required by this clause. All documents are to be signed by a person authorized by that insurer to bind coverage on its behalf. All documents are to be received and approved by City before work commences. Upon request of City at any time, Subrecipient shall provide complete, certified copies of all required insurance policies, including endorsements affecting the coverage required by these specifications.
16.Severability
If any provision of this MOU is held to be illegal, invalid, or unenforceable, in whole or in part, such provision shall be modified to the minimum extent necessary to make it legal, valid, and enforceable, and the legality, validity, and enforceability of the remaining provisions shall not be affected thereby.
7 17.Survival
The following sections survive expiration or termination of this MOU:
Section 7 (Records
Retention)
Section 10 (Disputes)
Section 14 (Indemnity)
18.Jurisdiction and Venue
This MOU shall be deemed an agreement under the laws of the State of California and for all purposes shall be interpreted in accordance with such laws. Both Parties hereby agree and consent to the exclusive jurisdiction of the courts of the State of California and that the venue of any action brought thereunder shall be Los Angeles County, California.
19.Waiver
No delay or failure by either Party to exercise or enforce at any time any right or provision of this Agreement shall be considered a waiver thereof of such Party’s right thereafter to exercise or enforce each and every right and provision of this Agreement.
A Waiver to be valid shall be in writing but need not be supported by consideration.
No single waiver shall constitute a continuing or subsequent waiver.
20.Standard of Care
The Parties shall perform the work required for the production of the Project under this MOU in accordance with generally accepted industry standards, practices, and principles applicable to such work.
21.Force Majeure
Neither Subrecipient nor City shall be liable or deemed to be in default for any delay or failure in performance under this MOU or interruption of services resulting, directly or indirectly, from acts of God, civil or military authority, acts of public enemy, war, strikes, labor disputes, or any other similar cause beyond the reasonable control of Recipient and City.
22.Execution of MOU or Amendment
This MOU, or any amendment related thereto (“Amendment”), may be executed in multiple counterparts, each of which shall be deemed to be an original, but all of which shall constitute one and the same agreement. The signature page of this MOU or any Amendment may be executed by way of a manual or authorized signature. Delivery of an executed counterpart of a signature page to this Agreement or an Amendment by electronic transmission scanned pages shall be deemed effective as a delivery of a manually executed counterpart to this Agreement or any Amendment.
8 23.Entire MOU
This MOU represents and contains the entire agreement of the Parties with respect to the matters set forth herein. This MOU supersedes any and all prior negotiations, discussions and, if any, previous agreements between the Parties. (SIGNATURES ON NEXT PAGE)
9 IN WITNESS WHEREOF, the Parties have caused this MOU to be executed by their duly authorized representatives as of the dates indicated below:
LOS ANGELES REGIONAL FOOD BANK
By:
Michael Flood, President/CEO Date
CITY OF BELL GARDENS
By:
Michael B. O’Kelly Date
City Manager
APPROVED AS TO FORM:
By:
Stephanie Vasquez Date
City Attorney
10 Exhibit A – Scope of Work
1. Provide food for 500 families once per month.
2. Provide healthy food options; shelf stable groceries, frozen meats/poultry, produce and dairy items based on available inventory.
3. Send only food in ready-to-distribute bags/boxes for a drive-through style distribution.
4. Deliver food on distribution days based on mutually agreed upon date and time frame.
CITY OF BELL GARDENS
OFFICE OF THE CITY MANAGER
EXECUTIVE SUMMARY
TO:Honorable Mayor and City Council Members
FROM:Michael O’Kelly, City Manager
BY: Daisy Gomez, City Clerk
SUBJECT:Local Commissions Appointment List
MEETING DATE: June 9, 2025
RECOMMENDATION:
It is staff's recommendation that the City Council review the Commissions Appointments List and by motion, remove commissioners and/or make appointments to the posted vacancies.
BACKGROUND / DISCUSSION:
The Local Appointments List includes all Bell Gardens Commissions and Commissioners. The City Council adopted Ordinance No. 825 on July 13, 2009 establishing minimum requirements for service on commissions. All Commissioners must reside within the City of Bell Gardens and may only serve on one Commission at a time. Once appointed, each Commissioner must adhere to the requirements of the City's Conflict of Interest Code and state-mandated AB 1234 ethics training and AB 1661 harassment training.
Ordinance No. 825 allows each Council Member to remove or appoint one candidate per Commission, subject to the approval of the Council majority. Appointed Commission Members serve terms that coincide with the term of the Council Member who made the appointment.
CONCLUSION:
After an appointment is made, Commission members will receive their Oath of Office before beginning service with their respective Commission at the next regularly scheduled Commission meeting. The City Clerk's Office will arrange for the proper filing of Conflict of Interest Code forms and schedule trainings for AB 1234 and AB 1661.
FISCAL IMPACT:
No fiscal impact.
ELECTRONICALLY APPROVED BY:
Michael B. O'Kelly, City Manager
Stephanie Vasquez, City Attorney
Manual Carrillo, Director of Finance and Administrative Services
Updated: 5/13/2025
CITY OF BELL GARDENSNOTICE OF COMMISSION VACANCIESAND ACTIVE COMMISSIONERS
EDUCATION COMMISSION
PLANNING COMMISSION
RECREATION, CULTURAL AND YOUTH COMMISSION
SENIOR CITIZEN COMMISSION
TRAFFIC AND SAFETY COMMISSION
The City Council is seeking applications for the following vacancies:
Meeting Date: Second Thursday of every month, City Hall Council Chamber, 5:00 p.m. Staff Liaison - Ana Avalos, Recreation and Community Services Supervisor, (562) 806-7650 Meeting Date: Third Wednesday of every month, City Hall Council Chamber, 5:15 p.m. Staff Liaison - Steven Jones, City Planner, (562) 806-7722Ernesto Ramirez Barcena 4/8/2024 Meeting Date: Third Thursday of every month, City Hall Council Chamber, 6:00 p.m. Staff Liaison – Armando Andrade, Recreation and Community Services Supervisor, (562) 806-7650 Meeting Date – Second Wednesday of every month, City Hall Council Chamber, 6:00 p.m. Staff Liaison – Diana Ortiz, Recreation and Community Services Supervisor (562) 806-7650 Meeting Date – First Tuesday of every month, City Hall Council Chamber, 5:30 p.m. Staff Liaison – Bernardo Iniguez , Director of Public Works/Facilities (562) 806-7770 Applicants must be residents of the City. No person previously convicted of a felony in this state or elsewhere shall bepermitted to serve on any City Commission. Before assuming the duties of a commissioner, each person appointed shalltake and file with the City Clerk the same constitutional oath of office required of members of the city council. Anymember of a commission shall be deemed to have resigned from the commission, and his or her office as a member ofthe commission shall automatically vacated, in the event, the member ceases to be a resident of the City or is convictedof a felony. (Bell Gardens Municipal Code Sections 2.68.030, 2.28.030, 2.22.030, 2.35.030) Applications may be obtained from the City Clerk’s Office: 7100 Garfield Ave, Bell Gardens, CA 90201. Applications willbe accepted in the City Clerk’s Office on a continuous basis until an appointment is made. Please call the City Clerk’sOffice at (562) 806-7705 or email [email protected] for more information.
Daisy Gomez, City Clerk
VACANT Barcena 2/3/2025Linda Judith Lopez Chavez 4/28/2025Crystal Jimenez De La Rosa 1/13/2025Juan Manuel Rojas Guillen 1/27/2025Miguel Maravilla Sanchez 1/13/2025 Carlos Jose Barrera Chavez 1/13/2024Kenneth Preciado De La Rosa 1/13/2025Yorgelys Monroy Guillen 2/11/2025Oscar Boado Sanchez 9/11/2023 VACANT Barcena 1/6/2025Katelynn Cabrera Chavez 4/28/2025Ainslee Preciado De La Rosa 2/24/2025VACANT Guillen 3/11/2025Carmen Vargas Sanchez 7/22/2024 Ana Maria Sanchez FloresBarcena 1/9/2023Mayra Teresa Yañez Chavez 4/28/2025Karina Garcia De La Rosa 5/12/2025VACANT GuillenStephanie Perez Sanchez 1/23/2023 David Heredia Barcena 1/9/2023Edgar Juvenal Lopez BustillosChavez 4/28/2025Gustavo Mendez De La Rosa 4/14/2025Samuel Perez Guillen 2/24/2025Hugo Alvarado Sanchez 1/9/2023
NAME APPOINTED BY VACANCYPOSTED APPOINTMENTDATE