W. Enforceebility. Repeal of any provision of the HMO does not affect any penalty, forfeiture, or liability incurred before, or preclude prosecution and imposition of penalties for any violation occurring before this Ordinance‘s effective date. Any such repealed part will remain in full force and effect for sustaining action or prosecuting violations occurring before the effective date of this Ordinance.
W. Validity of Previous Code Sections. it this entire Ordinance or its application is deemed invalid by a court of competent jurisdiction, any repeal or amendment of the BMC or other city ordinance by this Ordinance will be rendered void and cause such prevbus BMC provision or other city ordinance to remain in full force an effect for alt purposes. -
w. Reliance on Record. Each and every one of the findings and detemrinations in this Orcfinance are based on the competent and substantial evidence. both oral and written, contained in the entire record relating to the project. The findings and determinations constitute the independent findings and detenninations of the City Council in all respects and are fully and completely supported by substantial evidence in the record as a whole.
W. Limitations The City Council's analysis and evaluation of the project is based on the best information currenliy available. it is inevitable that in evaluating a project that absolute and perfect knowiedge of all possible aspects of the project will not exist. One of the major limitations on analysis of the project is the City Council’s lack of knowiedge of future events. in all instances, best elicits have been made to form accurate assumptions. Somewhat related to this are irmitadons on the City‘s ability to solve what are in effect regional, state, and national problems and issues. The City must work within the political framework within which it exists and with the limitations inherent in that framework.
Wt Severabilily. it any part of this Ordinance or its application is deemed invalid by a court of competent jurisdiction. the City Council intends that such invalidity will not affect the effectiveness of the remaining provisions or applications and, to this end, the provisions of this Ordinance are severable.
W. Electronic Signatures. This Ordinance may be executed with electronic signatures in accordance with Government Code §16.5. Such electronic signatures will he treated in all respects as having the same effect as an original signature. §§CT§QN 7g. Summaries of Information. All summaries of information in the . findings, which precede this section. are based on the substantial evidence in the record.
The absence of any particular fact from any such summary is not an indication that a particular finding is not based in part on that fact.
-24-
City of Beiiflower
Ordinance No. 1443
SECTIOH 13. Recordation. The City Clerk, or her duly appointed deputy, is directed to certify the passage and adoption of this Ordinance; cause it to be entered into the City of Beliflower’s book of original ordinances; make a note of the passage and adoption in the records of this meeting; and, within 15 days after the passage and adoption of this Ordinance, cause it to be published or posted in accordance with California law.
W. Effecflve Date. This Ordinance will take effect on the 30'h day following its final passage and adoption.
ORDINANCE NO. 1443 HAD ITS FIRST READING ON APRIL 14, 2025, ITS SECOND READING ON APRIL 28, 2025, AND WAS DULY PASSED, APPROVED, AND ADOPTED BY THE CITY COUNCIL OF THE CITY OF BELLFLOWER AT IT 5 REGULAR MEETING OF APRIL 28, 2025.
“.13; Day”
cum. Mayfi
APPROVED As To FORM:
Kart H. Berger. City Attorney
‘1: I By: A l I y Jusumrhiyo/mimm City Attorney
EXHIBITS:
Exhibit A: Density Bonus
Exhibit B: Accessory Dwelling Units
Exhibit 0: Community Care Facilities
Exhibit D: Emergency Shelters
Exhibit E; Affordable Housing- Lot Consolidation
-25-
Exhibit A
Density Bonus
'§ 1141.010. Purpose and Intent.
This Chapter establishes procedures for implementing density bonus requirements set forth in Government Code Sections 65915, et seq. as may be amended from time to time (the “Density Bonus Act").
§17.41.020. Procedure.
A.
B.
C.
in addition to any other requirement, applications for a density bonus must be filed on a form approved bythe Director.Anapplicationmustbeiiledconcurrentlywithanyomerlend use application required by this code. At the time the application is submitted, the appiicant must pay all applirmtion fees established by City Gounod resolution. meD’uecmrwiflpmoeSSMDensnyBonusActappficadoninMesamememerasail applicationsrequiredbythiecode.
mmmmmmcmwmmmmmmm
establisheligibifityunderthebene‘dysormm
§ 1141.020. Definitions.
Tmandplmesusedinfliscmpmmmeemmanmesdefimdbymmm
Act Undefinedwordsandplnasesendbevemesmmeanhgaesettonhhmme. § 1141.030. Bmmesandlncemivos.
A. mmmmmmmmMyrmamma
B.
C.
concessionpmeuanttoihisChaptcr.
Wemmnwymmmcmemmrmmdmammrm
land useelementofthcgenerelplan, themeximumdeneltyeiiowedcontrois.
Before the Building Official issues a budding permit, an applicant receiving bonuses or concessions under this Chapter must execide and record an agreement. in a form approved by the City My. seeming the continued altordabifity at all dwelling units in accordance with the Density BonusAct and this Chapter.
All dwelling units benefitting from the bonuses or concessions under this Chapter must be concurrently built in the some manner as market rates. All affordable units must be integrated and reasonably distributed throughout the approved project with the market rate units to ensure a reasonable mix of affordable and market rate units.
Density Calculation. The area of any land required to be dedicated for street or alley purposes may be included as im area for purposes of calculating the maximum density permitted by the underlying zone in which the protect is located.
PagetciB
-26-
§ 17.41.040. Amenities.
Residents of affordable units may not be charged for amenities not charged to other residents including, without limitation. access to recreational facilities, parking. cable television. and interior amenities like dishwashers and microwave ovens. Optional services for all residents must be the same. Tenants of affordable units may not be required to purchase additional services. § 17.41.050. Menu of Incentivcs.
Applicants with projects qualifying for incentives may request one or more of the following incentives; the number of incentives being requested must be consistent to the Density Bonus Act unless otherwise authorized by the apprcw'ng body:
A. YardlSetback. Up to a 20% decrease in the required width or depth of any individual yard or setback. except along any property line that abutsan R4 or more reshlctively zoned property.
A landscaping plan must be submitted to the Director for approval.
B. LotWidth UptonZWdecreaeetrcmebtwidthrequiremntAlmdscaphgplanmuslbe cubmiltedtotheDiroctorlorepproval.
C. Floor Area Ratio.
1. AWtWMmmfiombmmddemfly
bonusfcrwhichthepmjectiseligible,ncttoexcecd35%;cr
2. Mieuottlnofltemiseapphcebtefiomamamfiomfloorerearafionatoexceeddme idenfifiedinmeadoptedeemmiPianHomhIgEkmngweningmmoiectshe.
D. HeightApercentageincreaseinthe heightrequirernentinfeetequaltothepercentageot dmshybmushrwhkhmewciedkefigible.mpmmgehaeasemmmisapplbafle wertheentireparcel regardless ofthenumberofunderlyingheightlimits. Forpurpoeesof thissubsection, heightiimitscontained infie‘l‘itieandadofiedspecificpiansdonot apply.
1. lnanyzoneinwlfichtheheightormnnberdistoriesieirmited,misheightincreasewiil pennitamaximumcttl additionalfeetoroneaddtionalstcry,whicheverislower,to providetheallordableunlts.
2. Ncadditicnalheightcanbepennittedforthatportioncfabuildinginaprojectthatie iocatedwithhSOfeetolalotclaseifiedinanRt orrnoreresh‘ictlvezone.
3. Noadditicnelheightisporrnittedtorthetportionolabuildlnginaproiectthatislccated within 15feetctelotclaesifiedintheR-10rmcre restrictivezcne.
4. For each loot of additional height, the building must be set back one horizontal foot.
5. No additional height can be permitted for any portion of a building in a project locawd on a lot sharing a common lot line with or across an alley from a lot classified in an R4 or more restrictive zone. This prohibition does not apply it the lot on which the project is touted is within 1,500 feet of a transit stop but no additional height can be permitted for that portion of a building in the project that is located within 50 feet of a lot classified in an R4 or more restrictive residential zone.
PageZotS
-27-
E. Open Space. Up to a 20% decrease from an open space requirement. A landscaping plan must be submitted to the Director for approval.
§ 17.41060. Request tor incentives.
A. For projects qualifying under the Density Bonus Act for which ministerial approvals are required, the foilowing procedures apply:
1. Application. An applicant must file a request on a form provided by the Director. accompanied by fees established by city council resolution.
2. Director Authority. The Director will review applioefions for consistency with this True.
Acfim.TheCitywiuappmveadensitybonusaMrequestedincmfive(s)umessflm DirectcrmkesmammofthemfindingspmvidedbrunderGovemmeMCode section65915(d)(1i
www.mmmmmnammbyfimdmmmm
Pageants
-23-
Exhibit B
Accessory Dwelling Units
Ԥ 17.17.010. Definitions.
Unless the contrary is stated or clearly appears from the context. the following definitions govern the construction of the words and phrases used in this Chapter. Undefined words and phrases and have the same meaning as set forth in this Code or in applicable law. 'Primary dwelling" means a residential structure on a single parcel with provisions for living, sleeping, eating, a single kitchen for cooking. and sanitation facilities. Where more than one residentidstructureexistsonalotthe'prinarydwefling'willeitherbetheresidentialstmcmre that was first issued a valid certificate of occupancy, or, when applicable, the largest residential structure on the lot.
'lmdempmkhg’mMoamuemmbibspakedinaim,mebehinduwomer
§ 1117.020. CertificauoIOwupancy.
A. TheBuidttficialwillnotissueafinslcerfincakdoccupancytorsnAccuawy DuefirgllnitDU')orJuniorAccessorwefng Unit('JADU")betoretheBuitding Oficidissuesafinelceflificatedcocupamytortheprlnmydwdfmfic).8efweme Budd-190mm issuesanyfinalwrtilicateotoccupancyioranADU endiorJADU the pmputyownermustrecudwflhmeCountyRecorderaomenantkIalomapprwedby lheCityAttomey satisfyingappficablelaw, includhgthisSe-ction.
B. ADUmaynotbeusedbviolafionotfliiscode.mdanymnalottheADUnuntbetma termofatldaysorlonger;
C. JADUrmstinoludethefollowing:
1. TheJADUmaynotbesoldsepaately,
2. TheJADUhaasizeandattributeresbictionsrequiredbythieoode;
3. Thepropeflyownermustoocupyeidwrdceshgle-lanflyresidenceinwhichme JADUisperrnitted,orthenewlycreetedJADU.
4. TheJADUcannotberentedloranyperlodlesslhanaodays.
§ 17.11030. Awllcation for Address Number.
Any ADU or JADU that includes a separate entrance from the main entrance of the Primary Dwelling. or will be improved with a new or separate utility connection directly between the unit and the utility. must submit an applicadon for an address number. Address numbers will be determined by the Director pursuant to the promdures outlined in this code. Address numbers must be placed over the entrance to the ADU or JADU or on some other place where the number will be visible from the public right-of-way. When required by the Director, address identification must be provided in additional approved locations to facilitate emergency response.
Pageiof2
-29-
§17.17.o40. Fees.
A. Except as provided in California law, all ADUs are subject to deveiopmcnt impact fees proportional to the square footage of the primary dwelling unit in accordance with this code.
Except as provided by California law, each ADU must instaii a separate utility connection directiy between the ADU and the utility. which is subject to a connection fee or capacity charge.
TheCitymaychargeWnaHebspecfionandmflucfionfeesfmmpecfimeandior at! tequircd permits. The fees will be established by City Councii mutation and be assessedonthepropeflyowner.
AnADmnotbeconsideredanewresidenfiaiuseforpurpooesofcaicuiafingconnection macapadtydwgufwufififies,mflcssmem0iswnstmdedsinuuamiywma new primaty single-family dweiling.‘
Page20f2
-30-
Exhibit c
Community Care Facilities
'§ 17.72.14!) Community Care Facilities.
A. Purpose. This Section reduces development mnetraints and regulates community care . facilities for their orderly development.
Unless the contrary is stated or clearly appears (mm the context, the words and phrases used in this Section and have the same meaning as um in Health and Safety Code Section 1502, as may beamended from time totime, ores set forth in this Code.
Permitted uses. Community care facilities writing six of fewer persons are considered residential were and may be permitted in dress zones that allow residential uses.
Conditionally pennitted use. A conditional use permit, approved by the Planning Commieeicnpursuenttothisl’itle,ierequiredton
1. Everyconmure'tycerefacilityintheGGGeneralcornmercielzonemr
2. Reeldenfiaicarefecfifiiesssvhgeevenumepermhmetofiowingzoneez a. SFSingleFamilymne; I
b. A—EAgricutturalEstatezone;
6. R4 Law DensityResidenlidzone;
at. no Medmoensrrynesidenfiarmm
e. R-3 Multiple Reeidentiaizone;
3. Standards. in additionto anyothereppiicable law, thetoilmuingetendardsapply to all community care facilities:
a. Community care facilities serving six or tewerpersone must comply with all development standards applicable to outer residential uses in the some zone. b. Community care facilities serving seven or more persons must comply with all development standards applicable in the underlying zone. and all at the following:
i. Onehalt of a parking spaces must be provided for each bedroom in a residential care facility. Nonresidential care facilities must provide one parking space for every five persons residing at the facility, plus one parking space for every two persons employed at the facility.
it Residential care must not be located within:
-31-
a) 500 feet of any public or private school, park or playground, and any on-sale or ofl~sale alcohol establishments; or
b) 1,000 feet of any other residential care facility for seven or more persons, including for the elderly.
iii. Occupancy Limits. A residential care facility within residential zones may not serve more than 20 persons.
4. Findings. Before approving a conditional use permit for a community care facility as permitted by this Sectbn. the Planning Commission must find that the community care tacifity:
a. Witt not ram in adverse effects to, «jeopardize or endanger. the health. welfare, peace. oreatetyotpereonsinthesurroundingaree;
Will not adversely affect the livability of the surrounding neighborhood as a result of inadequate maintenmce. prohibited activities. andlor operating characteristics; Cordorme with eppficable law. including, without limitation, this Title, the General Plan, the Braiding Standards Code. and appropriate State] Federal licensing.
Wfllnotreeuhinnuiemceacthifieshchdhgmnhommetbnfiistwbanoeofflte peace, illegal dmg activity. public drunkenness, public consumption of alcohol. harassment of paes-ere-by, gambling. public urination. theft, assault. battery. vandalism, littering, loitering illegal parking, noise levels above those allowed pmeuadtotheBMC.lewdconduct,orpolicedetentionsand/oreneets; The design of the physical structure is wholly consistent with the design and scale of the surrounding neighborhood;
The use and structure will not create measurable and identifiable adverse traffic impacts in the surrounding neighborhood including a reduction in attache parking within the surrounding neighborhood. in making this determination, the applicant must furnish sufficient inmrmation to the Director for evaluation.“ Peach”
-32-
Exhibit D
Emergency Shelters
Ҥ 1772.130. Emergency Shelter.
This section implements applicable law, including Government Code § 65583. related to the City's assessment of housing needs.
A. Definitions. Terms and phrases used in this section have the same meaning as defined by Government Code section 65582, as may be amended from time to fime. Undefined words and phrases and have the same meaning as set forth in this Code.
Zone. Emergency shelters may be permitted in the C4? (General Commercial) Zone and intheM-1 (Light industrial) District, eubjecttotheprovieionsotthia‘l’itie.
Standards. Emergency shelters must satisfy the following:
1. 2.
cponcyeennotexeeedaooocupenteetenyonetime.
Pmidemmrkingepacetoreachpemnworldngmmeemergencymnomt
drestandardedonotrequlremoreparkhgforemergeneysmuersmanm residerrfialorconmeroialuaeawifimmeeamezone.
Alpropmdm-sitehrtakeandwaifirgereasmustbeeeperatedflomflrepubflc figtrt—ofmyamlbefullyscreenedfmmwblicview. Exteriorlntelteendwaiting mmustbeooveredbyapermenemwmeflhemkeendwanhgereamum
be suitably sized to prevent quoting in the public riglrt-ofaiva}r or within any parking lotbutcannot exceedélmaquare feat.
EachemergencyshettermuethaveenonefiemanagemeMolfloeandimplement amanegementplanwhichlnckrdes, withoutlimitefion:
a. Maintainingaminimumofonestaflmembertoreverytsbedswhenthe emgencyshelterisinoperefion.
b. Training emergency shelter staff persons in operating procedures, safety plane.andaeeistingctients.Theermrgencysheltermaynotemployany personwhohasbeen comm ofafelonyorwheare required to register as a sex registrant under Penal Code § 290.
c. Maintaining current information on alt individuals utilizing the emergency shelter and referral sheets for persons who. for any reason. cannot be served by the emergency shelter.
d. Screening individuais for admittance eligibility. with the objective of first providing services to individueie with connections to the City's jurisdiction. e. Continuously monitoring waiting areas to inform prospective clients whether they can be served within a reasonable time. if they cannot be sewed by the provided because of time or resource constraints, then
-33-
informing prospective clients of alternative programs and locations where similar services are provided.
f. Removing all litter on and within the vicinity of the emergency shelter daily.
9. Establishing standards for responding to emergencies and incidents. expelling clients from the facility, and establishing re-edmittance policies for clients who have been expelbd.
h. Establishing policies and procedures that prohibit alcohol and illegal drug use, end expelling persons in possession of such substances on the grammes
5. Notmomhanoneemergencysheflaiepermfltedwifiaharodheoimfeetm anotheremergencysheim.
6. lndhidualoccupencyinananergencysheuaislhfitedmfommnmsduMmy 12Wmnthpefiod.
7. Eideriorfighdngmustbepmvidedeteflbuildingentrancesandmndoaacfivity m,“mrstbeectivebdbetweenumeetendmieeoleechdey.
8. Eachemergencyshekermuethaveotleastonem—sitesecufiypemonnelpreeent Miedieemergencyshelterisoperafiond.
9. Themrgencyshdtermayprovfiemormofdnfoflowingepecificms www.mmum:
a. Commercidkitchenfacfitiesdeeignedendopentedhcompliencewifl:
oppiiceblelaW:
Diringeree;
Laundry,
Recreationromn;
Supportservices(e.g..traininu. oouroelirtg);end
Childcarefacilitiee. ”9
9 .
0 .
0 -
0. Procedure.Apennit applicationforan emergency shelter willbeccnsmered and approved ministerlafly by the Director.‘
P391220”
-34-
Exhibit E
Aflordable Housing - Lot Consolidation
“BMC Chapter 17.14. AFFORDABLE HOUSiNG - LOT CONSOLIDATiON.
17.14 Aflordable Housing - Lot Consolidation
§ 17.14.010. Intent and Purpose.
The purpose and intent of this Chapter is to inmntlvize lot consolidation for housing development and redevelopment in underutilized portions of the City, and support more compact and higher-density rental and owner-occupied residential developments affordable to lower income hwsehdds.
§ 1114.020. Definitions.
TennsandphrasesusedinthisChapterhavethesarnemeaningasdeiinedbythe California CodeotReguiations, including 25 CCR§6912, st. we, as maybeamended huntkrletofimemndaspmvldedbelowflndefimdmdsandphmseshavedmsame maningassetionh in this Code.
'Atiordabie Housing Project” means new development consisting of residential units restrictedtooccupancy byLowerlncome Households. For purposesofthls Chapter, Aliordwie Housing Project includes a mixed use project with ground-level commercial uses. providedthatthe residential usesaccountiornotlessthanBS‘lfiolmeAtlordable Housing Project‘s gross floor area.
§ 17.14.0313. Applicability.
ThisChapbrappiiestoAiiordable HousingProjectsihatincludeconsolldationcltwoor morecontiguousiegaiiotsforthe purposes ofestablishlng anAilordable Housing Project. 5; 1114.040. Minimum Standards for Lot Consolidation.
An Affordable Housing Project submitted pursuant to this Chapter must comply with all the following minimum standards:
A. Number oi Residential Units. The Affordable Housing Project must include not less than 16 residential units..and amount to a development density of not less than 30 dwelling units per acre.
8. Development Standards. All development standards in the underlying zone are applicable. except as otherwise authorized by this Chapter.
C. Affordability. The property owner or authorized representative must record a covenant against title to the resulting lot, in a form approved by the City Attomey, securing the Page‘lolS
-35-
continued affordability of all dwelling units in accordance with the Density Bonus Act, Califomla Code of Regulations, and any other applicable law governing Affordable Housing Costs and Affordable Rent. The Restrictive Covenant must be recorded against the property before the issuance of the first construction permit. The property owner or authorized representative must annually report affordable housing costs to the Director. '
D. Underutilized Lot. At least one of the lots proposed for consolidation must be less than or equal to 0.16 acres in gross area.
§ 1714.050. Submittal Requirements.
The property owner or authorized represenhtive must tile an application on forms provided by the Dim, Mother with required tiling fees, 3 chain of title. and other infomrationthatmayberequtredbytheDimctororEngineer.
§ 1114.060. Review.
NlAtiordableHoustrojectsstbmittedpursuantbthisChapter which includelot outsofidafimotfmuldsorbssaresmtoDwelopmemRevlewbymeDiwctorJhe DimwfllevaluatedioflmAfladableHouslngProjedsforcompliancewimmb Ctapbrbemresdndtdmgtaawbficheamgbeiaemeapprwhgbodypumuantmmis Code.
§ 17.14070. W.
mmmmmmwrmmmmmmm
morethanthreeoithefoliowlngirmnbves:
A Lotcoverage.WMntheprojectproposesfl1emaidnmmdenshyallowedperme mderlylngzone,ativepercentincreaseinmaxinmm aimed building coverage.
B. Lands-ape requirements. When the projectproposes the maximum density allowed per the underlying zone, a 10% reducb'on in minimum landscape requirements.
C. Setbacks. When the project proposes the maximum density allowed per the underlying zone, all requimd setbacks may be reduced to live feet. except when any property line of the consolidated lot abuts a parcel zoned for lowdensity residential uses, in which case the setbacks identified in the underlying zone apply.
D. Parking Reduction. A reduction in the number of required parking spaces may be granted by the Director, provided the property owner, or authorized agent, submits a parking study prepared by a traffic engineer which evaluates parking impacts and demands and demonstrates sufficient ofl~street parking to accommodate the use in support of reduction for review and approval to the Director and City Engineer.
Page2ot3
-35-
G.
Parking Aitematives. Tandem, shared and off-site parking options may be permitted when a parking study, prepared by a traffic engineer, is submitted to the Director for review and approval, which demonstrates sufficient off—street parking and circulation to accommodate the use.
Minimum Group Open Space. The required amount of group open space may be reduced by five percent.
Smaii Lot Subdivisions. The minimum lot size required by the underlying zone may be reduced to not less than 4,000 square feet.
{5 1114.080. Findings.
Before approving any Affordable Homing Project, including incentives pursuant to this Chapter, the approving authority must find alt of the following:
A.
B.
The application satisfies the provisions of this Chapter.
Thegrantingoithe requested imamivee will notreaultinany advereeimpactsto adiacentpropertiesduetoanencroachmentoibuiidingelemntsthatwould substantiaiiy reduce suoh property's mess to light and air, the privacy enjoyed by the adjacent resHents, or otherwise reduce the reasonable use at the property. . in granting a mm in the number at parking spaces andIor panting alternatives, theapproving authority mustflndthattheAflordable Housinniectwfllprovide sufficient parking toaocommodaletheproposeduse.’
Page30f3
-37-
STATE OF CALIFORNIA )
COUNTY OF LOS ANGELES ) SS
ClTY OF BELLFLOWER )
l, Mayra Ochiqui, City Clerk of the City of Bellflower, California, do hereby certify under penalty of perjury that:
Ordinance No. 1443 had its first reading on April 14, 2025, by the following vote to wit:
AYES: Council Members— Santa ines, Koops, Morse, Sanchez, and Mayor Dunton
Ordinance No. 1443 had its second reading on April 28, 2025. and was duly passed. approved, and adopted by the City Council of the City of Bellflower at its Regular Meeting of April 28, 2025, by the following vote to wit:
AYES: Council Members - Morse, Sanchez, Santa Ines, Koops. and Mayor Dunton
Dated: April 29, 2025
(SEAL)
-38-
0% of BELT—110%
“W... Stafteportm
TO: Honorable Mayor and Members of the City Council
ATTENTION: Ryan Smoot, City Manager
FROM: Elizabeth C. Oba, Director of Planning and Building Services Rowena Genilo—Concepcion, Planning Manager
Patti Nahill, Planning Consultant
SUBJECT: Consideration and possible action to: (1) waive further reading and adopt Ordinance No. 1443 — An Ordinance approving Zoning Ordinance Text Amendment Case No. ZOTA 25-01 amending
various provisions of Title 17 (Zoning) of the Bellflower Municipal Code (“BMC”) to implement the Housing Element; and (2) discuss the implementation of the State law pertaining to Accessory Dwelling Units.
DATE: April 28, 2025
EXECUTIVE SUMMARY
Ordinance No. 1443 was introduced on April 14, 2025. Second reading and adoption is recommended. If adopted, the Ordinance will take effect in 30 days.
At its April 14, 2025 Meeting, the City Councri directed staff to provide more information on Accessory Dwelling Unit (”ADU”) requirements, specifically the maximum square footage and the number of ADU allowed. The Director of Planning and Building Services (“Director") is seeking further direction on ADU regulations, specifically the allowable square footage and the number of allowable units.
RECOMMENDATION TO CITY COUNCIL
it is recommended that the City Council consider:
1) Waive further reading and adopt Ordinance No. 1443: and 2) Provide the Director with further direction on implementing the State law pertaining to ADUs; or
3) Alternatively, discuss and take other action related to this item.
FISCAL IMPACT
There is a cost for codifying the proposed ordinance within the BMC along with publication, etc. These are already anticipated as part of the City’s budget. No additional direct fiscal impact is identified. indirectly, the proposed actions will assist the City with obtaining State and federal grants.
-39-
Staff Report - Ordinance No. 1443
April 28, 2025
DISCUSSION
On April 14, 2025, the City Council held a public hearing to consider Zoning Ordinance Text Amendment Case No. ZOTA 25-01 amending various provisions of Title 17 (Zoning) of the BMC to implement the Housing Element. One of the amendments included amending the City’s ADU regulations.
As recommended during the public hearing, Ordinance No. 1443 applies the “default” California law (Gov. Code § 66323). This is intended to be more efficient given the Legislature’s decision to constantly change the ADU laws required adjustments and amendments that are costly and time consuming. The City Council introduced Ordinance No. 1443 and directed the Director to return with a discussion for the City Council to provide more information regarding ADUs, specifically the maximum allowable square footage and the allowance for a combination of new and converted ADUs on a single lot.
During the presentation, the City’s Planning Consultant noted that the proposed ADU amendment includes, without limitation:
- Maximum allowable square footage of 800 square feet for ADUs; and ~ Maximum number of allowable ADUs for multifamily lots (conversion 91 new construction —— rather than a combination of the two scenarios).
Government Code § 66321 provides that “a local agency may establish minimum and maximum unit size requirements for both attached and detached accessory dwelling units.” Such regulations, however, may not establish a “maximum square footage requirement that is less than either of the following [slight hundred fifty square feet.” In other words, the City Council may establish a greater limit than 850 square feet. Such regulations must be adopted by ordinance in accordance with the City Charter.
Until Ordinance No. 1443 becomes effective, the City ailows a maximum floor area of 1,200 square feet for new detached ADUs. The Director recommends the City' Council maintain the maximum allowable square footage for new detached ADUs at 1,200 square feet. Should the City Council decide to maintain the current maximum allowable square footage, then an ordinance will be presented at a future date.
Additionally, the maximum number of allowable ADUs for multifamily lots is based on Government Code § 66323(a) which states “[n)otwithstanding Sections 66314 to 66322, inclusive, a local agency shall ministerially approve an application for a building permit within a residential or mixed-use zone to create any of the following” (emphasis added).
This Government Code allows multiple ADUs: (1) within portions of existing multifamily dwelling units, up to 25% of the number of existing multifamily units; or (2) on a lot with a multifamily dwelling, not to exceed eight ADUs or the number of existing units on the lot.
Currently, the City allows applicants to combine these provisions (i.e., conversions up to 25% and multiple detached ADUs not to exceed eight .ADUs or the number of existing units on the lot).
-40-
Staff Report- Ordinance No. 1443
April 28, 2025
DlSCUSSiON — Continued
Given the Legislature’s use of the term “any” rather than “all” in Government Code section 66323(a), the Director recommends the City Council apply the State law to allow multiple ADUs on a lot with a multifamily dwelling as either conversions or detached ADt, pursuant to Government Code section 66323(a)(3)-(4) respectively but not a combination of both.
The Director recommends the City Council waive further reading and adopt Ordinance No. 1443 and provide direction regarding the two considerations above.
ATTACHAENTS
A. Ordinance No. 1443 ................................................................................... 4 B. April 14, 2025, Staff R merits) .................................................. 28 66342 ....................................................................................... 33 -41-
of BELLFLOWGQ
W’ Stafteport”
TO: Honorable Mayor and Members of the City Council
ATTENTION: Ryan Smoot, City Manager
FROM: Elizabeth C. Oba, Director of Planning and Building Services Rowena Genilo—Concepcion, Planning Manager
Patti Nahili, Planning Consultant
SUBJECT: Consideration and possible action to conduct a public hearing to consider 1) Zoning Ordinance Text Amendment Case No. ZOTA 25- 01; and 2) read by title only, waive first reading, and introduce Ordinance No. 1443 -— An Ordinance approving Zoning Ordinance Text Amendment Case No. ZOTA 25-01 amending various
provisions of Title 17 (Zoning) of the Bellflower Municipal Code to implement the Housing Element.
DATE: April 14, 2025
RECOMMENDATION TO CITY COUNCIL
1) Open the public hearing; take testimonial and documentary evidence; and after considering the evidence, read by title only, waive first reading, and introduce Ordinance No. 1443; or
2) Alternatively, discuss and take other action related to this item.
FISCAL IMPACT
There is a cost for codilying the proposed ordinance within the Bellflower Municipal Code (“8M0”) along with publication, etc. These are already anticipated as part of the City's operations. No additional direct fiscal impact is identified. Indirectly, the proposed actions will assist the City with obtaining State and federal grants.
PUBLIC NOTICE
A Notice of Public Hearing was published in the Los Cerritos Community News newspaper on March 21, 2025. Public hearing notices were posted at City Hall, Bellflower Substation, Thompson Park. Simms Park, Caruthers Park, Brakensiek Library, and the City’s website on March 21, 2025. As of the writing of this staff report, the City has received no correspondence
-42-
Staff Report — Zoning Ordinance Text Amendment Case No. ZOTA 25-01 April 14, 2025
CEQA STATUS
The City reviewed the environmental impacts of the proposed Ordinance pursuant to the California Environmental Quality Act (Public Resources Code §§ 21000, et seq. “CEQA') and the regulations promulgated thereunder (14 Cal. Code of Regs. §§ 15000, et seq., the “CEQA Guidelines”). in accordance with CEQA and CEQA Guidelines § 15162, the City Council finds as follows:
A. Resolution No. 22-04 was adopted by the City Council on January 20, 2022, approving Mitigated Negative Declaration No. MND 21-01.
B. Changing the regulatory framework for future development and uses within the Bellflower Municipal Code is an activity contemplated by MND 21-01.
C. This activity does not contemplate any changes which will require major revisions to MND 21-01 nor are there any substantial changes with respect to the circumstances under which MND 21-01 was undertaken.
D. There is no new information of substantial importance, which was not known and could not have been known with the exercise of reasonable diligence at the time MND 21-01 was approved.
TYPE OF ACTION {Lgislatigel
In considering BMC amendments, the City Council acts in its discretionary legislative capacity. The recommended action constitutes 3 Zoning Ordinance Text Amendment (“ZOTA”) that would amend the BMC by adding and modifying zoning regulations to remove development constraints, to streamline processing and to update the BMC to address changes in state laws to implement the Housing Element ('HE”). Pursuant to BMC § 17.104.030, the City Council must find:
A There are changed conditions since the existing zoning regulations became effective that warrant the proposed amendment to the BMC.
B. The proposed amendment to the BMC will not adversely affect adjoining property as to the value or precedent and will not be detrimental to the area.
C. The proposed amendment to the BMC will be in the interest or furtherance of public health, safety and general welfare.
D. The proposed amendment to the BMC will not adversely affect the City’s General Plan or the City’s Comprehensive Zoning Plan.
.43-
Staff Report ~ Zoning Ordinance Text Amendment Case No. ZOTA 25-01 April 14, 2025
BACKGROUND
oz. Housing Element
The City’s Housing Element includes the requirement to accommodate Bellflower’s Regional Housing Needs Allocation (‘RHNA”). Specifically, the City must implement land use regulations that encourage new housing consisting of 3,735 new residential units (1,015 very low-income units; 488 low-income units; 553 moderate income units; and 1,679 above moderate-income units). To achieve this goal, the Housing Plan identities long-term housing goals and short-term policies to address the identified housing needs.
The goals and policies are then implemented through a series of housing programs. The City has 35 recognized programs, including existing and new programs that have been added to address the City’s unmet housing needs. Each program identifies specific actions the City plans to undertake toward achieving each goal and policy.
DISCUSSION
As part of the certification of the Housing Element, the City committed to the implementation of certain Housing Element Programs. The proposed ZOTA IS necessary to implement certain Housing Element Programs.
0:0 Zoning Ordinance Text Amendment
ZOTA 25-01 establishes a regulatory framework of future development and uses. The BMC amendments would be applicable City-wide, as they implement relevant State laws and the HE (Ordinance No. 1443, Exhibits A through E). The proposed ZOTA addresses the following categories:
A Density Bonus (Program _5) - Harmonize the BMC with State Density Bonus provisions consistent with new legislation. All changes occur in BMC Chapter
17.41. (Exhibit A).
B. Accessory Dwelling Units (Program 9) — Repeal and replace the City’s ADU ’ regulations with provisions that implement the dynamic State mandates. The ZOTA further removes development constraints by consolidating all ADU regulations into one Chapter for ease of access and removing antiquated terminology from the BMC. (Exhibit B).
C. Community Care Facilities (Program 13) — Establish a new Section 17.72.140 governing community care facilities that consolidates all land use regulations for community care facilities, conditionally allows residential care facilities serving seven or more persons in residential zones, and imposes objective standards. (Exhibit C).
-44-
Staff Report — Zoning Ordinance Text Amendment Case No. ZOTA 25-01 April 14, 2025
DISCUSSlON — Continued
D. Emergency Shelters (Program 18) — Harmonize the BMC with State law regarding the areas where emergency shelters are permitted and regulations governing use and development within the City. The proposed amendment includes establishing a maximum capacity of 30 occupants. and updating parking standards based on the number of staff rather than the number of beds/rooms. These changes proposed are mandated under State law. Additionally, the ZOTA removes development constraints by consolidating all of the City’s emergency shelter regulations in a single BMC section. (Exhibit D).
. Affordable Housing — Lot Consolidation (Program 29) — Repeals and replaces BMC Chapter 17.14 to provide standards and incentives for the consolidation of lots in support of the development of affordable housing. The proposed provision provides incentives (maximum of three) applicable to affordable housing projects that are proposing at least 16 residential units with a minimum density of 30 dwelling units per acre, which include: increased lot coverage; reduced landscaping; reduced setback; reduced parking; parking alternatives; reduced group open space; and/or allowance for small lot subdivisions. (Exhibit E) . Remove Development Constraints (Program 13) — to revise the BMC to address constraints identified in Section 5 of the Housing Element, including (Attachment A, Sections 15-30):
0 reducing parking requirements in the A-E, R-1, R-2 and R-3 zones (i.e., to ensure they do not constrain the development of housing) to require only a ' two-car garage and one guest parking space for each dwelling unit - removing the requirement of additional parking spaces for additional bedrooms after the first two
. increased height requirements in the R-3 zone to three stories or 40 feet, whichever is less - previously two and one-half stories or 35 feet, whichever is less;
a removal of subjective findings as part of the design review process (i.e., point system for the 2/3'“ rule);
0 establishing explicit setbacks (i.e., 15 feet for one-story buildings wand 20 feet for two-story buildings), rather than setbacks based on formula 0 new references have been added to BMC Chapter 17.14, “Zones Enumerated” Section to list “Specific Plan (SP)” and “Housing Opportunity Overlay Zone (HOOZ)."
. Supportive Housing (Program 18) — State law requires that supportive housing be permitted in multi-family and mixed use zones subject only to objective standards in the underlying zone. The ZOTA ham'ionizes the BMC with the current State laws and consolidates all the BMC regulations into a single chapter to remove development constraints. (Attachment A, Sections 45-56) -45-
Staff Report — Zoning Ordinance Text Amendment Case No. ZOTA 25-01 April 14, 2025
DISCUSSION - Continued
H. Reasonable Accommodations for Persons with Disabilities (Program 25) — the proposed amendment includes, without limitation: updating the disability definition; removing findings 5 and 6 that were deemed by HCD to be a constraint; and removing the public notice and public hearing requirements to be consistent with State law changes. All changes occur in BMC Chapter 17.42. (Attachment A, Sections 57-60)
ATTACHMENT
A. Ordinance No. 1443 ' ' ' ........................................................ 6 -45-
at 5:; Mum. ill‘ " / LEGISLATIVE INFORMATION
Home Bill information : Callfomia Law Publications 5 Other Resources My Subscriptions 3 My Favorites Code:_ Section: lor20ri001 .. G
' Lin: mum
GOVERNMENT CODE - GOV
TITLE 7. PLANNING AND LAND USE [65000 - 56499.58] (Heading of Title 7 amended by Stats. 1974, Ch. 1536. ) DIVISION 1. PLANNING AND ZONING [65000 - £6342] { Heading of Division 1 added by Stats 1974, Ch. 1536. ) CHAPTER 13. Accessory Dwelling Units [66310 - 66342] ( Chapter 13 added by Stats. 2024, Ch. 7‘. Sec. 20. ) ARTICLE 1. General Provisions [66310 v60313] (Article 1 added by Stats, 2024, Ch. 7, Sec. 20. ) 99-3194 The Legislature finds and declares all of the following:
(a) Accessory dwelling units are a valuable form of housing in Callfomla. . (b) Accessory dwelling units provide housing for family members, students, the elderly, in-home health care providers, the disabled, and others, at below market prices within existing neighborhoods. (c) Homeowners who create accessory dwelling units benefit from added lncome, and an increased sense of security.
(d) Allowing accessory dwelling units in single~family or multifamily residential zones provides additional rental housing stock in California.
(a) California faces a severe housing crisis.
(f) The state is failing far short of meeting current and future housing demand with serious consequences for the state’ 5 economy, our ability to build green infill consistent with state greenhouse gas reduction goals, and the well- being of our citizens, particularly lower and middle-income earners. (g) Accessory dwelling units offer lower cost housing to meet the needs of existing and future residents within existing neighborhoods, while respecting architecturai character:
. (h) Accessory dwelling units are, therefore, an essential component of Callfomia's housing supply. (Added by Sites. 2024, Ch. 7, Sec. 20. (SB 477) Effective Maro‘i 25, 2024.) m It is the intent of the Legislature that an accessory dwelling unit ordinance adopted by a local agency has the effect of providing for the creation of accessory dwelling units and that provisions in this ordinance relating to matters including unit size, parking, fees, and other requirements, are not so arbitrary, excessive, or burdensome so as to unreasonably restrict the ability of homeowners to create accessory dwelling units in zones in which they are authorized by local ordinance.
(Added by Stats. 2024, Ch. 7, Sec. 20. (so 477) Effective March 25, 2024.)
9.3912: Notwithstanding Section 65803, this chapter shall also apply to a charter city. (Added by Stats: 3024/6557," sea 26733" 477‘)'L='i'lier:fi~ ‘ 'i/e' MET-51 I5, i074.) ’ m For purposes of this chapter:
(a) “Accessory dwelling unit” means an attached or a detached residential dwelling unit that provides complete independent living facilities for one or more persons and is located on a lot with a proposed or existing primary residence. It shall include permanent provisions for living, sleeping, eating, cooking, and sanitation on the same parcel as the single-family or multifamily dwelling is or will be situated. An accessory dwelling unit also includes the following:
(1) An efficiency unit.
(2) A manufactured home, as defined In Section 18007 of the Health and Safety Code. -47-
(b) “Accessory structure" means a structure that is accessory and incidental to a dwelling located on the same lot. it) “Efficiency unit” has the same meaning as defined in Section 17958.1 of the Health and Safety Code. (d) “Junior accessory dwelling unit” means a unit that is no more than 500 square feet in size and contained entirely within a single-family residence. A junior accessory dwailing unit may include separate sanitation facilities, or may share sanitation facilities with the existing structure. (e) “Livable space” means a space in a dwelling intended for human habitation, including living, sleeping, eating, cooking, or sanitation.
(f) “Living area” means the interior habitable area of a dwelling unit, including basements and attics, but does not include a garage or any accessory structure.
(9) “Local agency” means a city, county, or city and county, whether general law or chartered. (h) “Nonconforming zoning condition” means a physical improvement on a property that does not conform to current zoning standards.
(i) “Objective standards" means standards that involve no personal or subjective judgment by a public official and are uniformiy verifiable by reference to an external and uniform benchmark or criterion available and knowabie by both the development applicant or proponent and the public official prior to submittal. (j) “?assageway” means a pathway that is unobstructed clear to the sky and extends from a street to one entrance of the accessory dwelling unit.
(k) “Permitting agency” means any entity that is involved in the review of a permit for an accessory dwelling unit or junior accessory dwelling unit and for which there is no substitute, including, but not limited to, applicable planning departments, building departments, utilities, and special diStricts. (l) “Proposed dwelling" means a dwelling that is the subject of a permit application and that meets the requirements for permitting. .
(m) “Public transit" means a location, including, but not limited to, a bus stop or train station, where the public may access buses, trains, subways, and other forms of transportation that charge set fares, run on fixed routes, and are available to the public.
(n) “Tandem parking" means that two or more automobiles are parked on a driveway or in any other location on a lot, lined up behind one another. ,
(Amended by Stats. 2024, Ch. 296, Sec. 1. (so 1221) Effective January 1, 2025.) -43-
{5% Eégmim
LEGISLATIVE INFORMATION
Home Billinfonnaflon E Caufommm : Publications ; Other Resources ‘ MySubsodptions ‘ iii/Favorites Code:— Section: iorzo'nom' @
use more: GOVERNMENT cops - eov
TITLE 7. PLANNING AND LAND USE [65000 - 66499.58] ( Heading of Title 7 amended by Stats. 1974, Ch. 1536. ) DIVISION 1. PLANNING AND ZONING [65000 -66342] ( Heading of Division 1 added by Stats. 1974, Ch. 1536. ) CHAPTER 13. Accessory Dwelling Units [66310 - 66342] ( Chapter 13 added by Stats. 2024, Ch. 7. Sec. 20. ) ARTICLE ZAccossory Dwalling Unit Approvals [66314 - 66332} ( Article 2 added by Stats. 2024, Ch. 7, Sec. 20. ) $315» A local agency may, by ordinance, provide for the creation of accessory dwelling units in areas zoned to allow single-family or multifamily dwelling residential use. The ordinance shall do all of the following:
(a) Designate areas within the jurisdiction of the local agency where accessory dwelling units may be permitted.
The designation of areas may be based on the adequacy of water and sewer services and the impact of accessory dwelling units on traffic flow and public safety. A local agency that does not provide water or sewer services shall consult with the local water or sewer service provider regarding the adequacy of water and sewer services before designating an area where accessory dwelling units may be permitted. (b) (1) Impose objective standards on accessory dwelling units that include, but are not limited to, parking, height, setback, landscape, architectural review, maximum size of a unit, and standards that prevent adverse impacts on any real property that is listed in the California Register of Historical Resources. These standards shall not include requirements on minimum lot size.
(2) Notwithstanding paragraph (1), a local agency may reduce or eliminate parking requirements for any accessory dwelling unit located within its jurisdiction. (c) Provide that accessory dwelling units do not exceed the allowable density for the lot upon which the accessory dwelling unit is located, and that accessory dwelling units are a residential use that is consistent with the existing general plan and zoning designation for the lot.
(:1) Require the accessory dwelling units to comply with all of the following:
(1) Except as provided in Article 4 (commencing with Section 66340), the acceswry dwelling unit may be rented separate from the primary residence, but shall not be sold or othenivise conveyed separate from the primary residence.
(2) The lot is zoned to allow single-family or multifamily dwelling residential use and includes a proposed or existing dwelling. -
(3) The accessory dwelling unit is either attached to, or located within, the proposed or existing primary dwelling, Including attached garages, storage areas or similar uses, or an accessory structure or detached from the proposed or existing primary dwelling and located on the same lot as the proposed or existing primary dwelling, including detached garages.
(4) If there is an existing primary dwelling, the total floor area of an attached accessory dwelling unit shall not exceed 50 percent of the existing primary dwelling.
(5) The total floor area for a detached accessory dwelling unit shall not exceed 1,200 square feet. (6) No passageway shall be required in conjunction with the construction of an accessory dwelling unit. (7) No setback shall be required for an existing living area or accessory structure or a structure constructed in the same location and to the same dimensions as an existing structure that is converted to an accessory dwelling unit -49-
or to a portion of an accessory dwelling unit, and a setback of no more than four feet from the side and rear lot lines shall be required for an accessory dwelling unit that ls not converted from an existing structure or a new structure constructed in the same location and to the same dimensions as an existing structure. (8) Local building code requirements that apply to detached dwellings, except that the construction of an accessory dwelling unit shall not constitute a Group R occupancy change under the local building code, as described in Section 310 of the California Building Code (Title 24 of the California Code of Regulations), unless the building official or enforcement agency of the local agency makes a written finding based on substantial evidence in the record that the construction of the accessory dwelling unit could have a specific, adverse impact on public health and safety. Nothing in this paragraph shall be interpreted to prevent a local agency from changing the occupancy code of a space that was unhabitabie space or was only permitted for nonresidential use and was subsequently converted for residential use pursuant to this article. (9) Approval by the local health officer where a private sewage disposal system is being used, if required. (10) (A) Parking requirements for accessory dwelling units shall not exceed one parking space per accessory dwelling unit or per bedroom, whichever is less. These spaces may be provided as tandem parking on a driveway. (B) Offstreet parking shall be permitted in setback areas in locations determined by the local agency or through tandem parking, unless specific findings are made that parking in setback areas or tandem parking is not feasible based upon specific site or regional topographical or fire and life safety conditions. (C) This subparagraph shall not apply to an accessory dwelling unit that is described in Section 66322. (11) When a garage, carport, covered parking structure, or uncovered parking space is demolished in conjunction with the construction of an accessory dwelling unit or converted to an accessory dwelling unit, the local agency shall not require that those offstreet parking spaces be replaced. (12) Accessory dwelling units shall not be required to provide fire sprinklers if they are not required for the primary residence. The construction of an accessory dwelling unit shall not trigger a requirement for fire sprinklers to be installed in the existing primary dwelling. (e) Require that a demolition permit for a detached garage that is to be replaced with an accessory dwelling unit be reviewed with the application for the accessory dwelling unit and issued at the same time. (i) An accessory dwelling unit ordinance shall not require, and the applicant shall not be otherwise required, to provide written notice or post a placard for the demolition of a detached garage that is to be replaced with an accessory dwelling unit, unless the property is located within an architecturally and historically significant historic district.
(Amended by Stats. 2024, Ch. 296, Sec. 2. (SB 1211) Efi‘ective January 1, 2025.) £5311 Section 66314 establishes the maximum standards that a local agency shall use to evaluate a proposed accessory dwelling unit on a lot that includes a proposed Or existing single-family dwelling. No additional standards, other than those provided in Section 66314, shall be used or imposed, including an owner-occupant requirement, except that a local agency may require that the property may be used for rentals of terms 30 days or longer. (Added by Stats. 2024, Ch. 7, Sec. 20. (SB 477) Effective March 25, 2024.)
5.9315 An existing accessory dwelling unit ordinance governing the creation of an accessory dwelling unit by a local agency or an accessory dwelling ordinance adopted by a local agency shall provide an approval process that includes only ministerial provisions for the approval of accessory dwelling units and shall not include any discretionary processes, provisions, or requirements for those units, except as otherwise provided in this article. If a local agency has an existing accessory dwelling unit ordinance that fails to meet the requirements of this article, that ordinance shall be null and void and that agency shall thereafter apply the standards established in this article for the approval of accessory dwelling units, unless and until the agency adopts an ordinance that complies with this article.
(Added by Stats. 2024, Ch. 7, Sec. 20. (SB 477) Efiectlve March 25, 2024.) $53-11- (a) A permit application for an accessory dwelling unit or a junior accessory dwelling unit shall be considered and approved ministerially without discretionary review or a hearing, notwithstanding Section 65901 or 65906 or any local ordinance regulating the issuance of variances or special use permits. The permitting agency shall either approve or deny the application to create or serve an accessory dwelling unit or a junior accessory -50-
dwelling unit within 60 days from the date the permitting agency receives a completed application if there ls an existing single-family or multifamily dwelling on the lot. If the permit application to create or serve an accessory dwelling unit or a junior accessory dwelling unit is submitted with a permit application to create a new single-family or multifamily dwelling on the lot, the permitting agency may delay approving or denying the permit application for the accessory dwelling unit or the junior accessory dwelling unit until the permitting agency approves or denies the permit application to create the new single—family or multifamily dwelling, but the application to create or serve the accessory dwelling unit or junior accessory dwelling unit shall be considered without discretionary review or hearing. If the applicant requests a delay, the 60-day time period shall be tolled for the period of the delay. If the local agency has not approved or denied the completed application within 60 days, the application shall be deemed approved. A local agency may charge a fee to reimburse it for costs incurred to implement this section, including the costs of adopting or amending any ordinance that provides for the creation of an accessory dwelling unit. (b) If a pemitting agency denies an application for an accessory dwelling unit or junior accessory dwelling unit pursuant to subdivision (a), the permitting agency shall, within the time period described in subdivision (a), return in writing a full set of comments to the applicant with a list of items that are defective or deficient and a description of how the application can be remedied by the applicant. (c) No local ordinance, policy, or regulation, other than an accessory dwelling unit ordinance consistent with this article shall be the basis for the delay or denial of a building permit or a use permit under this section. (Added by Stats. 2024, Ch. 7, Sec. 20. (SB 477) Effective March 25, 2024.) m (a) A local agency may amend its zoning ordinance or general plan to incorporate the policies, procedures, or other provisions applicable to the creation of an accessory dwelling unit if these provisions are consistent with the limitations of this article.
(b) An accssory dwelling unit ordinance shall not be considered in the application of any local ordinance, policy, or program to limit residential growth.
(Added by Stats. 2024, Ch. 7, Sec. 20. (SB 477) Effective March 25, 2024.) m An accessory dwelling unit that conforms to Section 66314 shall be deemed to be an accessory use or an accessory building and shall not be considered to exceed the allowable density for the lot upon which it is located, and shall be deemed to be a residential use that is consistent with the existing general plan and zoning designations forthe lot. The accessory dwelling unit shall not be considered in the application of any local ordinance, policy, or program to limit residential growth. (Added by Stats. 2024, Ch. 7, SEC. 20. (SB 477) Effective March 25, 2024.) m (a) When a local agency that has not adopted an ordinance governing accessory dwelling units in accordance with Section 66314 receives an application for a permit to create or serve an accessory dwelling unit pursuant to this article, the local agency shall approve or disapprove the application ministerially without discretionary review pursuant to Section 56317. The permitting agency shall either approve or deny the application to create or serve an accessory dwelling unit or a junior accessory dwelling unit within 60 days from the date the permitting agency receives a completed application if there is an existing single-family or multifamily dwelling on the lot. If the permit application to create or serve an accessory dwelling unit or a junior accessory dwelling unit is submitted with a permit application to create or serve a new single-family or multifamily dwelling on the lot, the perrnltting agency may delay approving or denying the permit application for the accessory dwelling unit or the junior accessory dwelling unit until the permitting agency approves or denies the permit application to create or serve the new single-family or multifamily dwelling, but the application to create or serve the accessory dwelling unit or junior accessory dwelling unit shall still be considered ministerially without discretionary review or a hearing.
If the applicant requests a delay, the-GO-day time period shall be tolled for the period of the delay. If the local agency has not approved or denied the completed application within 60 days, the application shall be deemed approved.
(b) If a permitting agency denies an application for an accessory dwelling unit or junior accessory dwelling unit pursuant to subdivision (a), the permitting agency shall, within the time period described in subdivision (a), return in writing a full set of comments to the applicant with a list of items that are defective or deficient and a description of how the application can be remedied by the applicant. (Added by Stats. 2024, Ch. 7, Sec. 20. (SB 477) Effective March 25, 2024.)
55.3214 (a) Subject to subdivision (b), a local agency may establish minimum and maximum unit size requirements for both attached and detached accessory dwelling units. -51-
(b) Notwithstanding subdivision (a), a local agency shall not establish by ordinance any of the following:
(1) A minimum square footage requirement for either an attached or detached accessory dwelling unit that prohibits an efficiency unit.
(2) A maximum square footage requirement for either an attached or detached accessory dwelling unit that is less than either of the following:
(A) Eight hundred fifty square feet.
(B) One thousand square feet for an accessory dwelling unit that provides more than one bedroom. (3) Any requirement for a zoning clearance or separate zoning review or any other minimum or maximum size for an accessory dwelling unit, size based upon a percentage of the proposed or existing primary dwelling, or limits on lot coverage, floor area ratio, open space, front setbacks, and minimum lot size, for either attached or detached dwellings that does not permit at least an 800 square foot accessory dwelling unit with four-foot side and rear yard setbacks to be constructed in compliance with all other local development standards. (4) Any height limitation that does not allow at least the following, as applicable:
(A) A height of 16 feet for a detached accessory dwelling unit on a lot with an existing or proposed single family or multifamily dwelling unit.
(B) A height of 18 feet for a detached accessory dwelling unit on a lot with an existing or proposed single family or multifamily dwelling unit that is within one-half of one mile walking distance of a major transit stop or a high~quality transit corridor, as those terms are defined in Section 21155 of the Public Resources Code. A local agency shall also allow an additional two feet in height to accommodate a roof pitch on the accessory dwelling unit that is aligned with the roof pitch of the primary dwelling unit. (C) A height of 18 feet for a detached accessory dwelling unit on a lot with an existing or proposed multifamily, multistory dwelling.
(D) A height of 25 feet or the height limitation in the local zoning ordinance that applies to the primary dwelling, whichever is lower, for an accessory dwelling unit that is attached to a primary dwelling. This subparagraph shall not require a local agency to allow an accessory dwelling unit to exceed two stories. (AddEd by Stats. 2024, Ch. 7, Sec. 20. (SB 477) Efi‘ective March 25, 2024.) £332: Notwithstanding any other law, and whether or not the local agency has adopted an ordinance governing accessory dwelling units in accordance with Section 66314, all of the following shall apply:
(a) A local agency shall not impose any parking standards for an accessory dwelling unit in any of the following instances:
(1) Where the accessory dwelling unit is located within one-half of one mile walking distance of public transit. (2) Where the accessory dwelling unit is located within an architecturally and historically significant historic district.
(3) Where the accessory dwelling unit is part of the proposed or existing primary residence or an accessory structure.
(4) When on-street parking permits are-required but not offered to the, occupant of the accessory dwelling unit. (5) When there is a car share vehicle located within one block of the accessory dwelling unit. (6) When a permit application for an accessory dwelling unit is submitted with a permit application to create a new single-family dwelling or a new multifamily dwelling on the same lot, provided that the accessory dwelling unit or the parcel satisfies any other criteria listed in this subdivision. (is) The local agency shall not deny an application for a permit to create an accessory dwelling unit due to the correction of nonconforming zoning conditions, building code violations, or unpermitted structures that do not present a threat to public health and safety and are not affected by the construction of the accessory dwelling unit. (Added by Stats. 2024, Ch. 7, Sec. 20. (SB 477) Effective March 25, 2024.) -52-
553234 (a) Notwithstanding Sections 66314 to 66322, inclusive, 3 local agency shall mlnlsterially approve an application for a building permit within a residential or mixed-use zone to create any of the following:
(1) One accessory dwelling unit and one junior accessory dwelling unit per lot with a proposed or existing single— famiiy dwelling if all of the following apply:
(A) The accessory dwelling unit or junior accessory dwelling unit is within the proposed space of a single- family dwelling or existing space of a single-family dwelling or accessory structure and may include an expansion of not more than 150 square feet beyond the same physical dimensions as the existing accessory structure. An expansion beyond the physical dimensions of the existing accessory structure shall be limited to accommodating ingress and egress.
(B) The space has exterior access from the proposed or existing single-family dwelling. (C) The side and rear setbacks are sufficient for fire and safety. (D) The junior accessory dwelling unit complies with the requirements of Article 3 (commencing with Section 66333).
(2) One detached, new construction, accessory dwelling unit that does not exceed four-foot side and rear yard setbacks for a lot with a proposed or existing single-family dwelling. The accessory dwelling unit may be combined with a junior accessory dwelling unit described in paragraph (1). A local agency may impose the following conditions on the accessory dwelling unit:
(A) A total floor area limitation of not more than 800 square feet. (B) A height limitation as provided in subparagraph (A), (B), or (C) of Paragraph (4) 0f SUbd'ViSlO" 0’) °f Section 66321, as applicable.
(3) (A) Multiple accessory dwelling units within the portions of existing multifamily dwelling structures that are not used as-livabie space, including, but not limited to, storage rooms, boiler rooms, passageways, attics, basements, or garages, if each unit complies with state building standards for dwellings. (B) A local agency shall allow at least one accessory dwelling unit within an existing multifamily dwelling and shall allow up to 25 percent of the existing multifamily dwelling units. (4) (A) (i) Multiple accessory dwelling units, not to exceed the number specified in clause (ii) or (iii), as applicable, that are located on a lot that has an existing or proposed multifamily dwelling, but are detached from that multifamily dwelling and are subject to a height limitation in subparagraph (A), (B), or (C) of paragraph (4) of subdivision (b) of Section 66321, as applicable, and rear yard and side setbacks of no more than four feet. (ii) On a lot with an existing multifamily dwelling, not more than eight detached accessory dwelling units.
However, the number of accessory dwelling units allowable pursuant to this clause shall not exceed the number of existing units on the lot.
(iii) On a lot with a proposed multifamily dwelling, not more than two detached accessory dwelling units. (B) If the existing multifamily'dwelling has a rear or side setback of less than four feet, the local agency shall not require any modification of the existing multifamily dwelling as a condition of approving the application to construct an accessory dwelling unit that satisfies the requirements of this paragraph. (b) A local agency shall not impose any objective development or design standard that is not authorized by this section upon any accessory dwelling unit that meets the requirements of any of paragraphs (1) to (4), inclusive, 0f subdivision (a).
(c) A local agency shall not require, as a condition for ministerial approval of a permit application for the creation of an accessory dwelling unit or a junior accessory dwelling unit, the correction of nonconforming zoning conditions. (d) The installation of fire sprinklers shall not be required in an accessory dwelling unit if sprinklers are not required for the primary residence. The construction of an accessory dwelling unit shall not trigger a requirement for fire -53-
sprinklers to be installed in the existing multifamily dwelling. (e) A local agency shall require that a rental of the accessory dwelling unit created pursuant to this section be for a term longer than 30 days.
(f) A local agency may require, as part of the application for a permit to create an accessory dwelling unit connected to an onsite wastewater treatment system, a percolation test completed within the last five years, or, if the percolation test has been recertified, within the last 10 years. (9) Notwithstanding Section 66321 and subdivision (a) a local agency that has adopted an ordinance by July 1, 2018, providing for the approval of accessory dwelling units in multifamily dwelling structures shall ministerially consider a permit application to construct an accessory dwelling unit that is described in subdivision (a), and may impose objective standards including, but not limited to, design, development, and historic standards on said accessory dwelling units. These standards shall not include requirements on minimum lot size. (Amended by Stats. 2024, Ch. 296, Sea 3. (SB 1211) Effective January 1, 2025.) $5335- (a) Fees charged for the construction of accessory dwelling units shall be determined in accordance with Chapter 5 (commencing with Section 66000) and Chapter 7 (commencing with Section 66012). (b) An accessory dwelling unit shall not be considered by a local agency, special district, or water corporation to be a new residential use for purposes of calculating connection fees or capacity charges for utilities, including water and sewer service, unless the accessory dwelling unit was constructed with a new single-family dwelling. (c) (1) A local agency, special district, or water corporation shall not impose any impact fee upon the development of an accessory dwelling unit less than 750 square feet. Any impact fees charged for an accessory dwelling unit of 750 square feet or more shall be charged proportionately in relation to the square footage of the primary dwelling unit.
(2) For purposes of this subdivision, “impact fee” has the same meaning as the term “fee" is defined in subdivision (b) of Section 66000, except that it also includes fees specified in Section 66477. “Impact fee” does not include any connection fee or capacity charge charged by a local agency, special district, or water corporation. (d) For an accessory dwelling unit described in paragraph (1) of subdivision (a) of Section 66323, a local agency, special district, or water corporation shall not require the applicant to install a new or separate utility connection directly between the accessory dwelling unit and the utility or impose a related connection fee or capacity charge, unless the accessory dwelling unit was constructed with a new single-family dwelling, or upon separate conveyance of the accessory dwelling unit pursuant to Section 66342. (e) For an accessory dwelling unit that is not described in paragraph (1) of subdivision (a) of Section 66323, a local agency, special district, or water corporation may require a new or separate utility connection directly between the accessory dwelling unit and the utility. Consistent with Section 66013, the connection may be subject to a connection fee or capacity charge that shall be proportionate to the burden of the proposed accessory dwelling unit, based upon either its square feet or the number of its drainage fixture unit (DFU) values, as defined in the Uniform Plumbing Code adopted and published by the International Association of Plumbing and Mechanical Officials, upon the water or sewer system. This fee or charge shall not exceed the reasonable cost of providing this service. (Added by Stats. 2024, Ch. 7, Sec. 20. (SB 477) Effective March 25, 2024.) 51:25. (a) Except as provided in subdivision (b). this article shall supersede a conflicting local ordinance. (b) This article does not limit the authority of local agencies to adopt less restrictive requirements for the creation of an accessory dwelling unit.
(Added by Stats. 2024, Ch. 7, Sec. 20. (SB 477) Efi'ectlve March 25, 2024.) m (a) A loci-ll agency shall submit a copy of the ordinance adopted pursuant to Section 66314 to the Department of Housing and Community Development within 60 days after adoption. After adoption of an ordinance, the department may submit written findings to the local agency as to whether the ordinance complies with this article.
(b) (1) If the department finds that the local agency’s ordinance does not comply with this article, the department shall notify the local agency and shall provide the local agency with a reasonable time, no longer than 30 days, to respond to the findings before taking any other action authorized by this article. (2) The local agency shall consider the findings made by the department pursuant to paragraph (1) and shall do one of the following:
-54-
(A) Amend the ordinance to comply with this article.
(B) Adopt the ordinance without changes. The local agency shall include findings in its resolution adopting the ordinance that explain the reasons the local agency believes that the ordinance complies with this article despite the findings of the department.
(c) (1) If the local agency does not amend its ordinance in response to the department’s findings or does not adopt a resolution with findings explaining the reason the ordinance complies with this article and addressing the department’s findings, the department shall notify the local agency and may notify the Attorney General that the local agency is in violation of state law.
(2) Before notifying the Attorney General that the local agency is in violation of state law, the department may consider whether a local agency adopted an ordinance in compliance with this article between January 1, 2017, and January 1, 2020.
(Added by SEE. 2024, Ch. 7, Sec. 20. (SB 477) Efiective March 25, 2024.) m The department may review, adopt, amend, or repeal guidelines to implement uniform standards or criteria that supplement or clarify the terms, references, and standards set forth in this article. The guidelines adopted pursuant to this section are not subject to Chapter 3.5 (commencing with Section 11340) of Part 1 of Division 3 of Title 2.
(Added by Stats. 2024, Ch. 7, Sec. 20. (SB 477) Effective March 25, 2024.) m A local agency shall not issue a certificate of occupancy for an accessory dwelling unit before the local agency issues a certificate of occupancy for the primary dwelling. (Added by Stats. 2024, Ch. 7, Sec. 20. (SB 477) Effecrive March 25, 2024.) 55323. Nothing in this article shall be construed to supersede or in any way alter or lessen the effect or application of the California Coastal Act of 1976 (Division 20 (commencing with Section 30000) of the Public Resources Code), except that the local government shall not be required to hold public hearings for coastal development permit applications for accessory dwelling units.
(Added by Stats. 2024, Ch. 7, Sec. 20. (SB 477) Effective March 25, 2024.) £5339: A local agency may count an accessory dwelling unit for purposes of identifying adequate sites for housing, as specified in subdivision (a) of Section 65583.1, subject to authorization by the department and compliance with this division.
(Added by Stats. 2024, Ch. 7, Sec. 20. (SB 477) Effective March 25, 2024.) £131. In enforcing building standards pursuant to Article 1 (commencing with Section 17960) of Chapter 5 of Part
1.5 of Division 13 of the Health and Safety Code for an accessory dwelling unit described in subdivision (a) or (b), a local agency, upon request of an owner of an accessory dwelling unit for a delay in enforcement, shall delay enforcement of a building standard, subject to compliance with Section 17980.12 of the Health and Safety Code:
(a) The accessory dwelling unit was built before January 1, 2020. (b) The accessory dwelling unit was built on or after January 1, 2020, in a local jurisdiction that, at the time the accessory dwelling unit was built, had a noncompliant accessory dwelling unit ordinance, but the ordinance is compliant at the time the request ls made.
(Added by Stab. 2024, Ch. 7, Sec. 20. (SB 477) Efi'ective March 25, 2024.) 5-53-33: (a) Notwithstanding any other law, and except as otherwise provided in subdivision (b), a local agency shall not deny a permit for an unpermltted accessory dwelling unit or unpennitted junior accessory dwelling unit that was constructed before January 1, 2020, due to either of the following:
(1) The accessory dwelling unit or junior accessory dwelling unit is in violation of building standards pursuant to Article 1 (commencing with Section 17960) of Chapter 5 of Part 1.5 of Division 13 of the Health and Safety Code. (2) The accessory dwelling unit or junior accessory dwelling unit does not comply with this article or Article 3 (commencing with Section 66333), as applicable, or any local ordinance regulating accessory dwelling units or . junior accessory dwelling units.
-55-
Home Bill information California Law . Publications ; Other Resources 3 My Subscriptions My Favorites Coda:_ Suction:1or20r1l)01 ' ®
L192 W
GOVERNMENT CODE - GOV
TITLE 7. PLANNiNG AND LAND USE [65000 - 66499.58} ( Heading of Title 7amended by Stats. 1974, Ch. 1536.) DWISION 1. PLANNING AND ZONING [65000 - 66342] ( Heading of Division 1 added by Stats. 1974, Ch. 1538. ) CHAPTER 13. Accessory Dwelling Units [66310 - 66342] ( Chapter 13 added by Stats. 2024, Ch. 7, Sec. 20. ) ARTICLE 3. Junior Accessory Dwelling Units [66333 ~66339] ( Article 3 added by Stats. 2024, Ch. 7, Sec. 20. ) £9.13. Notwithstanding Article 2 (commencing with Section 66314), a local agency may, by ordinance, provide for the creation of junior accessory dwelling units in single—family residential zones. The ordinance may require a permit to be obtained for the creation of a junior accessory dWelling unit, and shall do all of the following:
(a) Limit the number of junior accessory dwelling units to one per residential lot zoned for single-family residences with a single-family residence built, or proposed to be built, on the lot. (b) Require owner-occupancy in the single family residence in which the junior accessory dwelling unit will be permitted. The owner may reside in either the remaining portion of the structure or the newly created junior accessory dwelling unit. Owner—occupancy shall not be required if the owner is another governmental agency, land trust, or housing organization.
(c) Require the recordation of a deed restriction, which shall run with the land, shall be filed with the permitting jgency, and shall include both of the following:
(1) A prohibition on the sale of the junior accessory dwelling unit separate from the sale of the single-family residence, including a statement that the deed restriction may be enforced against future purchasers. (2) A restriction on the size and attributes of the junior accessory dwelling unit that conforms with this article. (d) Require a permitted junior accessory dwelling unit to be constructed within the walls of the proposed or existing single-family residence. For purposes of this subdivision, enclosed uses within the residence, such as attached garages, are considered a part of the proposed or existing single-family residence. (e) (1) Require a permitted junior accessory dwelling unit to include a separate entrance from the main entrance to the proposed or existing single-family residence.
(2) If a permitted junior accessory dwelling unit does not include a separate bathroom, the permitted junior accessory dwelling unit shall include a separate entrance from the main entrance to the structure, with an interior entry to the main living area.
(f) Require the permitted junior accessory dwelling unit to include an efficiency kitchen, which shall include all of the following:
(1) A cooking facility with appliances.
(2) A food preparation counter and storage cabinets that are of reasonable size in relation to the size of the junior accessory dwelling unit.
(Added by Stats. 2024, Ch. 7, See. 20. (SB 477) Effective March 25 2024.) m (a) A junior accessory dwelling unit ordinance adopted pursuant to Section 66333 shall not require additional parking as a condition to grant a permit.
(b) This article shall not be interpreted to prohibit the requirement of an inspection, including the imposition of a fee for that inspection, to determine if the junior accessory dwelling unit complies with applicable building -55-
standards.
(Added by Slaw. 2024, Ch. 7, Sec. 20. (SB 477) Efi'ectlve March 25, 2024.) 553-3-5- (a) (1) An application for a permit pursuant to this article shall, notwithstanding Section 65901 or 65906 or any local ordinance regulating the issuance of variances or special use permits, be considered ministerially, without discretionary review or a hearing.
(2) The permitting agency shall either approve or deny the applintion to create or serve a junior accessory dwelling unit within 60 days from the date the local agency receives a completed application if there is an existing single-family dwelling on the lot.
(3) If the permit application to create or serve a junior accessory dwelling unit is submitted with a permit application to create or serve a new single-family dwelling on the lot, the permitting agency may delay approving or denying the permit application for the junior accessory dwelling unit until the permitting agency approves or denies the permit application to create or serve the new single-family dwelling, but the application to create or serve the junior accessory dwelling unit shall still be considered mlnisterially without discretionary review or a hearing.
(4) If the applicant requests a delay, the 60-day time period shall be toiled for the period of the delay. (b) If a permitting agency denies an application for a junior accessory dwelling unit pursuant to subdivision (a), the permitting agency shall, within the time period described in subdivision (a), return in writing a full set of comments to the applicant with a list of items that are defective or deficient and a description of how the application can be remedied by the applicant.
(c) A local agency may charge a fee to reimburse the local agency for costs incurred in connection with the issuance of a permit pursuant to this article.
(Added by Stats. 2024, 01. 7, Sec. 20. (SB 477) Efi'eca’ve March 25, 2024.) m A local agency shall not deny an application for a permit to create a junior accessory dwelling unit pursuant to this article clue to the correction of nonconforming zoning conditions, building code violations, or unpermltted structures that do not present a threat to public health and safety and that are not affected by the construction of the junior accessory dwelling unit.
(Added by SEtS. 2024, Ch. 7, Sec. 20. (SB 477) EMVE March 25, 2024.) 5531‘ (a) For purposes of any fire or life protection ordinance or regulation, a junior accessory dwelling unit shall not be considered a separate or new dwelling unit.
(b) This article shall not be construed to prohibit a city, county, city and county, or other local public entity from adopting an ordinance or regulation relating to fire and life protection requirements within a single-family residence that contains a junior accessory dwelling unit so long as the ordinance or regulation applies uniformly to all single- family residences within the zone regardless of whether the single-family residence includes a junior accessory dwelling unit or not.
(Added by Stats. 2024, Ch. 7, Sec. 20. (SB 477) Efi'ective March 25, 2024.) 5533-3: (a) For purposes of providing service for water, sewer, or power, including a connection fee, a junior accessory dwelling unit shall not be considered a separate or new dwelling unit. (b) This section shall not be construed to prohibit a local agency from adopting an ordinance or regulation related to a service or a connection fee for water, sewer, or power, that applies to a single-family residence that contains a junior accessory dwelling unit, so long as that ordinance or regulation applies uniformly to all single-family residences regardless of whether the single-family residence includes a junior accessory dwelling unit. (Added by Stats. 2024, Ch. 7, Sec. 20. (SB 477) Efi'ect‘lve MarCh 25, 2024.) m If a local agency has not adopted a local ordinance pursuant to this article, the local agency shall ministerially approve a permit to construct a junior accessory dwelling unit that satisfies the requirements set forth in paragraph ( 1) of subdivision (a) of Section 66323 and the requirements of this article. (Added by Stats. 2024, Ch. 7, Sec. 20. (SB 477) Effective March 25, 20.24.) -57-
ms
LEGISLATIVE INFORMATION
California Law : Publications Other Resources My Subscriptions , MyFavorites Code:_ Section: Manon" CD
um mm
GOVERNMENT CODE - GOV
TITLE 7. FIANNING AND LAND USE [85000 - 66499.58] ( Heading of Title 7 amended by Stats. 1974, Ch. 1536. ) DIVISION 1. PLANNING AND ZONING [65000 - 66342] (Heading of Division 1 added by Stats. 1974, Ch. 1536. ) CHAPTER 13. Accessory Dwelling Unlb [66310 - 66342] ( Chapter 13 added by Stats. 2024, Ch. 7, Sec. 20. ) AR‘flCLE 4 Accessory Dwelling Unit Sales [66340 . 66342] ( Article 4 added by Stats. 2024, Ch. 7, Sec. 20. )
3.359.: For purposes of this article:
(a) “Qualified buyer” means persons and families of low or moderate income, as that term is defined in Section 50093 of the Health and Safety Code.
(b) ‘Quallfied nonprofit corporation" means a nonprofit corporation organized pursuant to Section 501(c)(3) of the Internal Revenue Code that has received a welfare exemption under Section 214.15 of the Revenue and Taxation Code for properties intended to be sold to low-income families who participate in a special no-lnterest loan program.
(Added by Stats. 2024, Ch. 7, Sec. 20. (SB 477) Effective March 25, 2024.) $5351- A local agency shall allow an accessory dwelling unit to be sold or conveyed separately from the primary residence to a qualified buyer if all of the following apply:
(a) The accessory dwelling unit or the primary dwelling was built or developed by a qualified nonprofit corporation. (b) There is an enforceable restriction on the use of the land pursuant to a recorded contact between the qualified buyer and the qualified nonprofit corporation that satisfies all of the requirements specified in paragraph (10) of subdivision (a) of Section 402.1 of the Revenue and Taxation Code. (c) The property is held pursuant to a recorded tenancy in common agreement that includes all of the following:
( 1) The agreement allocates to each qualified buyer an undivided, unequal interest in the property based en the size of the dwelling that each qualified buyer occupies. (2) A repurchase option that requires the qualified buyer to first offer the qualified nonprofit corporation to buy the accessory dwelling unit or primary dwelling if the buyer desires to sell or convey the property. (3) A requirement that the qualified buyer occupy the accessory dwelling unit or primary dwelling as the buyer's principal residence.
(4) Affordability restrictions on the sale and conveyance of the accessory dwelling unit or primary dwelling that ensure the accessory dwelling unit and primary dwelling will be preserved for low—income housing for 45 years for owner-occupied housing units and will be sold or resold to a qualified buyer. (5) If the tenancy in common agreement is recorded after December 31, 2021, it shall also include all of the following:
(A) Delineation of all areas of the property that are for the exclusive use of a cotenant. Each cotenant shall agree not to claim a right of occupancy to an area delineated for the exclusive use of another cotenant, provided that the latter cotenant’s obligations to each of the other cotenants have been satisfied. (B) Delineation of each cotenant’s responsibility for the costs of taxes, insurance, utilities, general maintenance and repair, improvements, and any other costs, obligations, or liabilities associated with the -58-
property. This delineation shall only be binding on the parties to the agreement, and shall not supersede or obviate the liability, whether joint and several or otherwise, of the parties for any cost, obligation, or liability associated with the property where such liability is otherwise established by law or by agreement with a third party.
(C) Procedures for dispute resolution among the parties before resorting to legal action. (d) A grant deed naming the grantor, grantee, and describing the property interests being transferred shall be recorded in the county in which the property is located. A Preliminary Change of Ownership Report shall be filed concurrently with this grant deed pursuant to Section 480.3 of the Revenue and Taxation Code. (e) Notwithstanding Section 66324, if requested by a utility providing service to the primary residence, the accessory dwelling unit has a separate water, sewer, or electrical connection to that utility. (f) Nothing in this section limits the ability of an accessory dwelling unit to be sold or otherwise conveyed separate from the primary residence as a condominium pursuant to an ordinance adopted under Section 66342. (Added by Stats. 2024, Ch. 7, Sec. 20. (SB 477) Efi‘ectlve March 25, 2024.) m In addition to the requirement that a local agency allow the separate sale or conveyance of an accessory dwelling unit pursuant to Section 66341, a local agency may also adopt a local ordinance to allow the separate conveyance of the primary dwelling unit and accessory dwelling unit or units as condominiums. Any such ordinance shall include all of the following requirements:
(a) The condominiums shall be created pursuant to the Davis-Stirling Common Interest Development Act (Part 5 (commencing with Section 4000) of Division 4 of the Civil Code). (b) The condominiums shall be created in conformance with all applicable objective requirements of the Subdivision Map Act (Division 2 (commencing with Section 66410)) and all objective requirements of a local subdivision ordinance.
(c) Before recordation of the condominium plan, a safety inspection of the accessory dwelling unit shall be conducted as evidenced either through a certificate of occupancy from the local agency or a housing quality standards report from a building inspector certified by the United States Department of Housing and Urban Development.
(d) (1) Neither a subdivision map nor a condominium plan shall be recorded with the county recorder in the county where the real property is located without each lienholder’s consent. The following shall apply to the consent of a lienholder:
(A) A lienholder may refuse to give consent.
(B) A lienholder may consent provided that any terms and conditions required by the lienholder are satisfied. (2) Prior to recordation of the initial or any subsequent modifications to the condominium plan, written evidence of the iienholder’s consent shall be provided to the county recorder along with a signed statement from each lienholder that states as follows:
“(Name of lienholder) hereby consents to the recording of this condominium plan in their sole and absolute discretion and the borrower has or will satisfy any additional terms and conditions the lienholder may have." (3) The lienholder’s consent shall be included on the condominium plan or a separate form attached to the condominium plan that includes the following information:
(A) The lienholder's signature.
(B) The name of the record owner or ground lessee.
(C) The legal description of the real property.
(D) The identities of all parties with an interest in the real property as reflected in the real property records. (E) The lienholder's consent shall be recorded in the office of the county recorder of the county in which the real property is located.
-59-
(e) The local agency shall include the following notice to consumers on any accessory dwelling or junior accessory dwelling unit submittal checklist or public information Issued describing requirements and permitting for accessory dwelling units, including as standard condition of any accessory dwelling unit building permit or condominium plan approval:
“NOTICE: If you are considering establishing your primary dwelling unit and accessory dwelling unit as a condominium, please ensure that your building permitting agency allows this practice. If you decide to establish your primary dwelling unit and accessory dwelling unit as a condominium, your condominium plan or any future modifications to the condominium plan must be recorded with the County Recorder. Prior to recordation or modification of your subdivision map and condominium plan, any lienhoider with a lien on your title must provide a form of written consent either on the condominium plan, or on the lienholder's consent form attached to the condominium plan, with text that clearly states that the lender approves recordation of the condominium plan and that you have satisfied their terms and conditions, if any.
In order to secure lender consent, you may be required to follow additional lender requirements, which may include, but are not limited to, one or more of the following:
(a) Paying off your current lender.
You may pay off your mortgage and any liens through a refinance or a new loan. Be aware that refinancing or using a new loan may result in changes to your interest rate or tax basis. Also, be aware that any subsequent modification to your subdivision map or condominium plan must also be consented to by your lender, which consent may be denied.
(b) Securing your lender’s approval of a modification to their loan collateral due to the change of your current property legal description into one or more condominium parcels. (c) Securing your lender’s consent to the details of any construction loan or ground lease.
This may include a copy of the improvement contract entered in good faith with a licensed contractor, evidence that the record owner or ground lessee has the funds to complete the work, and a signed statement made by the record owner or ground lessor that the information in the consent above is true and correct." (1‘) If an accessory dwelling unit is established as a condominium, the local government shall require the homeowner to notify providers of utilities, including water, sewer, gas, and electricity, of the condominium creation and separate conveyance.
(9) (1) The owner of a property or a separate interest within an existing planned development that has an existing association, as defined in Section 4080 of the Civil Code, shall not record a condominium plan to create a common interest development under Section 4100 of the Civil Code without the express written authorization by the existing association.
(2) For purposes of this subdivision, written authorization by the existing association means approval by the board at a duly noticed board meeting, as defined in Section 4090 of the Civil Code, and if needed pursuant to the existing association’s governing documents, membership approval oi’ the existing association. (h) An accessory dwelling unit shall be sold or otherwise conveyed separate from the primary residence only under the conditions outlined in this paragraph or pursuant to this article. (Added by Stats. 2024, Ch. 7, Sec. 20. (55 477) Effective March 25, 2024.) _ -60-
15-A
TO: Honorable Mayor and Members of the City Council
ATTENTION: Ryan Smoot, City Manager
FROM: Tae Rhee, Finance Director/City Treasurer
SUBJECT: Consideration and possible action to receive and file Warrant Register No. 25-111, dated May 12, 2025.
DATE: May 12, 2025
EXECUTIVE SUMMARY
Section X.B of the Budget, Financial and Administrative Policies stipulates the City’s process in executing warrants for the payment of goods and services, as well as the requirement to make each warrant register a matter of public record by placing it on the City Council Agenda as a Consent Calendar item.
RECOMMENDATION
1) Receive and file Warrant Register No. 25-111; or
2) Alternatively, discuss and take other action related to this item.
FISCAL IMPACT
$2,412,704.59 in expenditures.
ATTACHMENT
Warrant Register No. 25-111 .......................................................................................... 2
0F BELLFL {Cl OWGQ «It Stafteport
0 v- ROWING T001819?”
Fund No.CITY OF BELLFLOWER:
010 General Fund 1,965,066.45$
011 General Fund Projects 5,970.94
030 Grant Projects Fund 0.10
037 Drug Education/Rehabilitation Fund 6,960.00
050 Supplemental Law Enforcement Services Fund (State) 39,985.01 090 Agency Fund/Refundable Deposits - Private Projects 24,000.00 100 Proposition A Fund - Transportation 3,945.09
135 Proposition C Fund - Transportation / Streets 48,871.20 140 State Gas Tax Fund - Streets 23,748.10
320 Measure W Fund - Water 2,887.23
510 Economic Development Fund 520.00
530 IT/Equipment Replacement Fund 3,222.07
900 Community Development Block Grant Fund 2,909.77
944 Parking District No. 1 Fund 257.31
Total Accounts Payable 2,128,343.27
Payroll Check/ACH Payments (Pay Period Ending 05/12/25) 284,361.32
Total Expenditures - City 2,412,704.59$
WARRANT REGISTER FUND SUMMARY
CITY OF BELLFLOWER
(Warrant Register No. 25-111 Dated May 12, 2025)
https://bellflowergcc.sharepoint.com/sites/fin/Shared Documents/Warrant Registers/Warrant Register Cover Page Template
REPORT.: 05/05/25 City of Bellflower PAGE: 001 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: /R055 (RICHARD M RAMIREZ)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250415 XXXXXX 04/24/25 100.00 010 20710 XXX WDC POLICY BOARD COMMITTEE STIPEND 4/15/25 ------------
Vendor's Total = 100.00
------------
....................................................................................................................................
VENDOR.: 20434 (20434 SOUTH SANTA FE AVENUE, LLC)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250418 XXXXXX 05/01/25 182975.16 010 43410 8010 TSS 06/24-05/25 RENT/8833 CEDAR ST/TEMPORARY SHELTER ------------
Vendor's Total = 182975.16
------------
....................................................................................................................................
VENDOR.: AIR04 (AIRGAS USA, LLC)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 159393160 XXXXXX 04/24/25 128.84 010 43100 3100 PUBLIC WORKS SUPPLIES ------------
Vendor's Total = 128.84
------------
....................................................................................................................................
VENDOR.: AKE01 (AKESO OCCUPATIONAL HEALTH)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- EM012990 XXXXXX 04/24/25 240.00 010 43092 1350 NEW HIRE PHYSICALS (QTY 4) 110.00 010 42012 1350 TB & HEARING TESTS (QTY 6) EM014192 XXXXXX 04/24/25 300.00 010 43092 1350 NEW HIRE PHYSICALS (QTY 5) 130.00 010 42012 1350 TB & HEARING TEST (QTY 7) ------------
Vendor's Total = 780.00
------------
REPORT.: 05/05/25 City of Bellflower PAGE: 002 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: ALL12 (ALL CITY MANAGEMENT SERVICES INC.)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 100423 XXXXXX 05/01/25 12481.37 010 42054 2050 3/30/25-4/12/25 SCHOOL CROSS'G GUARD SVC/AFN 245.1 ------------
Vendor's Total = 12481.37
------------
....................................................................................................................................
VENDOR.: AME44 (AMERICAN RED CROSS)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 22768664 XXXXXX 04/24/25 800.00 010 43020 8000 STAFF CPR & FIRST AID CERTIFICATIONS (QTY 20) 22770099 XXXXXX 04/24/25 160.00 010 43020 8000 STAFF CPR & FIRST AID CERTIFICATIONS (QTY 4) ------------
Vendor's Total = 960.00
------------
....................................................................................................................................
VENDOR.: ATL03 (ATLAS BACKFLOW)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 46241 XXXXXX 04/24/25 764.55 010 46300 3100 BACKFLOW TESTING (QTY 12)
84.95 010 46011 3900 BACKFLOW TESTING (QTY 12) 169.90 010 46027 3900 BACKFLOW TESTING (QTY 12) 46242 XXXXXX 04/24/25 100.00 010 46000 3900 BACKFLOW CERTIFICATION (QTY 1) ------------
Vendor's Total = 1119.40
------------
....................................................................................................................................
VENDOR.: BEA04 (BEAR COMMUNICATIONS, INC)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 5861032 XXXXXX 04/24/25 958.56 010 43300 3100 03/25 RADIO SYSTEM MAINTENANCE/AFN 719.1 5874801 XXXXXX 04/24/25 958.56 010 43300 3100 04/25 RADIO SYSTEM MAINTENANCE/AFN 719.1 ------------
Vendor's Total = 1917.12
------------
REPORT.: 05/05/25 City of Bellflower PAGE: 003 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: BEL02 (BELLFLOWER-SOMERSET MUTUAL WATER COMPANY)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250326 XXXXXX 04/24/25 6729.13 010 43212 3100 01/14/25-03/17/25 WATER 2932.70 010 43212 3900 01/14/25-03/17/25 WATER B250326A XXXXXX 04/24/25 21.05 010 43212 3100 02/18/25-03/19/25 RECLAIMED WATER 816.88 010 43212 3900 02/18/25-03/19/25 RECLAIMED WATER ------------
Vendor's Total = 10499.76
------------
....................................................................................................................................
VENDOR.: BEL03 (BELLFLOWER CHAMBER OF COMMERCE)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 2343 XXXXXX 05/01/25 520.00 510 44410 4002 BLFR.NEW BUSINESS WELCOME PROG/CHAP.6 (QTY 3) ------------
Vendor's Total = 520.00
------------
....................................................................................................................................
VENDOR.: BEL50 (BELLFLOWER UNIFIED SCHOOL DISTRICT)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 10973 XXXXXX 04/24/25 250.00 010 20500 REFUND DEPOSIT/P&R/R#10973 ------------
Vendor's Total = 250.00
------------
....................................................................................................................................
VENDOR.: BIN01 (BRADLEY BINDER)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250410 XXXXXX 04/24/25 285.64 010 43110 3100 REIMBURSEMENT WORK BOOTS ------------
Vendor's Total = 285.64
------------
REPORT.: 05/05/25 City of Bellflower PAGE: 004 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: BIR02 (CHRISTINA JOY PADILLA BIRKEY)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250407 XXXXXX 04/24/25 150.00 010 41000 1030 04/07/25 PLANNING COMMISSION STIPEND ------------
Vendor's Total = 150.00
------------
....................................................................................................................................
VENDOR.: BLU01 (BLUE DIAMOND MATERIALS)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 4014088 XXXXXX 04/24/25 360.80 010 43160 3100 ASPHALT 4014154 XXXXXX 04/24/25 603.19 010 43160 3100 ASPHALT 4014182 XXXXXX 04/24/25 119.90 010 43160 3100 ASPHALT 4020585 XXXXXX 04/24/25 122.10 010 43160 3100 ASPHALT 4020615 XXXXXX 04/24/25 123.20 010 43160 3100 ASPHALT 4020642 XXXXXX 04/24/25 173.80 010 43160 3100 ASPHALT 4020677 XXXXXX 04/24/25 223.33 010 43160 3100 ASPHALT 4026703 XXXXXX 05/01/25 598.14 010 43160 3100 ASPHALT 4026735 XXXXXX 05/01/25 436.66 010 43160 3100 ASPHALT 4026766 XXXXXX 05/01/25 491.20 010 43160 3100 ASPHALT ------------
Vendor's Total = 3252.32
------------
....................................................................................................................................
VENDOR.: BUR01 (BURKE,WILLIAMS & SORENSEN, LLP)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 340470 XXXXXX 05/01/25 2332.60 010 42032 8010 TSS 03/25 LEGAL SERVICES/20434 S.SANTA FE AVE,LLC ------------
Vendor's Total = 2332.60
------------
....................................................................................................................................
VENDOR.: BUT03 (BUTLER CHEMICALS, INC.)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 14719661 XXXXXX 04/24/25 125.02 010 46030 3900 WATER SOFTENER ------------
Vendor's Total = 125.02
------------
REPORT.: 05/05/25 City of Bellflower PAGE: 005 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: CAL17 (CAL-CITY CONSTRUCTION, INC.)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 1A XXXXXX 05/01/25 0.05 030 47604 9000 116 TEST ACH/3/25 BLFR.YTH,SENIOR CTR/SPEC#23/24-07 ------------
Vendor's Total = 0.05
------------
....................................................................................................................................
VENDOR.: CAL58 (CA. ASSOC OF CODE ENFORCEMENT OFFICERS)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 200033854 XXXXXX 04/24/25 55.90 010 43020 4105 04/16/25 CACEO WEBINAR/RESPONSIBLE LEADER
9.10 900 43020 4152 04/16/25 CACEO WEBINAR/RESPONSIBLE LEADER 200033855 XXXXXX 04/24/25 51.60 010 43020 4105 05/22/25 CACEO WEBINAR/DE-ESCALATION
8.40 900 43020 4152 05/22/25 CACEO WEBINAR/DE-ESCALATION 200033856 XXXXXX 04/24/25 46.44 010 43020 4105 06/18/25 CACEO WEBINAR/LEADERSHIP
7.56 900 43020 4152 06/18/25 CACEO WEBINAR/LEADERSHIP 200033857 XXXXXX 04/24/25 30.96 010 43020 4105 05/07/25 CACEO WEBINAR/SOCIAL MEDIA
5.04 900 43020 4152 05/07/25 CACEO WEBINAR/SOCIAL MEDIA 200033892 XXXXXX 04/24/25 30.96 010 43020 4105 05/07/25 CACEO WEBINAR/SOCIAL MEDIA
5.04 900 43020 4152 05/07/25 CACEO WEBINAR/SOCIAL MEDIA 200033893 XXXXXX 04/24/25 51.60 010 43020 4105 05/22/25 CACEO WEBINAR/DE-ESCALATION
8.40 900 43020 4152 05/22/25 CACEO WEBINAR/DE-ESCALATION ------------
Vendor's Total = 311.00
------------
....................................................................................................................................
VENDOR.: CAL63 (CALIFORNIA LANDSCAPE & DESIGN, INC.)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 39182 XXXXXX 05/01/25 60850.00 010 42350 4105 4/25 FENCE INSTALL/NUISANCE ABATEMENT/17046 BLFR. -3042.50 010 20400 RETENTION FENCE INSTALL/NUISANCE ABATE/17046 BLFR. ------------
Vendor's Total = 57807.50
------------
....................................................................................................................................
VENDOR.: CAP11 (CAPITAL ONE PUBLIC FUNDING)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250414H XXXXXX 04/14/25 50869.74 700 48100 5500 2021 CAPITAL ONE LFA DEBT SVC.PMT/PRINCIPAL
REPORT.: 05/05/25 City of Bellflower PAGE: 006 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: CAP11 (CAPITAL ONE PUBLIC FUNDING) ..Continue..
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250414H XXXXXX 04/14/25 6755.27 700 48200 5500 2021 CAPITAL ONE LFA DEBT SVC.PMT/INTEREST -57625.01 700 39000 2021 CAPITAL ONE LFA DEBT SVC.PMT/PRIN.,INTEREST 57625.01 010 49000 9999 2021 CAPITAL ONE LFA DEBT SVC.PMT/PRIN.,INTEREST -50869.74 850 19010 2021 CAPITAL ONE LFA DEBT SVC.PMT/PRINCIPAL 50869.74 850 24212 2021 CAPITAL ONE LFA DEBT SVC.PMT/PRINCIPAL ------------
Vendor's Total = 57625.01
------------
....................................................................................................................................
VENDOR.: COR02 (CORONA CLAY COMPANY, INC.)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 16626 XXXXXX 04/24/25 1707.75 010 46012 3900 ANGEL MIX ------------
Vendor's Total = 1707.75
------------
....................................................................................................................................
VENDOR.: COR15 (CORODATA MEDIA STORAGE INC.)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- DS1311509 XXXXXX 04/24/25 145.75 010 43620 1200 03/25 MEDIA RECORDS STORAGE/AFN 1043 ------------
Vendor's Total = 145.75
------------
....................................................................................................................................
VENDOR.: COR16 (CORODATA RECORDS MANAGEMENT INC.)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- RS7080243 XXXXXX 04/24/25 311.00 010 43620 1200 03/25 RECORDS MANAGEMENT ------------
Vendor's Total = 311.00
------------
REPORT.: 05/05/25 City of Bellflower PAGE: 007 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: CRA05 (MICHELE L. CRAVENS-WORLEY)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250409 XXXXXX 04/24/25 100.00 010 41000 1020 04/09/25 P&R COMMISSION STIPEND ------------
Vendor's Total = 100.00
------------
....................................................................................................................................
VENDOR.: CRA06 (CRAFTWATER ENGINEERING, INC.)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 2009036 XXXXXX 05/01/25 1044.00 320 47013 9000 106 3/25 DEV.SIMMS PARK STORMWATER CAPTURE PROJ.DESIGN ------------
Vendor's Total = 1044.00
------------
....................................................................................................................................
VENDOR.: CRU02 (CLAUDIA CRUZ)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250415 XXXXXX 04/24/25 70.00 010 42005 1350 REIMBURSE WELLNESS PROGRAM/RUNNING SHOES ------------
Vendor's Total = 70.00
------------
....................................................................................................................................
VENDOR.: DEP05 (DEPARTMENT OF TRANSPORTATION)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- SL250630 XXXXXX 05/01/25 2555.05 010 42322 3100 10/24-12/24 TRAFFIC SIGNAL MAINTENANCE ------------
Vendor's Total = 2555.05
------------
....................................................................................................................................
VENDOR.: DEP16 (DEPARTMENT OF JUSTICE)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 807770 XXXXXX 04/24/25 256.00 010 43440 8000 03/25 LIVESCAN FINGERPRINTS ------------
Vendor's Total = 256.00
------------
REPORT.: 05/05/25 City of Bellflower PAGE: 008 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: EMP01 (EMPLOYMENT DEVELOPMENT DEPARTMENT)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 984041424H XXXXXX 04/16/25 531.00 010 43519 8000 01/25-03/25 UNEMPLOYMENT CLAIMS/ACCT.#944-0709-05 ------------
Vendor's Total = 531.00
------------
....................................................................................................................................
VENDOR.: EMP05 (EMPLOYMENT DEVELOPMENT DEPARTMENT)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 8372002H XXXXXX 04/15/25 21.54 010 23080 PIT - FINAL 8378708H XXXXXX 04/24/25 14219.16 010 23080 PIT - PPE 4/18/25 PD 4/24/25 ------------
Vendor's Total = 14240.70
------------
....................................................................................................................................
VENDOR.: FAI01 (FAIR HOUSING FOUNDATION)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250305 XXXXXX 05/01/25 1514.06 900 44530 4155 02/25 CDBG PUBLIC SERVICE GRANT/AFN 38.10 B250408 XXXXXX 05/01/25 1264.69 900 44530 4155 03/25 CDBG PUBLIC SERVICE GRANT/AFN 38.10 ------------
Vendor's Total = 2778.75
------------
....................................................................................................................................
VENDOR.: FOR08 (FOREMAN PRODUCTS, LLC)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 58R1INVR1 XXXXXX 05/01/25 3184.06 530 18400 PHENOLIC LOCKERS/6 TOWERS/D.5013/TAG#20250408 ------------
Vendor's Total = 3184.06
------------
....................................................................................................................................
VENDOR.: FRO07 (FRONTIER COMMUNICATIONS)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250412 XXXXXX 05/01/25 492.46 100 43300 3560 04/25 TELEPHONE,INTERNET/PRKG.STR/16337 BLFR. ------------
Vendor's Total = 492.46
------------
REPORT.: 05/05/25 City of Bellflower PAGE: 009 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: GAL00 (GALLAGHER BENEFIT SERVICES, INC.)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 025042468 XXXXXX 04/24/25 14770.00 010 42054 1350 2025 TOTAL COMPENSATION STUDY/PMT#3 ------------
Vendor's Total = 14770.00
------------
....................................................................................................................................
VENDOR.: GAR06 (ANDREA B. CALIP TRUST)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250424 XXXXXX 05/01/25 5300.00 010 43410 2000 05/25 RENT/SUBSTATION -1272.00 010 20230 05/25 RENT/SUBSTATION LESS 24% FIT -371.00 010 20230 05/25 RENT/SUBSTATION LESS 7% STATE TAX ------------
Vendor's Total = 3657.00
------------
....................................................................................................................................
VENDOR.: GAT10 (GATEWAY WATER MANAGEMENT AUTHORITY)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- HTU2308 XXXXXX 05/01/25 811.77 320 41200 6020 FY23/24 HARBOR TOXIC POLLUTANT TMDL MONITOR'G PLAN HTU2408 XXXXXX 05/01/25 815.28 320 41200 6020 FY24/25 HARBOR TOXIC POLLUTANT TMDL MONITOR'G PLAN ------------
Vendor's Total = 1627.05
------------
....................................................................................................................................
VENDOR.: GER01 (DANDY GERZON DE PAULA)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250415 XXXXXX 04/24/25 100.00 010 20710 XXX WDC POLICY BOARD COMMITTEE STIPEND 4/15/25 ------------
Vendor's Total = 100.00
------------
REPORT.: 05/05/25 City of Bellflower PAGE: 010 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: GLA01 (GLASBY MAINTENANCE SUPPLY)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 350493A XXXXXX 05/01/25 222.45 010 46010 3900 CLEANING SUPPLIES
24.72 010 46020 3900 CLEANING SUPPLIES
------------
Vendor's Total = 247.17
------------
....................................................................................................................................
VENDOR.: GOG01 (GO GREEN INTERIOR PLANTS)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 49764 XXXXXX 04/24/25 150.00 010 46000 8000 04/25 INTERIOR PLANT SERVICE/AFN 463 ------------
Vendor's Total = 150.00
------------
....................................................................................................................................
VENDOR.: GRA06 (GRAINGER, INC.)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 444774393 XXXXXX 04/24/25 196.58 010 46029 3900 PUBLIC WORKS SUPPLIES ------------
Vendor's Total = 196.58
------------
....................................................................................................................................
VENDOR.: H&H02 (H & H NURSERY, INC.)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 17121 XXXXXX 04/24/25 137.78 010 46011 3900 REPLACEMENT PLANTS (QTY 15) ------------
Vendor's Total = 137.78
------------
....................................................................................................................................
VENDOR.: HAA01 (MITCHEL L. HAACK)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250409 XXXXXX 04/24/25 100.00 010 41000 1020 04/09/25 P&R COMMISSION STIPEND ------------
Vendor's Total = 100.00
------------
REPORT.: 05/05/25 City of Bellflower PAGE: 011 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: HAS03 (HASA INC)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 132694C XXXXXX 04/28/25 -717.77 010 43100 3900 CREDIT: POOL CHEMICALS 1020428 XXXXXX 04/28/25 1412.06 010 43100 3900 POOL CHEMICALS 1024160 XXXXXX 04/28/25 1097.11 010 43100 3900 POOL CHEMICALS 1025235 XXXXXX 04/28/25 962.02 010 43100 3900 POOL CHEMICALS ------------
Vendor's Total = 2753.42
------------
....................................................................................................................................
VENDOR.: HER18 (MARCUS HERNANDEZ)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250414 XXXXXX 04/24/25 254.13 010 43110 3900 REIMBURSEMENT WORKBOOTS ------------
Vendor's Total = 254.13
------------
....................................................................................................................................
VENDOR.: HUM03 (COOPERATIVE PERSONNEL SERVICES)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Description Ctr
---------- ------ -------- ------------ -------------- --- -------------------------------------------------- INV005917 XXXXXX 05/01/25 2772.50 010 43092 1350 BILINGUAL WRITTEN,ORAL EXAMS/3/26/25 (QTY 16) ------------
Vendor's Total = 2772.50
------------
....................................................................................................................................
VENDOR.: INK01 (INK HEAD PRINTS, LLC)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 13095 XXXXXX 04/24/25 2118.45 010 43110 5000 STAFF UNIFORMS/SWEATSHIRTS,POLOS (QTY 49) ------------
Vendor's Total = 2118.45
------------
REPORT.: 05/05/25 City of Bellflower PAGE: 012 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: INT24 (INTEGRATED DEMOLITION AND)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 2025012AD XXXXXX 05/01/25 119000.00 010 42350 4105 3/25-4/25 ABATEMENT DEMOLITION/17046 BELLFLOWER BL -5950.00 010 20400 RETENTION:ABATEMENT DEMOLITION/17046 BELLFLOWER BL ------------
Vendor's Total = 113050.00
------------
....................................................................................................................................
VENDOR.: IRS02 (INTERNAL REVENUE SERVICE)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 90413327H XXXXXX 04/15/25 40.46 010 23020 941: EMPLYRS QRTRLY OASDI - ACCURAL
9.46 010 23170 941: EMPLYRS QRTRLY MEDICARE - ACCURAL
71.80 010 23070 941: EMPLYRS QRTRLY FED TAX - ACCURAL 22259486H XXXXXX 04/24/25 53242.96 010 23020 941: EMPLYRS QRTRLY OASDI-PPE 4/18/25 PD 4/24/25 12567.88 010 23170 941: EMPLYRS QRTRLY MEDICARE-PPE 4/18/25 PD 4/24/25 37878.24 010 23070 941: EMPLYRS QRTRLY FEDERAL-PPE 4/18/25 PD 4/24/25 ------------
Vendor's Total = 103810.80
------------
....................................................................................................................................
VENDOR.: JDL01 (JDL PACKAGING SYSTEMS, INC)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- J71209 XXXXXX 05/01/25 629.85 010 43100 8000 COPY PAPER (QTY 15) 251.94 010 43100 3100 COPY PAPER (QTY 6)
419.90 010 43100 2000 COPY PAPER (QTY 10) ------------
Vendor's Total = 1301.69
------------
....................................................................................................................................
VENDOR.: JJP00 (JJ PROPERTY MAINTENANCE NETWORK, INC.)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 122908 XXXXXX 04/24/25 2997.00 010 46000 8000 03/25 JANITORIAL SERVICES/AFN 1062
REPORT.: 05/05/25 City of Bellflower PAGE: 013 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: JJP00 (JJ PROPERTY MAINTENANCE NETWORK, INC.) ..Continue..
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 122908 XXXXXX 04/24/25 652.00 010 46000 3100 03/25 JANITORIAL SERVICES/AFN 1062 1269.00 010 46000 2000 03/25 JANITORIAL SERVICES/AFN 1062 924.00 010 46013 3900 03/25 JANITORIAL SERVICES/AFN 1062 114.58 010 46010 3900 03/25 JANITORIAL SERVICES/AFN 1062 1141.00 010 46030 3900 03/25 JANITORIAL SERVICES/AFN 1062 ------------
Vendor's Total = 7097.58
------------
....................................................................................................................................
VENDOR.: JOH08 (LYNDA JOHNSON)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250415 XXXXXX 04/24/25 100.00 010 20710 XXX WDC POLICY BOARD COMMITTEE STIPEND 4/15/25 ------------
Vendor's Total = 100.00
------------
....................................................................................................................................
VENDOR.: LOS01 (LOS ANGELES COUNTY SHERIFF'S DEPARTMENT)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 252330TZ XXXXXX 05/01/25 111795.00 010 42130 2200 02/25 SPECIAL ASSIGNMENT OFFICERS (X4) 92230.89 010 42153 2200 02/25 GENERAL LAW CARS (40-HOUR) (X3) 30743.63 010 42155 2200 02/25 TRAFFIC LAW CAR (40-HOUR) (X1) 456665.86 010 42152 2200 02/25 GENERAL LAW CARS (56-HOUR)X10.61 129123.24 010 42154 2200 02/25 TRAFFIC LAW CARS (56-HOUR) (X3) 43041.08 135 42117 3600 02/25 TRANSIT OFFICER (56-HR) TRAFFIC (X1) 25636.44 010 42150 2200 02/25 SPECIAL ASSIGNMENT SERGEANT (X1)* 38946.70 050 42165 2150 02/25 NO RELIEF GRANT CARS (40-HR) (X2) 1038.31 050 47300 2150 02/25 MDC DATA & MAINTENANCE ONLY (X7) -215.19 010 42164 2200 CREDIT: RESERVE DEPUTY RATE ADJ.INV#251225MR 252435TZ XXXXXX 05/01/25 3429.46 010 42182 2200 09/24 LASD HELICOPTER SUPPORT 252503TZ XXXXXX 05/01/25 6312.83 010 42182 2200 10/24 LASD HELICOPTER SUPPORT 252510TZ XXXXXX 05/01/25 15127.86 010 42164 2200 2/5-28/25 OT LAW ENFORCEMENT/CRIME SUPPRESSION 252511TZ XXXXXX 05/01/25 1464.90 010 42161 2200 02/7-19/25 OT LAW ENFORCEMENT/TRAFFIC ENFORCEMENT ------------
Vendor's Total = 955341.01
------------
REPORT.: 05/05/25 City of Bellflower PAGE: 014 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: LOS29 (LOS ANGELES COUNTY SAFER ESCROW ACCOUNT)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 252330TZ XXXXXX 05/01/25 13974.38 010 42130 2200 02/25 LIAB.INS/SPECIAL ASSIGNMENT OFFICERS (X4) 11528.86 010 42153 2200 02/25 LIAB.INS/GENERAL LAW CARS (40-HOUR) (X3) 3842.95 010 42155 2200 02/25 LIAB.INS/TRAFFIC LAW CAR (40-HOUR) (X1) 57083.23 010 42152 2200 02/25 LIAB.INS/GENERAL LAW CARS (56-HOUR)X10.61 16140.41 010 42154 2200 02/25 LIAB.INS/TRAFFIC LAW CARS (56-HOUR) (X3) 5380.14 135 42117 3600 02/25 LIAB.INS/TRANSIT OFFICER (56-HR) TRAFFIC(X1) 4868.33 010 42165 2200 02/25 LIAB.INS/NO RELIEF GRANT CARS (40-HR) (X2) 252435TZ XXXXXX 05/01/25 428.68 010 42182 2200 09/24 LIABILITY INSURANCE/LASD HELICOPTER SUPPORT 252503TZ XXXXXX 05/01/25 789.10 010 42182 2200 10/24 LIABILITY INSURANCE/LASD HELICOPTER SUPPORT 252510TZ XXXXXX 05/01/25 1794.50 010 42164 2200 02/5-28/25 LIAB.INS/OT LAW ENF/CRIME SUPPRESSION 252511TZ XXXXXX 05/01/25 183.11 010 42161 2200 02/7-19/25 LIAB.INS/OT LAW ENF/TRAFFIC ENFORCEMENT ------------
Vendor's Total = 116013.69
------------
....................................................................................................................................
VENDOR.: LOS49 (L.A. CO. REGISTRAR-RECORDER/COUNTY CLERK)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250423 XXXXXX 04/24/25 2968.75 010 43000 4100 CEQA FILING FEE/AMENDMENT CASE ZOTA 25-01 B250423A XXXXXX 04/24/25 75.00 010 43000 4100 FILING FEE/HOUSING ELEMENT IMP.PROJECT PHASE II ------------
Vendor's Total = 3043.75
------------
....................................................................................................................................
VENDOR.: MEN06 (WILLIAM J MENDES)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250407 XXXXXX 04/24/25 150.00 010 41000 1030 04/07/25 PLANNING COMMISSION STIPEND ------------
Vendor's Total = 150.00
------------
....................................................................................................................................
VENDOR.: MOS01 (MOSS, LEVY & HARTZHEIM, LLP)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 16996 XXXXXX 05/01/25 4600.00 010 42052 1300 FY23/24 SINGLE AUDIT REPORT ------------
Vendor's Total = 4600.00
------------
REPORT.: 05/05/25 City of Bellflower PAGE: 015 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: MOT05 (MARIAH MARIE MOTT)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250407 XXXXXX 04/24/25 150.00 010 41000 1030 04/07/25 PLANNING COMMISSION STIPEND ------------
Vendor's Total = 150.00
------------
....................................................................................................................................
VENDOR.: MSA02 (MUNICIPAL DENTAL POOL)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- A250411H XXXXXX 04/10/25 8017.94 010 23120 DENTAL INS - 4/25
55.78 010 43514 3900 DENTAL INS - 4/25
-274.60 010 43514 3100 DENTAL INS - 4/25
166.65 010 43514 3900 DENTAL INS - 4/25
------------
Vendor's Total = 7965.77
------------
....................................................................................................................................
VENDOR.: MUN15 (MUNISERVICES, LLC.)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- V06020636 XXXXXX 04/24/25 4746.38 010 42054 1300 01/25-03/25 UUT COMPLIANCE REVENUE PROGRAM ------------
Vendor's Total = 4746.38
------------
....................................................................................................................................
VENDOR.: NOR18 (NORWALK LA MIRADA PLUMBING HEATING)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 0690CHRIS XXXXXX 04/24/25 12212.85 010 46000 8000 REPAIR DRAIN PIPE/CITY HALL 1208SCOTT XXXXXX 04/24/25 3131.65 010 46013 3900 REPAIR TANKLESS WATER HEATER/AQUATIC CENTER 41712JOSH XXXXXX 04/24/25 210.00 010 46011 3900 REPAIR SINK DRAIN/THOMPSON PARK ------------
Vendor's Total = 15554.50
------------
REPORT.: 05/05/25 City of Bellflower PAGE: 016 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: PAR01 (LIBERTY UTILITIES/PARK WATER COMPANY)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250423H XXXXXX 04/23/25 3107.63 010 43212 3100 02/26/25-03/25/25 WATER 5947.12 010 43212 3900 02/26/25-03/25/25 WATER B250424H XXXXXX 04/24/25 5730.48 010 43212 3900 02/27/25-03/27/25 WATER ------------
Vendor's Total = 14785.23
------------
....................................................................................................................................
VENDOR.: PERS0 (PUBLIC EMPLOYEES' RETIREMENT SYSTEM)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- A250418H XXXXXX 04/24/25 59994.16 010 23040 PERS RETIREMENT - PPE 4/18/25 PD 4/24/25
0.02 010 43524 3900 ROUNDING ADJ - PPE 4/18/25 PD 4/24/25 ------------
Vendor's Total = 59994.18
------------
....................................................................................................................................
VENDOR.: PRE26 (PRETTY SMART)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- SAR005 XXXXXX 05/01/25 2850.94 011 47253 9000 102 03/25 SIMMS PARK ADAPTIVE REUSE/SCHEMATIC/TO#3 ------------
Vendor's Total = 2850.94
------------
....................................................................................................................................
VENDOR.: QUA07 (QUADIENT, INC.)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250418H XXXXXX 04/18/25 3000.00 010 43400 8000 PREPAID POSTAGE ------------
Vendor's Total = 3000.00
------------
REPORT.: 05/05/25 City of Bellflower PAGE: 017 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: RES03 (RESOURCE BUILDING MATERIALS,INC.)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 3975872 XXXXXX 04/24/25 398.75 010 46029 3900 PUBLIC WORKS SUPPLIES ------------
Vendor's Total = 398.75
------------
....................................................................................................................................
VENDOR.: REY05 (ALEJANDRO REYES)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250417 XXXXXX 05/01/25 70.00 010 42005 1350 REIMBURSE WELLNESS PROGRAM/GYM ------------
Vendor's Total = 70.00
------------
....................................................................................................................................
VENDOR.: ROD00 (CENIT RODRIGUEZ - PETTY CASH CUSTODIAN)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 27354H XXXXXX 04/22/25 65.88 010 43020 8000 SUPPLIES/04/07/25 DRIVERS TRAINING CLASS
30.59 010 43092 1350 SUPPLIES/ORAL INTERVIEW PANEL
39.74 010 43092 1350 SUPPLIES/INTERVIEW PANELISTS
60.00 010 43100 1350 DRY CLEANING/TABLECLOTH
12.48 010 43020 8000 SUPPLIES/04/14/25 DRIVERS TRAINING CLASS ------------
Vendor's Total = 208.69
------------
....................................................................................................................................
VENDOR.: ROM02 (MARGARET ROMERO)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250409 XXXXXX 04/24/25 100.00 010 41000 1020 04/09/25 P&R COMMISSION STIPEND ------------
Vendor's Total = 100.00
------------
REPORT.: 05/05/25 City of Bellflower PAGE: 018 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: SAN36 (SONNY R. SANTA INES)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250415 XXXXXX 04/28/25 100.00 010 20710 XXX WDC POLICY BOARD COMMITTEE STIPEND 4/15/25 ------------
Vendor's Total = 100.00
------------
....................................................................................................................................
VENDOR.: SCS02 (S.C. SIGNS & SUPPLIES LLC)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 257792 XXXXXX 04/24/25 1768.00 010 43180 3100 REPLACEMENT SIGNS (QTY 25) 257793 XXXXXX 04/24/25 224.20 010 43180 3100 REPLACEMENT SIGN POST (QTY 1) 257794 XXXXXX 04/24/25 203.32 010 43170 3100 PUBLIC WORKS SUPPLIES 254438A XXXXXX 04/24/25 6960.00 037 43036 2510 MESSAGE BOARDS RENTAL/11/18/24-12/2/24/RPL.CHECK 257958 XXXXXX 05/01/25 104.98 010 43180 3100 PUBLIC WORKS SUPPLIES 257959 XXXXXX 05/01/25 2204.48 010 43100 3100 TRAFFIC CONES ------------
Vendor's Total = 11464.98
------------
....................................................................................................................................
VENDOR.: SIM06 (J R SIMPLOT COMPANY)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 205099863 XXXXXX 04/24/25 188.67 010 46010 3900 HERBICIDE ------------
Vendor's Total = 188.67
------------
....................................................................................................................................
VENDOR.: SMA01 (SMART AND FINAL)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 527333 XXXXXX 04/24/25 55.27 010 41100 1000 04/14/25 CITY COUNCIL MEETING EXPENSE 082400 XXXXXX 05/01/25 55.27 010 41100 1000 04/21/25 CITY COUNCIL MEETING EXPENSE ------------
Vendor's Total = 110.54
------------
REPORT.: 05/05/25 City of Bellflower PAGE: 019 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: SMA02 (SMART & FINAL)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 019411 XXXXXX 04/24/25 66.33 010 42534 5000 REFRESHMENTS/SPECIAL INTERESTS PROGRAM 219477 XXXXXX 04/24/25 52.46 010 43100 5012 ADAPTIVE RECREATION SUPPLIES ------------
Vendor's Total = 118.79
------------
....................................................................................................................................
VENDOR.: SOS02 (HECTOR SOSA)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250415 XXXXXX 04/24/25 100.00 010 20710 XXX WDC POLICY BOARD COMMITTEE STIPEND 4/15/25 ------------
Vendor's Total = 100.00
------------
....................................................................................................................................
VENDOR.: SOU01 (SOUTHERN CALIFORNIA EDISON)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250416H XXXXXX 04/16/25 49.06 010 43210 3100 03/25 ELECTRIC B250421H XXXXXX 04/21/25 24.13 010 43210 3100 03/25 ELECTRIC 430.60 010 43210 3900 03/25 ELECTRIC
5902.37 010 43210 8000 03/25 ELECTRIC
3452.63 100 43210 3560 03/25 ELECTRIC
2169.66 010 43210 8010 TSS 03/25 ELECTRIC
B250423H XXXXXX 04/23/25 1788.48 010 43210 2000 03/25 ELECTRIC 59918.34 010 43210 3100 03/25 ELECTRIC
257.31 944 43210 3410 03/25 ELECTRIC
178.17 320 43210 6022 03/25 ELECTRIC
250423ECFH XXXXXX 04/23/25 5019.50 010 43210 3900 ECF 03/25 ELECTRIC/THE MAYNE EVENTS CENTER ------------
Vendor's Total = 79190.25
------------
....................................................................................................................................
VENDOR.: SOU03 (THE GAS COMPANY)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250422H XXXXXX 04/22/25 4723.10 010 43211 3900 03/25 GAS
REPORT.: 05/05/25 City of Bellflower PAGE: 020 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: SOU03 (THE GAS COMPANY) ..Continue..
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250422H XXXXXX 04/22/25 607.50 010 43211 8000 03/25 GAS 250424ECFH XXXXXX 04/24/25 2745.19 010 43211 3900 ECF 03/25 GAS/THE MAYNE EVENTS CENTER B250424H XXXXXX 04/25/25 680.28 010 43211 3900 03/25 GAS 104.62 010 43211 3900 03/25 GAS
B250425H XXXXXX 04/25/25 330.94 010 43211 8010 TSS 03/25 GAS ------------
Vendor's Total = 9191.63
------------
....................................................................................................................................
VENDOR.: STA15 (STATE OF CALIFORNIA)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250424 XXXXXX 05/01/25 371.00 010 20230 05/25 BACKUP WITHHOLDING/GAR06 ------------
Vendor's Total = 371.00
------------
....................................................................................................................................
VENDOR.: STA54 (STAR PRODUCTS LLC)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 2716 XXXXXX 04/24/25 994.59 010 43160 3100 ASPHALT RELEASE ------------
Vendor's Total = 994.59
------------
....................................................................................................................................
VENDOR.: STR01 (STREETLIGHT RESTORATION SPECIALISTS, INC)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 3020241BM XXXXXX 05/01/25 24998.00 140 47148 9000 131 10/24 ALONDRA/BELLFLOWER TRAF.SIG.RESTORATION -1249.90 140 20400 131 RETENTION: 10/24 ALONDRA/BLFR.TRAF.SIG.RESTORATION ------------
Vendor's Total = 23748.10
------------
REPORT.: 05/05/25 City of Bellflower PAGE: 021 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: TAY06 (TAYLOR'S LOCK & KEY)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 7338 XXXXXX 04/24/25 61.52 010 46000 3900 KEYS
7.00 010 46030 3900 KEYS
------------
Vendor's Total = 68.52
------------
....................................................................................................................................
VENDOR.: THE36 (THERMAL CONCEPTS, INC.)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Description Ctr
---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 9166 XXXXXX 04/24/25 6900.00 010 46000 8000 COMPRESSOR/UNIT 3/CITY HALL P180371 XXXXXX 04/24/25 15669.00 010 46013 3900 REPLACEMENT HVAC UNIT/THOMPSON PARK ------------
Vendor's Total = 22569.00
------------
....................................................................................................................................
VENDOR.: TIM04 (CHARTER COMMUNICATIONS)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 801042125 XXXXXX 05/01/25 404.96 135 43300 3610 4/21/25-5/20/25 INTERNET SERVICE/SP,CP,CITY HALL ------------
Vendor's Total = 404.96
------------
....................................................................................................................................
VENDOR.: TIT01 (TITAN ENVIRONMENTAL SOLUTIONS, INC.)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 11131560 XXXXXX 05/01/25 0.05 030 47604 9000 116 TEST ACH/ASBESTOS SURVEY,POINT COUNT/BLFR.VOL.CTR. ------------
Vendor's Total = 0.05
------------
....................................................................................................................................
VENDOR.: TRA16 (TRANSDEV FLEET SERVICES, INC.)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 11949510 XXXXXX 05/01/25 21959.48 010 42054 3100 3/25 VEHICLE & EQUIPMENT MAINT.& REPAIR SERVICES
REPORT.: 05/05/25 City of Bellflower PAGE: 022 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: TRA16 (TRANSDEV FLEET SERVICES, INC.) ..Continue..
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 11949511 XXXXXX 05/01/25 89.63 010 46500 3100 SUPPLIER SERVICE/UNIT #345 160.00 010 46500 2000 SUPPLIER SERVICE/UNIT #142 241.94 010 46500 3900 REPAIR/UNIT #366,SUPPLIER SERVICE/UNIT #604 ------------
Vendor's Total = 22451.05
------------
....................................................................................................................................
VENDOR.: TRE01 (RENE JAVIER TREVINO)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250415 XXXXXX 04/24/25 100.00 010 20710 XXX WDC POLICY BOARD COMMITTEE STIPEND 04/15/25 ------------
Vendor's Total = 100.00
------------
....................................................................................................................................
VENDOR.: TRI08 (TRIPEPI, SMITH & ASSOCIATES)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 14487 XXXXXX 04/24/25 9924.88 010 41317 1012 03/25 VIDEO PRODUCTION SERVICES/AFN 684.4 14488 XXXXXX 04/24/25 13212.33 010 41317 1012 03/25 COMMUNICATIONS COORD.& OUTREACH SERVICES ------------
Vendor's Total = 23137.21
------------
....................................................................................................................................
VENDOR.: TUS01 (TUSTIN AWARDS, INC.)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 63025 XXXXXX 04/24/25 2360.90 010 41302 1012 SPECIAL EVENT AWARDS (QTY 13) ------------
Vendor's Total = 2360.90
------------
REPORT.: 05/05/25 City of Bellflower PAGE: 023 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: ULI01 (ULINE,INC.)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 191511312 XXXXXX 05/01/25 38.57 010 46000 3100 PUBLIC WORKS SUPPLIES ------------
Vendor's Total = 38.57
------------
....................................................................................................................................
VENDOR.: UND01 (UNDERGROUND SERVICE ALERT OF SOUTHERN CA)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 24253065 XXXXXX 04/28/25 85.17 010 41200 3100 DIG SAFE BOARD FEES 320250079 XXXXXX 04/28/25 261.60 010 41200 3100 NEW TICKET CHARGE (QTY 136) ------------
Vendor's Total = 346.77
------------
....................................................................................................................................
VENDOR.: VER09 (VERIZON WIRELESS)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 110091845H XXXXXX 04/24/25 38.01 530 43300 9500 04/25 CELLULAR BROADBAND
41.57 010 43300 1000 CVS 04/25 CELLULAR BROADBAND
41.57 010 43300 3000 04/25 CELLULAR BROADBAND
83.14 010 43300 3100 04/25 CELLULAR BROADBAND
41.57 010 43300 3900 04/25 CELLULAR BROADBAND 124.71 010 43300 4000 04/25 CELLULAR BROADBAND
41.57 010 43300 4100 04/25 CELLULAR BROADBAND 282.03 010 43300 4105 04/25 CELLULAR BROADBAND
45.91 900 43300 4152 04/25 CELLULAR BROADBAND 184.53 010 43300 2000 04/25 CELLULAR BROADBAND 121.15 010 43300 1100 04/25 CELLULAR BROADBAND
61.59 010 43300 5000 04/25 CELLULAR BROADBAND 116.04 010 43300 5010 04/25 CELLULAR BROADBAND
41.57 010 43300 5017 04/25 CELLULAR BROADBAND
38.01 320 43300 6022 04/25 CELLULAR BROADBAND
45.02 135 43300 3610 04/25 CELLULAR BROADBAND
41.57 900 43300 5022 04/25 CELLULAR BROADBAND ------------
Vendor's Total = 1389.56
------------
REPORT.: 05/05/25 City of Bellflower PAGE: 024 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: VIS01 (VISTA PAINT CORPORATION)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 88714700 XXXXXX 05/01/25 1813.70 010 43162 3100 GRAFFITI PAINT ------------
Vendor's Total = 1813.70
------------
....................................................................................................................................
VENDOR.: VOY01 (VOYAGER FLEET SYSTEMS INC)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 778672513 XXXXXX 05/01/25 10289.18 010 46501 3100 03/25 CNG,DIESEL FUEL/VARIOUS EQUIPMENT ------------
Vendor's Total = 10289.18
------------
....................................................................................................................................
VENDOR.: VOY02 (VOYA RETIREMENT INS & ANNUITY CO - 457)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- A250408H XXXXXX 04/10/25 30886.20 010 23090 VOYA 457 DEFERRED COMP PPE 4/04/25 PD 4/10/25 A240418H XXXXXX 04/24/25 33717.96 010 23090 VOYA 457 DEFERRED COMP PPE 4/18/25 PD 4/24/25 ------------
Vendor's Total = 64604.16
------------
....................................................................................................................................
VENDOR.: VOY03 (VOYA RETIREMENT INS & ANNUITY CO - 401a)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- A250408H XXXXXX 04/10/25 1794.90 010 23092 VOYA 401A - PPE 4/04/25 PD 4/10/25 A250418H XXXXXX 04/24/25 1777.28 010 23092 VOYA 401A - PPE 4/18/25 PD 4/24/25 ------------
Vendor's Total = 3572.18
------------
....................................................................................................................................
VENDOR.: VOY04 (VOYA RETIREMENT INS & ANNUITY - 457 ROTH)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- A250410H XXXXXX 04/10/25 3017.54 010 23093 ROTH DEFERRED COMP-PPE 4/4/25 PD 4/10/25
REPORT.: 05/05/25 City of Bellflower PAGE: 025 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: VOY04 (VOYA RETIREMENT INS & ANNUITY - 457 ROTH) ..Continue..
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- A250418H XXXXXX 04/24/25 2785.39 010 23093 ROTH DEFERRED COMP-PPE 4/18/25 PD 4/24/25 ------------
Vendor's Total = 5802.93
------------
....................................................................................................................................
VENDOR.: WGZ00 (W.G. ZIMMERMAN ENGINEERING, INC.)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 2503720 XXXXXX 05/01/25 3120.00 011 47240 9000 136 03/25 ON-CALL DESIGN SVCS/CARUTHERS PARK DOG PARK ------------
Vendor's Total = 3120.00
------------
....................................................................................................................................
VENDOR.: WHI03 (WHITTIER FERTILIZER)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 422304 XXXXXX 04/24/25 2822.40 010 46012 3900 WOOD CHIPS ------------
Vendor's Total = 2822.40
------------
....................................................................................................................................
VENDOR.: WIL25 (ROBERT WILSON)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250407 XXXXXX 04/24/25 150.00 010 41000 1030 04/07/25 PLANNING COMMISSION STIPEND ------------
Vendor's Total = 150.00
------------
....................................................................................................................................
VENDOR.: WIL27 (KIDZ TALENT ACADEMY LLC)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250407 XXXXXX 04/24/25 575.25 010 42534 5000 INSTRUCTOR FEE/CHEER,HIP HOP/03/17/25-04/07/25 ------------
Vendor's Total = 575.25
------------
REPORT.: 05/05/25 City of Bellflower PAGE: 026 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: WOO04 (JEFFREY T. WOOD)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250415 XXXXXX 04/24/25 100.00 010 20710 XXX WDC POLICY BOARD COMMITTEE STIPEND 04/15/25 ------------
Vendor's Total = 100.00
------------
....................................................................................................................................
VENDOR.: YAT02 (VERONICA YATES)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250414 XXXXXX 05/01/25 19.74 010 45000 1350 REIMBURSE MILEAGE/2/11/25-4/14/25 ------------
Vendor's Total = 19.74
------------
....................................................................................................................................
VENDOR.: \ADV3 (ADVANTAGE ENGINEER)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 5680 XXXXXX 05/01/25 1000.00 090 20500 REFUND DEPOSIT/PW/17600 BELLFLOWER BLVD/R#5680 ------------
Vendor's Total = 1000.00
------------
....................................................................................................................................
VENDOR.: \AL60 (ANITA VALERIE ALATORRE)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250407 XXXXXX 04/24/25 624.00 010 42534 5000 INSTRUCTOR FEE/FULL BODY FITNESS/3/12/25-4/7/25 ------------
Vendor's Total = 624.00
------------
....................................................................................................................................
VENDOR.: \AN35 (BELIA V. ANDALON)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250408 XXXXXX 04/24/25 608.40 010 42534 5000 INSTRUCTOR FEE/PAINTING/02/25/25-04/08/25 ------------
Vendor's Total = 608.40
------------
REPORT.: 05/05/25 City of Bellflower PAGE: 027 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: \BRE1 (GUY BREMER)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250407 XXXXXX 04/24/25 150.00 010 41000 1030 04/07/25 PLANNING COMMISSION STIPEND ------------
Vendor's Total = 150.00
------------
....................................................................................................................................
VENDOR.: \COA4 (FITNESS REPAIR SHOP INC.)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 88431 XXXXXX 04/24/25 605.27 010 46200 5013 GYM EQUIPMENT/CHROME HEX TRAP BAR 88564 XXXXXX 05/01/25 4108.13 010 46200 5013 PO#500050028 HIP MACHINE/GYM EQUIPMENT
------------
Vendor's Total = 4713.40
------------
....................................................................................................................................
VENDOR.: \CR29 (CROWN CASTLE USA INC.)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 93220 XXXXXX 05/01/25 1000.00 090 20500 REFUND DEPOSIT/PW/COKE AVE & ARTESIA BLVD/R#93220 ------------
Vendor's Total = 1000.00
------------
....................................................................................................................................
VENDOR.: \ENG3 (ENGINEERING ASSOCIATES, LLC)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 98659 XXXXXX 05/01/25 1000.00 090 20500 REFUND DEPOSIT/PW/9572 PARK ST/R#98659 98661 XXXXXX 05/01/25 1000.00 090 20500 REFUND DEPOSIT/PW/9851 ROSE ST/R#98661 98664 XXXXXX 05/01/25 1000.00 090 20500 REFUND DEPOSIT/PW/17043 WOODRUFF AVE/R#98664 98666 XXXXXX 05/01/25 1000.00 090 20500 REFUND DEPOSIT/PW/10027 ROSE ST/R#98666 ------------
Vendor's Total = 4000.00
------------
REPORT.: 05/05/25 City of Bellflower PAGE: 028 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: \KI29 (JACLYN KIM)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 17161 XXXXXX 04/24/25 500.00 010 20500 REFUND DEPOSIT/P&R/R#17161 ------------
Vendor's Total = 500.00
------------
....................................................................................................................................
VENDOR.: \LIM7 (LIMITED EDITION CO)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Description Ctr
---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 17072 XXXXXX 04/24/25 500.00 010 20500 REFUND DEPOSIT/P&R/R#17072 ------------
Vendor's Total = 500.00
------------
....................................................................................................................................
VENDOR.: \PAT1 (ASHISH PATEL)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 017869002 XXXXXX 04/24/25 250.00 010 20500 REFUND DEPOSIT/P&R/R#1017869.002 ------------
Vendor's Total = 250.00
------------
....................................................................................................................................
VENDOR.: \R061 (ARMANDO RAMIREZ)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250418 XXXXXX 05/01/25 172.39 010 43110 3900 REIMBURSE WORK BOOTS ------------
Vendor's Total = 172.39
------------
....................................................................................................................................
VENDOR.: \ROU0 (MINA ROUFAEL)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 27293H XXXXXX 04/17/25 22.00 010 41100 1000 REFRESHMENTS/CITY COUNCIL
REPORT.: 05/05/25 City of Bellflower PAGE: 029 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: \ROU0 (MINA ROUFAEL) ..Continue..
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- XXXXXX 04/17/25 73.09 010 43100 1100 HR SUPPLIES
64.68 010 42015 1350 REFRESHEMNTS,FOOD/EMPLOYEE RECOGNITION DAY
------------
Vendor's Total = 159.77
------------
....................................................................................................................................
VENDOR.: \SAN2 (JESUS SANCHEZ)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- B250407 XXXXXX 04/24/25 171.28 010 43110 3100 REIMBURSEMENT WORK BOOTS ------------
Vendor's Total = 171.28
------------
....................................................................................................................................
VENDOR.: \SO08 (SOUTH INDIAN MUSIC ACADEMY)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 17163 XXXXXX 05/01/25 500.00 010 20500 REFUND DEPOSIT/P&R/R#17163 ------------
Vendor's Total = 500.00
------------
....................................................................................................................................
VENDOR.: \SPR2 (SPRING NECTAR FOUNDATION)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 17144 XXXXXX 04/24/25 425.00 010 20500 REFUND DEPOSIT/P&R/R#17144
75.00 010 20500 FR.010-20500 TO 010-36630/CANCELLATION/R#17144 -75.00 010 36630 FR.010-20500 TO 010-36630/CANCELLATION/R#17144 ------------
Vendor's Total = 425.00
------------
REPORT.: 05/05/25 City of Bellflower PAGE: 030 RUN....: 05/05/25 Cash Disbursement Report by Vendor ID #: PYVP Run By.: Deserie Stanley CTL.: BEL
....................................................................................................................................
VENDOR.: \WLB0 (W.L. BUTLER CONSTRUCTION)
---- WARRANT ----- --------------------------------------- DISTRIBUTION --------------------------------------- Invoice No Number Date Amount Paid G/L Account No Ctr Description ---------- ------ -------- ------------ -------------- --- -------------------------------------------------- 26890 XXXXXX 04/24/25 18000.00 090 20506 REFUND DEPOSIT/PW/C&D WMP/10400 ROSECRANS/R#26890 ------------
Vendor's Total = 18000.00
------------
Report's Grand Total = 2128343.27
============
15-B
TO: Honorable Mayor and Members of the City Council
ATTENTION: Ryan Smoot, City Manager
FROM: Mayra Ochiqui, City Clerk
SUBJECT: Consideration and possible action to approve the Minutes of April 21, 2025, Special Meeting of the City Council.
DATE: May 12, 2025
EXECUTIVE SUMMARY
None
RECOMMENDATION TO CITY COUNCIL
1) Approve the April 21, 2025, Special Meeting Minutes; or
2) Alternatively, discuss and take other action related to this item.
FISCAL IMPACT
None
ATTACHMENT
Minutes of the April 21, 2025, Special Meeting… ........................ ………………………… 2
MINUTES
CITY OF BELLFLOWER
SPECIAL MEETING OF THE BELLFLOWER CITY COUNCIL
MONDAY, APRIL 21, 2025, 2:00 P.M.
BELLFLOWER CITY HALL – COUNCIL CHAMBERS
1 CALL TO ORDER
Mayor Dunton called the Special Meeting to order at 2:00 p.m. in the Council Chambers at Bellflower City Hall, 16600 Civic Center Drive, Bellflower.
2 ROLL CALL
The following Members of the City Council responded present to roll call:
Mayor Ray Dunton
Mayor Pro Tem Sonny R. Santa Ines
Council Member Dan Koops
Council Member Wendi Morse
Council Member Victor A. Sanchez
Staff Participants:
Ryan Smoot, City Manager
Karl H. Berger, City Attorney
Mayra Ochiqui, City Clerk
Len Gorecki, Assistant City Manager/Director of Public Works Tae Rhee, Director of Finance
Anna Garan, Finance Manager
Brian McNerney, Director of Public Safety
Jim DellaLonga, Director of Economic Development
Elizabeth Oba, Director of Planning and Building Services Wangsu Lee, Assistant to the City Manager
Dakota Wallace, Management Assistant
3 PUBLIC COMMENTS
For the record, there was no one in attendance wishing to provide public comments.
Bellflower City Council Special Meeting Minutes Item No. 4-A April 21, 2025 Page 2 of 9
4 BUDGET STUDY SESSION
A Consideration and possible action to conduct a City Council Study Session concerning 2025-2027 Proposed Budget.
The study session will review budget proposals from each City department for Fiscal Years 2025-2027. Individual Department Directors will provide an overview of their departments and present major department changes and projects incorporating overarching goals from the Strategic Plan adopted by the Council earlier this year. Council Members may provide general input and direction regarding the draft budget. A separate meeting will be held to consider adopting a final budget.
City Manager Smoot introduced the item.
For the record, Finance Manager Garan 1) provided a PowerPoint presentation of an overview of Management’s Recommended 2025-2027 Budget Adjustments; and 2) along with City Manager Smoot, responded to Council Members’ questions.
For the record, relative to Slide 4 of the PowerPoint presentation (General Fund Budget), 1) Finance Manager Garan clarified that the proposed General Fund Surplus Policy is to allow for the allocation of the actual General Fund surplus, if the actual surplus is in excess of two million dollars, to the General Fund Property Acquisition Reserve and General Fund Capital Projects Fund; and 2) City Manager Smoot a) reiterated that with the proposed policy, anything in excess of two million dollars would be split between the General Fund Property Acquisition Reserve and the General Fund Capital Projects Fund; however, if the actual surplus is not in excess of two million dollars, the funds will remain in the unassigned General Fund reserve; b) confirmed that the balance of the General Fund Property Acquisition Reserve has been fully expended, highlighting that the proposed policy would ensure that sufficient funds are allocated for future investments; and c) clarified that if the proposed policy is adopted, staff will be able to transfer the surplus funds without City Council approval.
For the record, the discussion followed each Department’s budget as listed on the PowerPoint presentation provided by Finance Manager Garan.
City Manager’s Office
Assistant to the City Manager Lee 1) provided a report of the City Manager’s, City Attorney’s Office, and New Hope Temporary Shelter’s proposed budgets; and 2) responded to Council Members’ questions along with City Manager Smoot, City Attorney Berger and Finance Manager Garan.
For the record, 1) without objection, Council Member Sanchez requested that “Goal #4: Improve Quality of Life & Visual Appeal in the City” be added to the strategic plan goals and objectives listed on Slide 22 of the PowerPoint presentation (City Manager’s Office Strategic Plan Goals & Objectives), expressing the opinion that Goal #4 should be actively considered and achieved by the City Manager’s Office; and 2) City Manager Smoot confirmed that although not shown on the slide, all strategic plan goals are considered and achieved by the City Manager’s Office.
Bellflower City Council Special Meeting Minutes Item No. 4-A April 21, 2025 Page 3 of 9
4 BUDGET STUDY SESSION – Continued
A Consideration and possible action to conduct a City Council Study Session concerning 2025-2027 Proposed Budget – Continued
For the record, and without objection, Mayor Pro Tem Santa Ines requested and received confirmation from City Manager Smoot that the new Human Resources & Risk Manager 1) will prioritize risk management; 2) will review the City’s current insurance coverage to determine if the City is sufficiently covered or has excess coverage that may not be needed; and 3) is aware of these City Council priorities.
City Attorney’s Office
Relative to Slide 24 of the PowerPoint presentation (Major Department Changes – City Attorney’s Office) and at the request of Mayor Dunton and Mayor Pro Tem Santa Ines, City Attorney Berger 1) clarified that seventy-five hours are billed as a retainer; however, as the services and needs of the City have changed, billable hours have increased, noting that the City Attorney’s Office was nine hundred twenty-one hours over the retainer in 2024; 2) stated that an increase of rates has not been requested, further explaining that the current retainer is below market rate when comparing to other municipal attorneys; 3) explained that some attorney fees are recovered by the City, such as time for public nuisance cases, liens, and cannabis permit renewals because the time is billed directly to the property owner or permittee; and 4) confirmed that his firm has been compensated for the hours worked.
New Hope Temporary Shelter Services
Following brief discussion, relative to Slide 25 of the PowerPoint presentation (New Hope Temporary Shelter Services) and in response to questions and comments provided by Council Member Sanchez, City Manager Smoot confirmed that the City is working with Los Angeles County and other local solutions to provide funding for temporary shelter services.
At the request of Council Member Koops, 1) Assistant to the City Manager Lee clarified that Operating and Maintenance Costs listed for the shelter includes a $400,000 placeholder for Measure A funding because the County has indicated that the City is not able to supplant or replace the funding that we currently utilize to operate the shelter, meaning that effectively the City would have to expand the homelessness services and reallocate an additional $400,000 for other homelessness services, so we have included that into that line item as the worst case scenario; 2) City Manager Smoot stated that he did not see specific “anti-supplantation” language is anywhere in Measure A, nor believed that it was the intent of Measure A, and the City has disputed that with the County; however, have opted to include the funding there as worst case scenario as it has been difficult to reach an agreement with the County; and 3) Finance Manager Garan confirmed that the placeholder funds could be separated out in the budget from the usual operating and maintenance cost.
For the record, following brief discussion, it was the consensus of the City Council to include a separate line item on page 164 of the Budget (New Hope Temporary Shelter Services) to differentiate the actual operating and maintenance costs compared to the projected operating and maintenance costs.
Bellflower City Council Special Meeting Minutes Item No. 4-A April 21, 2025 Page 4 of 9
4 BUDGET STUDY SESSION – Continued
A Consideration and possible action to conduct a City Council Study Session concerning 2025-2027 Proposed Budget – Continued
At the request of Mayor Pro Tem Santa Ines relative to the PLHA Grant funding, 1) Assistant to the City Manager Lee confirmed that the City is entitled to permanent housing allocation funds, the estimates are released for five-year increments, and although it is nearly impossible to project the fund allocation , the City will continue to apply for it; and 2) Finance Manager Garan confirmed that all $963,000 of funding was used this year towards personnel costs for Mercy House.
Following discussion, City Manager Smoot 1) explained that based on the daily reports provided by the New Hope Shelter, approximately thirty-four to thirty-six individuals occupy the Shelter daily and the per bed cost paid by the City is approximately $145 per day; and 2) confirmed that he would look into the possibility of the City “selling beds” to surrounding cities as it may be a potential revenue source.
For the record, Council Member Koops expressed concern with the City “selling beds” to surrounding cities as the community was promised that the New Hope Shelter would be available to the Bellflower community only.
City Clerk’s Office
City Clerk Ochiqui 1) provided a report of the City Clerk’s proposed budget; and 2) along with City Manager Smoot, responded to Council Members’ questions.
At the request of Mayro Pro Tem Santa Ines, City Clerk Ochiqui clarified that Public Records Act requests received for building records are typically made by property owners and buyers conducting their due diligence prior to completing real estate transactions.
In response to questions and comments by Mayor Dunton, 1) City Clerk Ochiqui clarified that the City continues to maintain both hardcopy and electronic records; and 2) City Manager Smoot confirmed that many digitized records are readily available to the public through the City’s records archive on the website, noting that perhaps the increase in the number of records requests received each year may be even greater if the records archive were not readily available; however, noted that not all records are available on the website, as some are excluded from disclosure or otherwise protected.
Finance Department
Finance Manager Garan 1) provided a report of the Finance Department’s proposed budget; and 2) along with City Manager Smoot, responded to Council Members’ questions.
Bellflower City Council Special Meeting Minutes Item No. 4-A April 21, 2025 Page 5 of 9
4 BUDGET STUDY SESSION – Continued
A Consideration and possible action to conduct a City Council Study Session concerning 2025-2027 Proposed Budget – Continued
At the request of Council Member Sanchez and Mayor Pro Tem Santa Ines, Finance Manager Garan 1) explained that the implementation of the new financial software will take approximately twenty to twenty-four months, noting that both the current system and new system will run concurrently; 2) stated that the implementation of the new software is approximately $500,000, and $100,000 each year thereafter for maintenance, which is allocated in the proposed budget; 3) clarified that the new system will only migrate the summary data, not the details, as it is easier to quality check only the summary data; and 4) explained that with the new system, invoices will be processed online and employees will be able to complete their timecards and access previous timecards online.
In response to Mayor Dunton, City Manager Smoot 1) confirmed that staff would reach out to California Joint Powers Insurance Authority (CJPIA) to determine whether the City needs earthquake insurance when the City is self-insured through CJPIA; and 2) stated that the new Risk Manager will be tasked with reviewing insurance coverages for the City as an insured and the insurance we require fr om vendors and contractors.
In response to questions and comments provided by Council Member Sanchez, Finance Manager Garan confirmed that she would look into the City’s banking institution’s current Earnings Credit Rate (“ECR”), noting that the City does not rely on the operating accounts to generate investment earnings, but rather use other investment vehicles specifically for investment purposes to optimize interest earnings.
Recess: For the record and without objection, Mayor Dunton recessed the meeting at 3:44 p.m. for a brief break.
Reconvene: For the record, Mayor Dunton reconvened the meeting at 3:50 p.m., with all Council Members present.
Public Safety Department
Director of Public Safety McNerney 1) provided a report of the Public Safety Department’s proposed budget; and 2) along with City Manager Smoot and City Attorney Berger, responded to Council Members’ questions.
In response to questions and comments provided by Mayor Dunton, relative to Slide 36 of the PowerPoint presentation (Public Safety Department Major Contract Services Deployment), Director McNerney 1) clarified the “40-Hour Units” and “56- Hour Units” are per shift, not per Los Angeles County Sheriff Deputy (“Deputy”), further explaining that the City’s current agreement with the Los Angeles County Sheriff’s Department (LASD) requires that one 40-Hour Unit Non-Relief and one 56-Hour Unit Non-Relief be filled at all times; and 2) explained that there are a total of twenty-one Deputies on shift in the City throughout the day and night, noting that per the agreement, only one patrol unit with two Deputies is provided for either the day or night shift.
Bellflower City Council Special Meeting Minutes Item No. 4-A April 21, 2025 Page 6 of 9
4 BUDGET STUDY SESSION – Continued
A Consideration and possible action to conduct a City Council Study Session concerning 2025-2027 Proposed Budget – Continued
Following brief discussion, 1) Director McNerney a) stated he is hopeful the Motor Deputy position will be filled in the near future; b) clarified that LASD does not charge the City for overtime of the Deputies; however, if the City requests for a Deputy to work overtime, the City must bear the overtime costs; and c) explained the “no-call” traffic car was removed from the proposed budget as the LASD is unable to fill the position; however, if they are able to fill it in the future, staff will request a budget amendment to include the position, further clarifying that the position was not removed from the agreement with the LASD, it was only from the proposed budget; and 2) City Manager Smoot explained that the agreement with the LASD is structured on a per minute basis and the City has requested that the LASD bill their minutes per service category to ensure the minutes required per the agreement are being met sufficiently.
For the record, and without objection, Council Member Sanchez requested staff look into 1) installation of traffic cameras positioned at major arterial streets that have the capability of issuing tickets to assist with traffic calming as a “Plan B” to the Motor Deputy that the City would like to have, but is currently unavailable due to staffing issues within the LASD; 2) budget for a Motor Deputy and a “No Call” traffic car so that the City can show that it is actively pursuing these services; 3) including Goal #2 (Increase Public Outreach, Education and Connection) in the Public Safety Department budget presentation to increase Public Safety involvement within the community through the Neighborhood Watch Program and/or the LASD Volunteers on Patrol (“VOPs”) Program; 4) creating parking districts in certain areas of the City to alleviate crime and public nuisance; and 5) seeing if the newly formed Public Safety Joint Powers Authority (“JPA”) could provide animal control services in the future as there are concerns with services currently provided by Southeast Area Animal Control Authority (“SEAACA”).
In response to comments and questions from Council Member Sanchez, 1) Director McNerney a) stated that staff researched the ticketing cameras, including five pilot cities, and noted that it would not be available to other cities until the year 2030; b) clarified that the Motor Deputy was removed from the budget because the LASD is unable to provide it at this time and the City is better off taking the savings until a Motor Deputy and “No Call” car are available and once available, a budget amendment will be brought back to City Council to reincorporate the funding as it is still in the City’s agreement with LASD; and c) clarified that Goal #2 (Increase Public Outreach, Education and Connection) was not listed in the Public Safety Department budget presentation since no budget allocation was needed to achieve that goal, but it is an active part of Public Safety services; 2) City Manager Smoot confirmed that the motor deputy is still on the “575 form,” it just was not budgeted last year, but will be budgeted in Year 1 in the event the service is available; 3) Mayor Dunton expressed that he is in favor of having the money accessible for other things in the General Fund as the money had been allocated for those services for so long without any progress; and 4) Mayor Pro Tem Santa Ines agreed that although Director McNerney is hopeful to acquire Motor Deputy services, there is currently no hope.
Bellflower City Council Special Meeting Minutes Item No. 4-A April 21, 2025 Page 7 of 9
4 BUDGET STUDY SESSION – Continued
A Consideration and possible action to conduct a City Council Study Session concerning 2025-2027 Proposed Budget – Continued
At the request of Council Member Sanchez, and following general discussion related to public nuisance concerns of a property located in the Artesia Corridor, City Attorney Berger stated that the matter would be scheduled for a future agenda as initiation of litigation to the extent that they are able to.
Following discussion, 1) Director McNerney and City Manager Smoot confirmed that more information relative to technology for public safety, such as “ShotSpotter” and graffiti tracker software/app, will be brought to the City Council for consideration at a future date; and 2) Director McNerney confirmed that license plate readers have been purchased by the City and will be installed at major traffic intersections, and additional units and “ALPR cameras” could be purchased through ShotSpotter’s parent company “Sound Thinking,” noting that this technology compared to the cost of an additional Deputy would be less than half the cost and would be a supplemental option to increase public safety services, reiterating the lack of resources from LASD.
At the request of Mayor Pro Tem Santa Ines, relative to page 184 of the Budget (Budget Analysis), Director McNerney confirmed that he would look into the reason for the monetary difference between the “Special Assignment Sergeant” and “Traffic Law Cars – 56-HR Relief and 40-HR Relief.”
Economic Development Department
Director of Economic Development DellaLonga 1) stated that the PowerPoint presentation was reorganized but content had not changed; 2) provided a report of the Economic Development Department’s proposed budget; 3) noted that a study session would be scheduled with the City Council to discuss the future of economic development going forward; and 4) along with City Manager Smoot, responded to Council Members’ questions.
At the request of Mayor Dunton, Director DellaLonga 1) explained that the goal of the proposed Department reorganization is to increase the department’s capacity and delineate duties and responsibilities to provide clear expectations for staff; and 2) stated that the proposed Senior Project Manager of Business Development position would be responsible for overseeing the Business Assistance Programs (“BAPS”) and communicating with current and potential businesses to generate more economic development in the City, noting that the overall goal of the Department is to create new business opportunities, while also retaining what currently exists.
For the record, and without objection, Mayor Santa Ines requested that the Economic Development Department and the Planning and Building Services Department conduct a review of the General Plan with a focus on certain corridors.
Bellflower City Council Special Meeting Minutes Item No. 4-A April 21, 2025 Page 8 of 9
4 BUDGET STUDY SESSION – Continued
A Consideration and possible action to conduct a City Council Study Session concerning 2025-2027 Proposed Budget – Continued
Following brief discussion, 1) Mayor Dunton stated that he was in favor of conducting a workshop in the future to assist the Economic Development Department with understanding the City Council’s priorities and goals; 2) at the request of Council Member Sanchez regarding when the study session would be scheduled, City Manager Smoot stated that it would be scheduled shortly after the budget year to implement changes and carry forward; and 3) Council Member Koops a) expressed frustration with projects that have been stagnant for long periods of time, such as the “Gold property,” Belle Fleur Centre, K-Mart, and the vacant property behind the Sizzler on Artesia Boulevard, expressing the opinion that there are always projects in the works but most do not come to fruition; and b) stated that he would like to see the Economic Development Department engage with property owners to assist with the fruition of developments.
In response to questions and comments provided by Council Member Koops, City Manager Smoot stated that staff assist property owners with developing and maintaining their properties; however, there are challenges with property owner compliance that inhibits successful development and/or maintenance, but perhaps the City could do to a better job of incentivizing compliance and deterring non-compliance.
For the record, Council Member Sanchez expressed the opinion that the City should continue to strengthen economic development within the City, bring in new businesses, and explore the next ballot measures , such as a vacant property tax or the ¼ cent tax that is newly available.
Planning and Building Services Department
Director of Planning and Building Services Oba 1) stated that a correction was made to Slide 52 of the PowerPoint presentation (Planning Department Existing Structure) to read “7 Contract Building & Safety Staff;” 2) provided a report of the Planning and Building Services Department’s proposed budget ; and 3) along with City Manager Smoot and Finance Manager Garan, responded to Council Members’ questions.
In response to questions and comments provided by Council Member Sanchez and Mayor Pro Tem Santa Ines relative to Slide 55 of the PowerPoint presentation (Planning Department Proposed Structure), Director Oba 1) confirmed the proposed structure is equivalent to surrounding cities and will be sufficient; and 2) stated that the separation of the Planning Division and Advance Planning Division will benefit the Department as specific projects will be separated depending on the scope of work, further clarifying that the Senior Planner of the Advance Planning Division will report directly to the Planning Manager.
Bellflower City Council Special Meeting Minutes Item No. 4-A April 21, 2025 Page 9 of 9
4 BUDGET STUDY SESSION – Continued
A Consideration and possible action to conduct a City Council Study Session concerning 2025-2027 Proposed Budget – Continued
At the request of Council Member Sanchez relative to Accessory Dwelling Units (ADUs), Director Oba confirmed that they account for about five percent of permits, which is a high number considering the volume of permits processed, and equate to most of the construction permits.
At the request of Council Member Koops, relative to Slide 57 of the PowerPoint Presentation (Major Department Changes Planning), 1) Finance Manager Garan confirmed that the increase in salaries, wages, benefits and taxes in the amount of $187,775 accounts for the seven full-time and two part-time employees currently in the Planning Division, noting that this includes an assumed Cost-of-Living Adjustment (“COLA”) increase and CalPERS adjustment; and 2) City Manager Smoot highlighted that Slide 9 of the PowerPoint Presentation (Budget Summary – By Expenditure Type) demonstrates that 23% of the City’s expenditures for the next two years is for salaries, benefits and taxes.
For the record, there was no formal action taken on this item.
5 ADJOURNMENT
It was moved by Council Member Koops, seconded by Mayor Pro Tem Santa Ines, and carried without objection, to adjourn the meeting. Mayor Dunton adjourned the meeting at 6:02 p.m.
Ray Dunton, Mayor
City of Bellflower
ATTEST:
Mayra Ochiqui, City Clerk
Approved: May 12, 2025
15-C
TO: Honorable Mayor and Members of the City Council
ATTENTION: Ryan Smoot, City Manager
FROM: Mayra Ochiqui, City Clerk
SUBJECT: Consideration and possible action to approve the Minutes of April 24, 2025, Special Meeting of the City Council.
DATE: May 12, 2025
EXECUTIVE SUMMARY
None
RECOMMENDATION TO CITY COUNCIL
1) Approve the April 24, 2025, Special Meeting Minutes; or
2) Alternatively, discuss and take other action related to this item.
FISCAL IMPACT
None
ATTACHMENT
Minutes of the April 24, 2025, Special Meeting… ........................ ………………………… 2
o“ 01: BELLFLO
“ s a
"o ROWING TOGETk‘YFS t f t
MINUTES
CITY OF BELLFLOWER
SPECIAL MEETING OF THE BELLFLOWER CITY COUNCIL
THURSDAY, APRIL 24, 2025
11:00 A.M. – BRAVO AWARDS CEREMONY
THE MAYNE EVENTS CENTER
16400 BELLFLOWER BLVD., BELLFLOWER, CA 90706
11:00 A.M. – BRAVO AWARDS CEREMONY
1 Call to Order
The Special Meeting was called to order at 11:06 a.m. at The Mayne Events Center, 16400 Bellflower Boulevard, Bellflower.
2 Roll Call
For the record, the following Members of the City Council were present:
Mayor Ray Dunton
Mayor Pro Tem Sonny R. Santa Ines
Council Member Dan Koops
Council Member Wendi Morse
Council Member Victor A. Sanchez
• INVOCATION
James Cody Birkey offered the Invocation.
• PLEDGE OF ALLEGIANCE
Mitch Haack led the assembly in the Pledge of Allegiance.
OF BELLFL CS“ 0%
I. (I 0 $- ROMNO Mme
Bellflower City Council Special Meeting Minutes Item No. 3 April 24, 2025 Page 2 of 2
3 Presentations to BRAVO Award Recipients
For the record, the following individuals were presented awards for their distinguished service:
Valor
Gabriel D’Souza, Deputy, Los Angeles County Sheriff’s Department Elvis Ontiveros, Deputy, Los Angeles County Sheriff’s Department
Outstanding Citizen
Cindy Weeks, Bellflower Unified School District
Student Essay Winners
Isaiah Gonzalez, Bellflower High School
Natalie Schulz, Mayfair High School
Outstanding Service
Jose Martinez, III, Deputy, Los Angeles County Sheriff’s Department Khadijah Dibia, Bellflower Unified School District
Christopher Guillen & Marcus Guillen, The Rocio Guillen Foundation Michael DeLelio, Captain, Los Angeles County Fire Department Matthew Powers, Firefighter, Los Angeles County Fire Department Wolhan Sosa, Firefighter, Los Angeles County Fire Department Greg Bryant, Firefighter Paramedic, Los Angeles County Fire Department Chris Warren, Firefighter Paramedic, Los Angeles County Fire Department Justin Neese, Firefighter Specialist, Los Angeles County Fire Department
For the record, Marcus Guillen and Wolhon Sosa were not in attendance to receive their awards.
4 PUBLIC COMMENTS
None
5 Adjournment
Without objection, the meeting was adjourned at 12:50 p.m.
ATTEST:
_______________________________
Ray Dunton, Mayor Mayra Ochiqui, City Clerk
City of Bellflower Approved: May 12, 2025
15-D
TO: Honorable Mayor and Members of the City Council
ATTENTION: Ryan Smoot, City Manager
FROM: Mayra Ochiqui, City Clerk
SUBJECT: Consideration and possible action to approve the Minutes of April 29, 2025, Special Meeting of the City Council.
DATE: May 12, 2025
EXECUTIVE SUMMARY
None
RECOMMENDATION TO CITY COUNCIL
1) Approve the April 29, 2025, Special Meeting Minutes; or
2) Alternatively, discuss and take other action related to this item.
FISCAL IMPACT
None
ATTACHMENT
Minutes of the April 29, 2025, Special Meeting… ........................ ………………………… 2
o“ 01: BELLFLO
“ s a
"o ROWING TOGETk‘YFS t f t
MINUTES
CITY OF BELLFLOWER
SPECIAL MEETING OF THE BELLFLOWER CITY COUNCIL
TUESDAY, APRIL 29, 2025, 2:00 P.M.
BELLFLOWER CITY HALL – COUNCIL CHAMBERS
1 CALL TO ORDER
Mayor Dunton called the Special Meeting to order at 2:03 p.m.
2 ROLL CALL
The following Members of the City Council responded present to roll call:
Mayor Ray Dunton
Mayor Pro Tem Sonny R. Santa Ines
Council Member Dan Koops
Council Member Wendi Morse
Council Member Victor A. Sanchez
Staff Participants:
Ryan Smoot, City Manager
Justin A. Tamayo, Assistant City Attorney
Mayra Ochiqui, City Clerk
Len Gorecki, Assistant City Manager/Director of Public Works Tae Rhee, Director of Finance
Anna Garan, Finance Manager
P.J. Mellana, Director of Parks and Recreation
Brian McNerney, Director of Public Safety
Wangsu Lee, Assistant to the City Manager
Dakota Wallace, Management Assistant
3 PUBLIC COMMENTS
For the record, there was no one in attendance wishing to provide public comments.
4 BUDGET STUDY SESSION
A Consideration and possible action to conduct a City Council Study Session concerning 2025-2027 Proposed Budget.
City Manager Smoot introduced the item.
BEL
’1 6
GROWNG 1063““?-
Bellflower City Council Special Meeting Minutes Item No. 4-A April 29, 2025 Page 2 of 8
4 BUDGET STUDY SESSION – Continued
A Consideration and possible action to conduct a City Council Study Session concerning 2025-2027 Proposed Budget – Continued
For the record, this is a continuation of Budget Study Session #1 held on April 21, 2025. The discussion followed each Department’s budget as listed on the PowerPoint presentation provided by Finance Manager Garan.
Parks and Recreation Department
Director of Parks and Recreation Mellana 1) provided a report of the Parks and Recreation Department’s proposed budget; and 2) along with City Manager Smoot and Finance Manager Garan, responded to Council Members’ questions.
For the record, and without objection, Mayor Dunton requested that staff look into utilizing potential grant funding to connect Caruthers Park North to Butterfly Garden Park to Riverview Park in the future.
Relative to the Park Development Project fund, Director Mellana 1) explained that the goal is to utilize the Measure A funds allocated in the proposed budget for the development of “pocket parks” or “mini pitches” in various areas of the City, noting that they are potential concepts and not included in the proposed budget, may be brought back to the City Council for consideration; and 2) at the request of Director Mellana, confirmed that he would check where the source of electricity would be for these types of developments.
In response to questions and comments provided by Mayor Dunton and Mayor Pro Tem Santa Ines, 1) Director Mellana confirmed that the proposed budget includes the addition of the annual edition of the City News (4th publication); and 2) City Manager Smoot a) highlighted that “Goal #2: Increase Public Outreach, Education and Connection” of the Strategic Plan is to bring a unified and consistent voice to the City’s communication channels and platforms, noting that this has recently been implemented among staff with that specific goal in mind; and b) confirmed that a communications assessment on the City’s current platforms and processes will be conducted by Tripepi Smith & Associates in the future.
Relative to Slide 62 of the PowerPoint presentation (Parks & Recreation Department Proposed Structure) and at the request of Council Member Koops, Director Mellana stated that programming will continue at Simms Park during the construction of the Bellflower Youth and Senior Center and Stormwater Capture Project, further explaining that although facility rentals will be temporarily paused during the construction, full-time staff will focus on the implementation of the Parks and Recreation Master Plan while also “activating” other parks located throughout the City.
Bellflower City Council Special Meeting Minutes Item No. 4-A April 29, 2025 Page 3 of 8
4 BUDGET STUDY SESSION – Continued
A Consideration and possible action to conduct a City Council Study Session concerning 2025-2027 Proposed Budget – Continued
For the record, 1) discussion ensued relative to Bellflower Sister City organization; 2) Council Member Sanchez requested a Parks and Recreation staff member attend the meetings, as it is sometimes difficult for Council Members to attend; and 3) it was the consensus of the City Council to restore the budget for the Bellflower Sister City, Inc. Cultural Exchange Program (Account 010-41570-4250) in the amount of $4,045 for Fiscal Year 2025-26 and $8,085 for Fiscal Year 2026-27 with the funds to be disbursed in accordance with the terms outlined in the City-approved Memorandum of Understanding (“MOU”) with Bellflower Sister City, Inc.
Relative to Slide 63 of the PowerPoint presentation (Major Department Changes – Year 1 Parks and Recreation) and at the request of Mayor Dunton, Director Mellana 1) clarified that the $50,000 allocated in contract services for holiday downtown and tree decorations is only for the installation of the decorations for the Tree Lighting Ceremony held annually in the Downtown, further clarifying that the proposed budget allocates $30,000 for the purchasing of additional holiday decorations; 2) confirmed that the proposed budget is sufficient to install and decorate the Downtown area for the Tree Lighting Ceremony as done in the past ; 3) stated that if additional decorations are desired, the budget would need to be amended accordingly, highlighting for comparison purposes that the City of Paramount conducts a holiday event which includes a decorating budget of approximately $200,000 annually; and 4) stated that staff can issue a Request for Proposals (“RFP”) for holiday decorating and installation services in the Downtown area if that is the direction of the City Council.
Following brief discussion, 1) Mayor Dunton expressed support for issuing an RFP for holiday decorating in the downtown area up to the 91 freeway, expressing the opinion that he would like to see holiday decorating year -round in the Downtown area, which may include programable café lighting that change colors, simulated gas lanterns, twinkle lights in the trees, and/or decorative banners; and 2) Council Member Koops suggested adding additional decorations to the Los Angeles County Fire Museum and The Edgeway to enhance the aesthetic of Bellflower Boulevard.
For the record, and without objection, Mayor Dunton requested staff issue an RFP for holiday decorating and installation services in the Downtown area year-round with different options for levels of decorating, and return to the City Council with a recommendation.
Bellflower City Council Special Meeting Minutes Item No. 4-A April 29, 2025 Page 4 of 8
4 BUDGET STUDY SESSION – Continued
A Consideration and possible action to conduct a City Council Study Session concerning 2025-2027 Proposed Budget – Continued
At the request of Council Member Sanchez, relative to concerns regarding the quality of park facilities, 1) City Manager Smoot confirmed that there is a work capacity that has been reached with current staffing levels across all departments; however, the focus has now shifted to the quality of work, not the quantity of the work, expressing the opinion that with the shift of focus and the addition of staff, the quality of City facilities will improve; and 2) Director Mellana stated that staff is working on leveraging technology to enhance the communication and tracking of work orders for park facilities between the Parks and Recreation Department and the Public Works Department, further explaining that there are funds allocated in the proposed budget for the implementation of a new system; however, internal policies and procedures must be in place prior to the implementation of the technology.
Recess: For the record and without objection, Mayor Dunton recessed the meeting at 3:48 p.m. for a brief break.
Reconvene: For the record, Mayor Dunton reconvened the meeting at 3:59 p.m., with all Council Members present.
Public Works Department
Assistant City Manager/Director of Public Works Gorecki 1) provided a report of the Public Works Department’s proposed budget; and 2) responded to Council Members’ questions, with City Manager Smoot and Finance Manager Garan.
Relative to Slide 67 of the PowerPoint presentation (Strategic Plan Goals/Objectives Public Works), Council Member Koops 1) expressed the opinion that the Public Works weekend crew dedicated to addressing graffiti removal and the disposal of illegally dumped bulky items has significantly enhanced the visual appeal of public spaces, which has made the City more attractive to residents and visitors alike; and 2) further expressed that the addition of two new Maintenance Worker I positions to the Bellflower Enforcement and Safety Team (“BEAST”) will continue to assist with the progress that has been recently made.
In response to questions and comments provided by Mayor Dunton and Council Member Koops relative to the proposed funding for a landscape maintenance contract, Assistant City Manager/Director Gorecki 1) explained that the goal is to remove landscaping tasks from current staff to focus on higher priority and detail-oriented tasks, such as repainting City facilities, irrigation changes, or leveling brick; 2) reiterated that the Department reached capacity with current staffing levels and the focus shifted to quality of work, not quantity of work; 3) confirmed that if a contract is awarded, Public Works staff will quality check the work; 4) stated that approximately one-hundred-fifty hours to one-hundred-eighty hours per week are dedicated to landscape maintenance of City facilities, noting that approximately nine staff members will be reassigned to different duties; and 5) stated the Request for Proposals will include all City parks, “setbacks”, and medians, and he will look into adding freeway on/off-ramps in the proposal.
Bellflower City Council Special Meeting Minutes Item No. 4-A April 29, 2025 Page 5 of 8
4 BUDGET STUDY SESSION – Continued
A Consideration and possible action to conduct a City Council Study Session concerning 2025-2027 Proposed Budget – Continued
Relative to page 273 of the Budget (Public Works – Recycling Programs) and at the request of Mayor Pro Tem Santa Ines, Assistant City Manager/Director Gorecki clarified that zero funding has been allocated for the Organic Waste Recycling Program in Fiscal Year 2026-27 as the program is fully funded by a CalRecycle Grant; however, if the grant funding is not received, staff will request a budget amendment at a later date.
For the record, Council Member Sanchez 1) left the dais and Council Chambers at 4:52 p.m.; and 2) returned to the Council Chambers and dais at 4:54 p.m.
For the record, and without objection, Council Member Sanchez requested that “Goal #2: Increase Public Outreach, Education and Connection” be added to the strategic plan goals and objectives listed on Slide 67 of the PowerPoint presentation (Strategic Plan Goals/Objectives Public Works), expressing the opinion that Goal #2 should be actively considered and achieved by the Public Works Department.
Relative to “Goal #4: Improve Quality of Life & Visual Appeal in the City” listed on Slide 69 of the PowerPoint presentation (Strategic Goals/Objectives Public Works), Council Member Sanchez expressed frustration with the establishment of a Capital Improvement Project (CIP) line item to fund studies for traffic calming and safety improvements, 1) expressing the opinion that multiple studies were conducted in past years, which demonstrate extensive traffic patterns in certain areas of the City, however, no traffic calming measures have been implemented to alleviate the issues identified; and 2) suggested funding specific to the implementation of traffic calming measures be allocated in the proposed budget.
Council Member Koops expressed support in creating a separate line item in the proposed budget specific to traffic calming measures, expressing the opinion that changes to the current traffic patterns must be made to keep children in the community safe.
Following discussion, City Manager Smoot 1) confirmed that funding for traffic management projects (Account No. 51606) in the amount of $75,000 for Fiscal Year 2025-26 and $75,000 in Fiscal Year 2026-27 is allocated in the proposed budget; and 2) clarified that the proposed funding is sufficient to conduct the required studies and/or implementation of certain traffic calming measures, such as “bulb-outs” or signage; however, funding would be insufficient for implementation of large traffic calming measures that require modification to infrastructure.
Following lengthy discussion relative to traffic calming measures, and without objection, Council Member Koops suggested the City Council visit the City of Montclair to view the traffic calming measures recently implemented there to be used as a potential model for what could be implemented here.
Bellflower City Council Special Meeting Minutes Item No. 4-A April 29, 2025 Page 6 of 8
4 BUDGET STUDY SESSION – Continued
A Consideration and possible action to conduct a City Council Study Session concerning 2025-2027 Proposed Budget – Continued
For the record, Council Member Sanchez, 1) stated that he did not want to be told following this budget cycle that traffic calming measures are not budgeted, as he was told this in past years; 2) at the request of Mayor Pro Tem Santa Ines, stated that he did not have a specific street where he would like traffic calming measures tested as he did not want to appear bias; 3) expressed the opinion that $75,000 is not sufficient to assist with traffic calming and does not demonstrate that the City is actively working on addressing the concerns of residents, highlighting that the community has voiced in the 2024Community Satisfaction Survey that unsafe driving and traffic congestion is a “very/somewhat serious problem;” and 4) proposed a budget of $500,000 annually be dedicated to traffic calming measures.
Following discussion, 1) Mayor Dunton a) expressed the opinion that traffic enforcement conducted by the Los Angeles County Sheriff’s Department (LASD) could assist with traffic calming and safety; b) expressed the opinion that if a traffic calming measure is implemented on one street, it will have to be duplicated on other streets as well; and c) expressed that he cannot support the allocation of $500,000 if he does not know what it will be used for; and 2) Mayor Pro Tem Santa Ines expressed the that he cannot support the allocation of funds towards a non-specific project, further explaining that the budget may be amended in the future if additional funding for a specific project is needed.
Recess: For the record and without objection, Mayor Dunton recessed the meeting at 5:47 p.m. for a brief break.
Reconvene: For the record, Mayor Dunton reconvened the meeting at 5:57 p.m., with all Council Members present.
For the record, 1) Council Member Sanchez requested a traffic calming study be conducted on the block of Park Street to Flower Street and Ardmore Avenue to Clark Street to run a “proof of concept” sampling; 2) it was the consensus of the City Council to direct staff to use the $75,000 allocated for traffic calming measures to complete a site-specific concept for the designated block of Park Street to Flower Street and Ardmore Avenue to Clark Street that examines the entire geographical area to mitigate and solve the problems identified in previous relative studies; and 3) City Manager Smoot noted that some Council Members may need to recuse on specific projects when this matter comes back for further consideration.
For the record, Council Member Morse 1) left the dais and Council Chambers at 6:00 p.m.; and 2) returned to the Council Chambers and dais at 6:01 p.m.
Capital Improvement Projects
For the record, 1) supplemental material was distributed to the City Council and made available to the public prior to the start of the meeting; and 2) City Manager Smoot a) provided a brief overview of the Capital Improvement Program (“CIP”) Master Plan; and b) along with Director of Public Works Gorecki and Finance Manager Garan, responded to Council Members’ questions.
Bellflower City Council Special Meeting Minutes Item No. 4-A April 29, 2025 Page 7 of 8
4 BUDGET STUDY SESSION – Continued
A Consideration and possible action to conduct a City Council Study Session concerning 2025-2027 Proposed Budget – Continued
Relative to slide 74 of the PowerPoint presentation (Capital Improvement Projects Streets) and at the request of Mayor Dunton, Assistant City Manager/Director Gorecki confirmed that $3,600,000 is allocated in Fiscal Year 2027 -28 and Fiscal Year 2028-29 for the Lakewood Boulevard Complete Streets Project, which encompasses the entirety of Lakewood Boulevard to the southern City limits, noting that the design renderings will be brought back to the City Council for direction and consideration at a future date.
For the record, Council Member Koops 1) left the dais and Council Chambers at 6:10 p.m.; and 2) returned to the Council Chambers and dais at 6:12 p.m.
Relative to the Tree Master Plan on slide 74 of the PowerPoint presentation (Capital Improvement Projects Streets) and at the request of Mayor Pro Tem Santa Ines, Assistant City Manager/Director Gorecki 1) stated that the $1,000,000 grant awarded to the City in 2024 for the development of an Urban Forestry Management Plan (“Plan”) was frozen by the Federal government, confirming the Plan programmed the planting and maintenance of 500 trees; and 2) explained that the Public Works Department plants approximately thirty to thirty-five trees each year.
Following brief discussion, Mayor Pro Tem Santa Ines expressed the opinion that the City should execute the tree master plan as previously presented, despite the freeze of the grant funding, and plant more trees than done in the recent past.
For the record, it was the consensus of the City Council to 1) direct staff to look into how to obtain the Tree City USA designation ; and 2) allocate an additional $100,000 in the Tree Management fund (Account No. 011-42329-9000) for additional tree planting over the next two fiscal years.
At the request of Mayor Dunton, Finance Manager Garan clarified that the Simms Park field renovation is funded by Measure A grant funding in addition to the proceeds of the Municipal Water Sale.
Relative to the Council Chamber Improvements Project (Account No. 040-53603- 9000) and at the request of Mayor Dunton and Mayor Pro Tem Santa Ines, City Manager Smoot clarified that the proposed project is fully funded by the Public, Educational, and Government funds (“PEG”), which must be used for capital expenditures related to the upgrade of audiovisual systems, lighting, and/or Americans with Disabilities Act (“ADA”) accessibility.
For the record, and without objection, Mayor Dunton and Mayor Pro Tem Santa Ines requested that staff look into utilizing PEG funding for upgrades to the William and Jane Bristol Civic Auditorium.
Following brief discussion, at the request of Mayor Pro Tem Santa Ines, 1) City Manager Smoot confirmed that the Bank of the West is a potential location for the new public safety building; and 2) Finance Manager Garan confirmed that the current public safety substation rent payments have been unclaimed, clarifying that an amount of $180,679 was escheated in February 2024, and an additional $54,855 may possibly be escheated in May 2025.
Bellflower City Council Special Meeting Minutes Item No. 4-A April 29, 2025 Page 8 of 8
4 BUDGET STUDY SESSION – Continued
A Consideration and possible action to conduct a City Council Study Session concerning 2025-2027 Proposed Budget – Continued
For the record, and without objection, Mayor Pro Tem Santa Ines suggested transferring the escheated amount related to the unclaimed substation rent checks to the General Fund Capital Projects Fund (Account No. 011-39000) to fund the future Public Safety Facility Project (Account No. 011-53607-9000).
For the record, Council Member Sanchez 1) left the dais and Council Chambers at 7:04 p.m.; and 2) returned to the Council Chambers and dais at 7:05 p.m.
Relative to the City Hall Restroom Remodel, Council Member Morse suggested installing higher toilets for accessibility.
Relative to the Bellflower Boulevard Lighting Replacement Project, 1) Mayor Dunton expressed the opinion that the City should program the funds in Fiscal Year 2025-26 instead of Fiscal Year 2027-28; and 2) Mayor Pro Tem Santa Ines asked if the Public Works Department has sufficient staff to complete the project in Fiscal Year 2025-26, and if so, agreed that the funds should be programmed in Fiscal Year 2025-26.
For the record, it was the consensus of the City Council to transfer the Bellflower Boulevard Lighting Replacement Project (Account No. 011-53803- 9000) funds in the amount of $100,000 from Fiscal Year 2027-28 to Fiscal Year 2025-26.
Following discussion, and without objection, Mayor Santa Ines requested that Finance Manager Garan provide a list of the proposed changes to the 2025-2027 Proposed Budget to the City Council for review and consideration prior to May 6, 2025.
For the record, there was no formal action taken on this item.
5 ADJOURNMENT
Without objection, Mayor Dunton adjourned the meeting at 7:25 p.m.
ATTEST:
_______________________________
Ray Dunton, Mayor Mayra Ochiqui, City Clerk
City of Bellflower Approved: May 12, 2025
15-E
TO: Honorable Mayor and Members of the City Council
ATTENTION: Ryan Smoot, City Manager
FROM: Mayra Ochiqui, City Clerk
SUBJECT: Consideration and possible action to approve the appointment of the Chamber of Commerce’s nominee Jennifer Beech to the
Southeast Los Angeles County Workforce Development Board (“SELACO WDB”) for the term July 1, 2025, to June 30, 2027.
DATE: May 12, 2025
EXECUTIVE SUMMARY
The recommended action will approve the appointment of the Chamber of Commerce’s nominee Jennifer Beech to the SELACO WDB Board of Directors for the term July 1, 2025, to June 30, 2027.
RECOMMENDATION TO CITY COUNCIL
1) Approve the appointment of Jennifer Beech to the SELACO WDB Board of Directors for the term ending June 30, 2027; or
2) Alternatively, discuss and take other action related to this item.
FISCAL IMPACT
SELACO WDB Directors representing the private sector receive $75 for each meeting attended, up to a maximum of $75 per month per Resolution No. 19-39 adopted May 28, 2019. Funds are budgeted in Account No. 010-41210-1000.
BACKGROUND
Each of the eight participating cities appoints two Directors to represent the private sector on the Southeast Los Angeles County Workforce Development Board (SELACO WDB) Board of Directors. These Directors serve staggered, two-year terms and meet bi-monthly.
1 o“ 01: BELLFLO
“ s a
"o ROWING TOGETk‘YFS t f t
Staff Report – SELACO WDB Director Appointment
May 12, 2025
BACKGROUND – Continued
Directors representing the private sector must be nominated by local business organizations and business trade associations (i.e., the Chamber of Commerce) and must be representatives of business in the local area who:
1) are owners of businesses, chief executives or operating officers of businesses, and other business executives or employers with optimum policy-making or hiring authority; and
2) represent businesses with employment opportunities that reflect the employment opportunities of the local area.
Bellflower’s current representatives are Aaron Drake and Larry Wehage. Aaron Drake’s term expires on June 30, 2025. The Directors of the Chamber of Commerce have requested that Jennifer Beech be appointed to serve as one of Bellflower’s Directors representing the private sector on the SELACO WDB for the term ending June 30, 2027.
ATTACHMENT
Chamber of Commerce Nomination Letter ...................................................................... 3
2 3
May 2nd, 2025
Ms. Mayra Ochiqui
City Clerk
City of Bellflower
' 16600 Civic Center Drive
Bellflower, CA 90706
Dear Ms. Ochiqui
. The Bellflower Chamber of Commerce would like to request, by the approval of our Board of Directors that action be taken by the Bellflower City Council at the next regular council meeting to approve our nomination for Bellflower Chamber of Commerce Ambassador Jennifer Beech to Serve on the Southeast Los Angeles Workforce Investment Board, immediately for the term starting July 15*, 2025 and ending June 30th, 2027.
If you have any questions, please feel free to contact me at the Chamber office at [email protected].
Sincerely,
WWW a
Michele Moore
Chamber Manager
""‘ilflowér Chamber of Commerce ' , [email protected] 16 p:Be-fllfloWef Blvd, Suite A Bellflower, CA 90706 www.beilflowerchamberorg
15-F
TO: Honorable Mayor and Members of the City Council
ATTENTION: Ryan Smoot, City Manager
FROM: Len Gorecki, Assistant City Manager/Director of Public Works Sarah Ho, Public Works Manager
SUBJECT: Consideration and possible action to adopt Resolution No. 25-16 – A Resolution approving the Amended and Restated Joint Exercise of Powers Agreement for the Los Angeles Gateway Region
Integrated Regional Water Management Authority.
Date: May 12, 2025
EXECUTIVE SUMMARY
The Los Angeles Gateway Region Integrated Regional Water Management Joint Powers Authority (“GWMA”) was established in 2007 by a Joint Powers Authority Agreement (“JPA”). GWMA was formed to address the state’s efforts that encouraged and prioritized regional, multi-party, and/or multi-benefit projects for competitive funding. Because GWMA’s membership and responsibilities have grown and evolved since its inception, the JPA Agreement is now being amended to best reflect current and anticipated activities, roles, and responsibilities.
RECOMMENDATION TO CITY COUNCIL
1) Adopt Resolution No. 25-16, authorizing the City Manager to sign the Amended and Restated Joint Exercise of Powers Agreement for the Gateway Region Integrated Regional Water Management Joint Powers Authority (Agreement File No. 523); or
2) Alternatively, discuss and take other action related to this item.
FISCAL IMPACT
Funding for membership in GWMA ($15,000 per year) is included in the Public Works Maintenance and Operations Budget for FY2024-25 under Account No. 320-41200-6020 (Measure W – Safe Clean Water Program Funds).
DISCUSSION
The Gateway Water Management Authority was formed in 2007 to address water supply reliability, water quality, stormwater, and flood control in the Gateway Region of Los Angeles County.
F BELLF
{vi 0 LOVVEQ
% Stmieport
1 Staff Report – AFN 523
May 12, 2025
DISCUSSION – Continued
With a population of more than 2 million people, GWMA members have successfully worked together to develop regional projects, and seek and receive local, state and/or federal funds to support those projects.
GWMA members are made up of Gateway cities and water agencies that represent distinctive hydrogeological, topographic, demographic, political, and economic elements.
Membership in the GWMA has proven to successfully communicate the Gateway region’s needs with a single voice increasing opportunities for project and funding partners.
Since its inception, GWMA’s membership has increased and GWMA’s role has evolved significantly. Currently, membership has grown to 28 cities and water agencies. With that growth, GWMA has been able to respond to the changing water conditions and challenges in Southern California. In addition to developing regional projects and seeking grant funds to support them, GWMA continues its critical role as part of the Greater Los Angeles County Integrated Regional Water Management ensuring that the Gateway region’s voice is always heard. Further, GWMA’s added role since 2012 has been to facilitate and administratively support watershed stormwater compliance programs under the MS4 Permit for the Lower Los Angeles River, Lower San Gabriel River, Los Cerritos Channel and several other regional groups of cities working together to comply with the MS4 Permit for monitoring/reporting harbor stormwater flows.
In 2024, GWMA staff and legal counsel provided several updates regarding the proposed modifications to the JPA Agreement. These changes include: board member terms and allowing for up to three alternates; updating the list of members cities/agencies; def ining a super-majority vote for certain board actions; and no longer requiring a lead agency to be appointed to conduct the financial/contractual affairs of GWMA (which have been done in-house since 2014).
On January 14, 2025, Public Works staff received the draft Amended and Restated JPA Agreement for review and comment. Legal Counsel was also requested to review the document. Comments were due to GWMA staff by March 14, 2025. On April 10 th, GWMA staff presented the revised draft agreement to the GWMA Board, showing the incorporated members’ comments to the JPA Agreement. After discussion, the GWMA Board approved the Amended and Restated JPA Agreement by a super-majority vote which is presented herein.
There is no change to the annual dues which will continue to be assessed and approved by a super-majority vote of the GWMA Board in order to support the on -going work of the GWMA.
ATTACHMENT
Resolution No. 25-16....................................................................................................... 3 2
CITY OF BELLFLOWER
RESOLUTION NO. 25-16
A RESOLUTION APPROVING THE AMENDED AND RESTATED JOINT
EXERCISE OF POWERS AGREEMENT FOR THE LOS ANGELES GATEWAY
REGION INTEGRATED REGIONAL WATER MANAGEMENT AUTHORITY
THE CITY COUNCIL RESOLVES AS FOLLOWS:
SECTION 1. Recitals. The City Council finds and declares as follows:
A. The City of Bellflower (the “City”) is a “local agency,” as defined in the Integrated Regional Water Management Planning Act, California Water Code Section 10530, et seq. (“IRWMPA”); and
B. The City is a permittee under the “Waste Discharge Requirements and National Pollutant Discharge Elimination System (“NPDES”) Permit for Municipal Separate Storm Sewer System (“MS4”) Discharges within the Coastal Watersheds of Los Angeles and Ventura Counties,” NPDES Permit No. CAS004004 (“MS4 Permit”), as amended from time to time by the California Regional Water Quality Control Board, Los Angeles Region.
C. The City is a “public agency,” as defined in the Joint Exercise of Powers Act, California Government Code Section 6500, et seq., and is authorized to enter into an agreement to exercise powers common to the member public agencies.
D. The Los Angeles Gateway Region Integrated Regional Water Management Authority (“GWMA”) was established to operate as a “regional water management group,” as defined in and authorized by the IRWMPA, in order to (a) implement a regional water resources management plan that will protect and enhance regional water supplies, and to otherwise further the purposes of the IRWMPA, with respect to the Gateway Region and (b) perform other regional responsibilities for water development and management.
E. Through the GWMA, participating agencies also cooperate with each other to implement certain portions of the Watershed Management Programs and Coordinated Integrated Monitoring Programs, as those programs are described in the MS4 Permit, and to perform such other responsibilities for water quality.
F. On April 10, 2025, the GWMA Board adopted, by a super-majority vote, a proposed amendment to the GWMA’s Joint Exercise of Powers Agreement (the “Amended and Restated Agreement”) to, among other things, update the purposes of the GWMA relating to the MS4 Permit and to make other changes intended to modernize the governance of the GWMA. 3 City of Bellflower
Resolution No. 25-16
G. The proposed Amended and Restated Agreement will take effect upon adoption by a super-majority of the legislative bodies of the GWMA’s members.
H. The City Council desires to continue participating in the GWMA and to adopt the Amended and Restated Agreement.
I. This Resolution is adopted based upon the evidence submitted during the May 12, 2025, City Council meeting including, without limitation, all documents presented to the City Council and public testimony.
SECTION 2. Action. The City Council approves the “Amended and Restated Joint Exercise of Powers Agreement” for the Los Angeles Gateway Region Integrated Regional Water Management Authority,” attached as Exhibit “A” and incorporated by reference.
SECTION 3. Other Actions Authorized. The City Manager, and designees, are authorized to take all action necessary or reasonably required to carry out, give effect to this Resolution and the City Clerk is directed to transmit certified copies of this Resolution and Agreement to representatives of GWMA.
SECTION 4. Preservation. This resolution does not affect any penalty, forfeiture, or liability incurred before, or preclude prosecution and imposition of penalties for any violation occurring before, this Resolution’s effective date. Any such amended part will remain in full force and effect for sustaining action or prosecuting violations occurring before the effective date of this Resolution.
SECTION 5. Limitations. The City Council’s analysis and evaluation of the project is based on the best information currently available. It is inevitable that in evaluating a project that absolute and perfect knowledge of all possible aspects of the project will not exist. One of the major limitations on analysis of the project is the City Council’s lack of knowledge of future events. In all instances, best efforts were made to form accurate assumptions. Somewhat related to this are the limitations on the City's ability to solve what are in effect regional, state, and national problems and issues. The City must work within the political framework within which it exists and with the limitations inherent in that framework.
SECTION 6. Reliance On Record. Each and every one of the findings and determinations in this Resolution are based on the competent and substantial evidence, both oral and written, contained in the entire record relating to the project. The findings and determinations constitute the independent f indings and determinations of the City Council in all respects and are fully and completely supported by substantial evidence in the record as a whole.
SECTION 7. Summaries of Information. All summaries of information in the findings, which precede this section, are based on the substantial evidence in the record.
The absence of any particular fact from any such summary is not an indication that a particular finding is not based in part on that fact.
4 City of Bellflower
Resolution No. 25-16
SECTION 8. Construction. This Resolution must be broadly construed to achieve the purposes stated in this Resolution. It is the City Council’s intent that the provisions of this Resolution be interpreted or implemented by the City and others in a manner that facilitates the purposes set forth in this Resolution.
SECTION 9. Severability. If any part of this Resolution or its Application is deemed invalid by a court of competent jurisdiction, the City Council intends that such invalidity will not affect the effectiveness of the remaining provisions or applications and, to this end, the provisions of this Resolution are severable.
SECTION 10. Electronic Signatures. This Resolution may be executed with electronic signatures in accordance with Government Code §16.5. Such electronic signatures will be treated in all respects as having the same effect as an original signature.
SECTION 11. Effective Date. This Resolution will become effective immediately upon adoption and will remain effective unless repealed or superseded.
SECTION 12. The Mayor, or presiding officer, is authorized to affix their signature to this Resolution signifying its adoption by the City Council of the City of Bellflower, and the City Clerk, or her duly appointed deputy, is directed to attest .
PASSED, APPROVED, AND ADOPTED BY THE CITY COUNCIL OF THE CITY OF BELLFLOWER THIS 12TH DAY OF MAY 2025.
________________________________
Ray Dunton, Mayor
ATTEST:
________________________________
Mayra Ochiqui, City Clerk
APPROVED AS TO FORM:
Karl H. Berger, City Attorney
_______________________________________
By: Justin A. Tamayo, Assistant City Attorney
ATTACHMENT:
Exhibit A – Amended and Restated Joint Exercise of Powers Agreement 5 12664-0001\3009909v6.doc
AMENDED AND RESTATED JOINT EXERCISE OF POWERS AGREEMENT FOR
THE LOS ANGELES GATEWAY REGION INTEGRATED REGIONAL WATER
MANAGEMENT AUTHORITY
THIS AMENDED AND RESTATED JOINT EXERCISE OF POWERS
AGREEMENT (“Agreement”), dated for reference as of April 10, 2025, is entered into by and between the Cities of Artesia, Bell, Bell Gardens, Bellflower, Cerritos, Commerce, Compton, Cudahy, Downey, Hawaiian Gardens, Huntington Park, La Mirada, Lakewood, Long Beach, Lynwood, Maywood, Montebello, Norwalk, Paramount, Pico Rivera, Santa Fe Springs, Signal Hill, South Gate, Vernon, and Whittier, the Central Basin Municipal Wa ter District, the Long Beach Public Utilities Department (acting through its Board of Public Utilities Commissioners), and the Water Replenishment District of Southern California, all of which are public agencies and/or municipal corporations. Each of the foregoing are sometimes referred to herein as “Member”, or collectively as “Members.”
RECITALS
(i) In 2007, the cities of Cerritos, Downey, Lakewood, Long Beach, Norwalk, Paramount, Santa Fe Springs, Signal Hill, and South Gate initially entered into a Joint Exercise of Powers Agreement (“Original Agreement”) and created the Los Angeles Gateway Region Integrated Regional Water Management Authority (“GWMA”). Since its creation, additional Members, as listed above in the preamble, have been added to the GWMA pursuant to the provisions of the Original Agreement.
(ii) Each Member is a “public agency,” as defined in the Joint Exercise of Powers Act, California Government Code Section 6500, et seq., and all are authorized to enter into this Agreement in order to exercise powers common to these public agencies. (iii) This Agreement creates a public entity, separate from its Members, that is capable of carrying out the purposes of this Agreeme nt.
(iv) Each Member is a “local agency,” as defined in the Integrated Regional Water Management Planning Act, California Water Code Section 10530, et seq. (“IRWMPA”). As of the effective date of this Agreement, all Members function within the County of Los Angeles. (v) It remains the intent of the Members in entering into this Agreement to operate as a “regional water management group,” as defined in and authorized by the IRWMPA, in order to (a) implement a regional water resources management plan that will protect and enhance regional water supplies, and to otherwise further the purposes of the IRWMPA, with respect to the Members’ jurisdictional areas (collectively, “Gateway Region”) and (b) perform other regional responsibilities for water development and management, as described herein. (vi) All of the cities which are Members are permittees under the “Waste Discharge Requirements and National Pollutant Discharge Elimination System (NPDES) Permit for Municipal Separate Storm Sewer System (MS4) Discharges within the Coastal Watersheds of Los Angeles and Ventura Count ies,” NPDES Permit No. CAS004004 (“MS4 Permit”), as amended from time to time by the California Regional Water Quality Control Board, Los Angeles Region.
6 12664-0001\3009909v6.doc
(vii) The Members desire to amend and restate the Original Agreement in order to further state their intent to cooperate with each other to implement certain portions of the Watershed Management Programs and Coordinated Integrated Monitoring Programs, as those programs are described in the MS4 Permit, and to perform such other responsibilities for wate r quality, as described herein.
(viii) The Members acknowledge that the GWMA may contract and cooperate with other regional water management groups and agencies to develop, administer, update, and implement, an Integrated Water Management Plan for the Greater Los Angeles County area.
AGREEMENT
NOW, THEREFORE, in consideration of the promises, terms, conditions and covenants contained herein, the parties agree as follows:
1. Recitals Incorporated. The recitals set forth above, are hereby incorporated by reference and made a part of this Agreement.
2. Purposes. This Agreement is made pursuant to the provisions of the Joint Exercise of Powers Act, relating to the exercise of powers common to the Members. The purpose of this Agreement is to jointly exercise the powers set forth herein as to the Gateway Region, and , acting as a “regional water management group,” to jointly prepare, contract for the preparation and implementation of, and/or adopt a “regional plan” for the management of water resources, and for implementation and operation of “qualified projects or programs,” and/or the preparation of “qualified reports and studies,” as those quoted terms are defined in the IRWMPA. In accordance with the IRWMPA, the regional water resources management plan may more specifically address any of the matters set forth and more fully described in California Water Code Section 10540(c) including, but not limited to, the following: ground water management planning; urban water management planning; the preparation of a water supply assessment; the planning, construction or modification of a flood management project; the planning, construction or modification of a water recycling project; the planning, construction or modification of a domestic water supply facility to meet safe drinking water standards; the planning, construction or modification of a drainage water management unit, and/or the implementation of a water conservation program. In addition, the purpose of this Agreement is to implement and from time to time revise certain portions of the Watershed Management Programs and Coordinated Integrated Monitoring Programs, as those programs are described in the MS4 Permit, that have been developed by the Members and to perform such other responsibilities to promote water qua lity within the Gateway Region. Notwithstanding the citation of specific legal authority for the foregoing, the Authority may exercise any other statutory authority which may now exist or be subsequently enacted to deal with ground water, storm water, water recharge, water recycling, water supply, water storage, water treatment, water drainage, water conservation or any related urban water management subject within the purview of local or regional water agencies and MS4 operators.
3. Establishment. Pursuant to the Joint Exercise of Powers Act, the Original Agreement established a Joint Powers Authority which is a regional water management group and a public entity separate from the parties to this Agreement. The name of the entity is the “Los Angeles Gateway Region Integrated Regional Water Management Authority ” and may be referred to as the “Gateway Water Management Authority .” The GWMA shall carry out its functions through a Governing Board, as described in this Agreement. 7 12664-0001\3009909v6.doc
4. Term of Agreement. This amended and restated Agreement is effective as of the latest date by which a super-majority of the Members, acting through their legislative bodies, adopt resolutions approving this amended and restated Agreement and thereafter having executed this Agreement, and shall continue in full force and effect for so long as no less than three (3) such Members remain, or until terminated by unanimous consent, provided that all liabilities of the GWMA have been satisfied and all assets of the GWMA have been distributed. A super- majority for purposes of this Section 4 shall mean the affirmative vote of two-thirds (2/3) of the Members.
5. Restriction on Exercise of Powers. Pursuant to and to the extent required by California Government Code Section 6509, the GWMA shall be restricted in the exercise of its powers to the same extent as the City of Long Beach is restricted in its exercise of powers hereunder; provided that, if the City of Long Beach ceases to be a Member, then the GWMA shall be restricted in its exercise of powers to the same extent as the City of Downey is restricted in its exercise of powers hereunder; in that the aforesaid cities are charter cities with statutory authority over a water supply.
6. Governing Board. The governing body of the GWMA is the Governing Board which is comprised of one representative from each Member, but such representative need not be a member of the legislative body of such public agency if approved by resolution of the legislative body of the Member. The Governing Board shall oversee the activities of the GWMA and shall act consistent with and in furtherance of the purposes of this Agreement and the GWMA. (a) Appointment. The legislative body of each of the Member shall appoint one member of the Governing Board and may appoint up to three alternate Board members. If neither the Governing Board member nor the Member’s alternate(s) can attend a scheduled meeting, one time per year the chief executive (e.g., city manager) or the assistant chief executive of such Member may designate in writing a representative for that meeting who may attend and participate in that meeting as if he or she was a Governing Board member.
(b) Term of Members. Each member and alternate member of the Governing Board serves until removed by the applicable Member’s legislative body. Board members and alternates may be removed at any time by the appointing Member’s legislative body. Vacancies shall be filled in the same manner as the original appointment. (c) Compensation. Governing Board members receive no compensation for attending required meetings.
(d) Voting. Each Governing Board member shall have one (1) vote. If a Board member cannot attend a meeting, the alternate attending shall be fully empowered to act as the Governing Board member for the meeting so attended. Actions taken by the Governing Board shall require a majority or super-majority vote as provided below in Section (e). (e) Quorum. A majority of the Governing Board must be present to constitute a quorum. No action will be valid unless it has received the affirmative vote of the majority of those Governing Board members present, except where a super-majority vote is specified. Where a super-majority vote is specified herein, it shall mean the affirmative vote of two-thirds (2/3) of the Governing Board members present.
(f) Responsibilities. The Governing Board will:
8 12664-0001\3009909v6.doc
(1) Determine general policy for GWMA activities.
(2) Act on behalf of all Members in adopting strategies to pursue the purposes of the GWMA and implement such strategies.
(3) Approve a budget to expend funds necessary to exercise the powers and achieve the purposes of the GWMA, as set forth in this Agreement, and as otherwise provided by law. A super -majority vote shall be required to adopt a budget or assess the contribution of costs or to purchase or long -term lease any real property. (4) Ensure that projects and programs that are undertaken are in the best interest of the residents served by the GWMA.
(5) Authorize expenditures of funds in accordance with budget and any purchasing procedures adopted by the Governing Board.
(6) Share costs equally among the Members, except as otherwise provided herein.
(7) Approve or deny applications from local public agencies for admission to the GWMA or expel a member from the GWMA.
(8) Adopt by-laws, rules and regulations governing operations of the GWMA.
(9) Appoint such ad hoc or standing committees of its Members as it may deem appropriate, all in uniformity with the Ralph M. Brown Act (Sections 54950 et seq.). (g) Meetings. The Governing Board shall conduct regular and special meetings in accordance with the Ralph M. Brown Act, commencing with California Government Code Section 54950, or any successor provision thereto. It shall hold at least one (1) regular meeting in each year and such additional meetings as may be necessary to accomplish the purposes sp ecified herein. Regular meetings shall be held at such location as the Governing Board may determine by Resolution. Minutes shall be kept of all meetings of the GWMA and shall be provided to the Members and made available to the public. Meetings shall be conducted in accordance with rules of procedure adopted by the Governing Board (the most current edition of “Roberts Rules of Order” as of the effective date of this Agreement).
Except as specifically provided elsewhere in this Agreement, any rule of procedure affecting the order of business may be suspended with the approval of a majority of Board members then voting.
7. Organization.
(a) Officers. The Governing Board shall elect a chair, a vice-chair, treasurer and/or such other officers as the Board shall find appropriate. The Governing Board shall also appoint a secretary, who need not be a member of the Governing Board. Each officer shall serve at the pleasure of the Governing Board. Upon approval by the Governing Board, all contracts, deeds and other official documents on behalf of the GWMA shall be executed by the Chair or the Executive Officer, and attested to by the Secretary and approved as to form by GWMA’s legal counsel or other appropriate officer.
9 12664-0001\3009909v6.doc
(b) Employees. The Governing Board may appoint an Executive Officer, controller, clerk, legal counsel or other employees as it deems appropriate and may establish the duties and compensation of such employees. The Governing Board may choose to utilize the services of employees of the Members by appointing a Lead Agency, as described below, and, if required, compensate the Member accordingly, or may directly appoint and employ its own staff.
If the GWMA directly employs employees, the Governing Board shall adopt a personnel system establishing rules and regulations comparable to the public sector generally. (c) Finances. The Governing Board shall appoint a qualified person to act as the Auditor, who need not be a member of the Governing Board. GWMA shall cause an independent annual audit of the GWMA’s finances to be made by a certified public accountant in compliance with California Government Code Section 6505. The Treasurer of the GWMA shall be the depositor and shall have custody of all money of the GWMA received from whatever source. The Auditor of the GWMA shall draw warrants to pay demands against the GWMA when the demands have been approved by the GWMA by its authorized representative pursuant to any delegation of authority by the GWMA. The Treasurer and Auditor shall comply strictly with the provisions of statutes relating to their duties, as set forth in the Joint Exercise of Powers Act. The Governing Board may transfer the responsibilities of Treasurer and/or Auditor to any person or entity as may then be authorized by law.
(d) Consultants. The GWMA is authorized to enter into contracts and pay consultants pursuant to the GWMA’s purchasing procedure to perform any work or activity it is empowered to perform hereunder, including the provision of professional, financial, legal, administrative, technical or other services. A consultant may be designated as an officer, including the Executive Officer, of the GWMA.
(e) Lead Agency. The Governing Board may, but is not required to, select from the Members, a Lead Agency for the GWMA. In such case, the Director of Finance of the Lead Agency shall be and act as the Treasurer and Auditor of the GWMA, pursuant to California Government Code Section 6505.6. Pursuant to California Government Code Section 6505.1, the Secretary and Treasurer shall have charge of the property of the GWMA and each shall file an official bond in the penal sum of Ten Thousand Dollars ($10,000.00) or such additional amount as the Governing Board may establish. If a lead agency is selected, by majority vote the Governing Board may change the Lead Agency at any time. In such event, the officers of the new Lead Agency shall serve as the respective officers of the GWMA. (f) Property of the GWMA . Pursuant to California Government Code Section 6505.6, the Governing Board may designate an officer or employee, or officers and employees, in addition to the Treasurer, to receive, deposit, invest, and disburse the money of the GWMA pursuant to California Government Code Sections 6505.5 and 6509.5. The Governing Board shall fix the amount of the official bond to be filed by each such designee.
8. Powers and Functions as a Regional Water Management Entity. Subject to the limitations set forth herein, the GWMA, acting through its Governing Board, shall have any and all powers commonly held by the Members, necessary or appropriate to fulfill the purposes set forth in Section 2, above, and to implement the agreed upon provisions of the MS4 Permit on behalf of the Members and to otherwise perform the functions and exercise the powers of a regional water management group pursuant to applicable law. 10 12664-0001\3009909v6.doc
9. Corporate and Political Powers. For purposes of exercising its authority, and subject to the limitations set forth herein, the GWMA shall have all joint powers specified in California Government Code Section 6508 including, but not limited to, any or all of the following:
(a) To exercise the common powers of its Members;
(b) To make and enter into contracts;
(c) To employ agents and employees;
(d) To acquire, construct, manage, maintain or operate any building, structure, work or improvement;
(e) To acquire, hold or dispose of real or personal property; (f) To incur debts, liabilities and obligations and issue bonds, notes, certificates of participation and other forms or evidence of indebtedness; (g) To sue and be sued in its own name;
(h) To apply for, accept, receive and disburse grants, loans and other financial aid from any agency of the State of California or the United States of America and to receive donations of property, funds, services and other forms of assistance from persons, firms, corporations or governmental entities;
(i) To obtain insurance for the GWMA and contract for risk management services;
(j) To invest money of the GWMA in the same manner and on the same conditions as local agencies pursuant to California Government Code Section 53601; (k) To prepare and support legislation related to the purposes of this Agreement;
(l) To adopt rules, regulations, policies, bylaws and procedures for the carrying out of the foregoing powers or necessary for the governing of the operations of the GWMA; and (m) To exercise all other powers necessary and proper to carry out the provisions of this Agreement.
10. Limitations. The GWMA shall not have the power of eminent domain.
11. Expenditures and Contributions. From time to time, the Governing Board may require Member contributions in order to make expenditures necessary to carry out the purposes and functions of the GWMA which may include, but are not limited to, retention of consultant(s) to conduct studies and prepare plans, reports and designs, and/or provide management services. Contracts over $100,000 shall require a super -majority vote of the Governing Board to approve . Contributions may be assessed against Members on an equ al basis, or upon such other basis as may be determined by the Governing Board. Within thirty (30) days of such an assessment by the Governing Board becoming effective, each Member, 11 12664-0001\3009909v6.doc
shall make the requ ired contribution, provided that any Member not wishing to make such contribution may, in the alternative, withdraw from the GWMA within said period by adopting a resolution of withdrawal by its legislative body and otherwise complying with Section 15 .
12. Eligibility for Membership and Admission. Any local public agency that is a member of the Gateway Cities Council of Governments, or that has statutory authority over a water supply with the Gateway Cities Region, may apply to become a member of the GWMA pursuant to an action taken by the legislative body of such public agency and may become a Member upon a super -majority vote of the Governing Board and execution of this Agreement . At the time of approval of admission, the Governing Board may request that the new Member make a payment of any costs incurred by the GWMA to date, to the extent the benefit of those costs will be derived or will continue to be derived after the new Member agency has joined the GWMA .
13. Accounts, Reports, and Audits. The following procedures shall be followed to ensure strict accountability of all funds of the GWMA and to provide for accurate reporting of receipts and disbursements of said funds:
(a) The Auditor shall either prepare or contract with a certified public accountant to prepare an annual audit of the GWMA’s accounts and records. The minimum requirements for such audits shall be those prescribed by the State Controller for special districts under California Government Code Section 26909 or successor statute and shall conform to generally accepted accounting principles.
(b) A report of said audit shall be filed as a public record with each Member and with the County Auditor of the County of Los Angeles. Such report shall be filed within twelve (12) months of the end of the fiscal year or years under examination. (c) Any additional procedures pertaining to accountability of funds and assets of the GWMA, as specified in the Joint Exercise of Powers Act, shall be followed.
14. Obligation for Debts and Liabilities and Distribution of Assets. Except as otherwise provided herein or by applicable law , no Member shall be individually responsible for any of the debts, liabilities or obligations of the GWMA, and all such debts, liabilities and obligations shall exclusively be those of the GWMA.
(a) Indemnification.
(1) Each Member agrees to indemnify, defend and hold the GWMA and all other Members, and employees, officers and agents of the GWMA, free and harmless with respect to any and all claims, liabilities, losses, and damages, including legal fees and expenses, to the extent arising out of or connected with the acts or omissions, or breach or default, of such Member, or any person or entity acting on behalf of such Member, in the performance of any of its obligations under this Agreement. (2) The GWMA shall indemnify, defend, and hold harmless, jointly and severally, each of its Members and the Members’ officers, officials, employees, agents, and representatives with respect to any loss, damage, injury, claim, litigation, o r liability, including attorney’s fees and costs, arising out of or in any way related to the creation , 12 12664-0001\3009909v6.doc
operation, functioning, decisions, or actions of the GWMA or the GWMA’s officers, officials, employees, agents, or representatives.
(3) The provision of indemnity set forth in this Section shall not be construed to obligate the GWMA to pay any liability, including but not limited to punitive damages, which by law would be contrary to public policy or otherwise unlawful. (b) Tort Liability. Government Code Section 895.2 imposes certain tort liability jointly upon public agencies solely by reason of such public agencies being parties to an agreement as defined in Government Code Section 895. Therefore, the Member public agencies, as among the mselves, pursuant to the authorization contained in Government Code Sections 895.4 and 895.6, each assume the full liability imposed upon it or any of its officers, agents, employees or representatives by law for injury caused by a negligent or wrongful action or inaction, or omission, occurring in the performance of this Agreement, to the same extent that such liability would be imposed in the absence of Government Code Section 895.2. To achieve this purpose, each Member public agency indemn ifies and holds harmless each other party and the GWMA, for any loss, cost or expense, including reasonable attorney ’s fees and consultant fees that may be imposed upon or incurred by such other Member public agency or the GWMA solely by virtue of Governme nt Code Section 895.2. (c) Funds for Defense. Notwithstanding the provisions of paragraphs (a) or (b), above, by a super -majority vote of the Governing Board, the Board may approve the expenditure of GWMA funds to defend, indemnify and hold the GWMA, members of the Governing Board, and/or any employee or agent of the GWMA, free and harmless from claims and liabilities arising in connection with their actions taken in good faith, and while within the scope of their duties being performed on behalf of the GWMA. (d) Self-Insure. The GWMA may self-insure or purchase insurance, and/or-, require the Members to self-insure or purchase insurance, in order to comply with any of the defense and indemnity requirements herein.
(e) Privileges and Immunities. All of the privileges and immunities from liability, exemptions from laws, ordinances, and rules, all pension, relief, disability, worker’s compensation, and other benefits which apply to the activity of officers, agents, or employees of any Member when performing their respective functions within the territorial limits of the Member, shall apply to them to the same degree and extent while engaged in the performance on any of their functions and duties extraterritorially hereunder.
15. Withdrawal by a Member. Subject to the provisions of this section, any Member may withdraw from the GWMA by providing the Governing Board no less than thirty (30) days prior written notice including a copy of the initiating resolution by the legislative body of the withdrawing Member. The withdrawing Member shall pay all unpaid contributions that were approved by the Governing Board more than one hundred twenty (120) days prior to the date of the notice of withdrawal. No Member may withdraw unless and until it has satisfied any a nd all outstanding contractual obligations, or other indebtedness for which such Member would otherwise be obligated, in whole or in part, to pay. “Outstanding contractual obligations” includes the obligations for payments on contracts which the GWMA has entered into and are legally binding but where additional services will be performed in the future, until the contract has been fully performed.
13 12664-0001\3009909v6.doc
16. Effect of Termination. Upon termination of this Agreement by the GWMA, all of the existing assets shall be divided and distributed for public purposes in such manner as shall be determined by a super-majority vote of the Governing Board provided, however, that this Agreement and the Governing Board shall continue to exist for the purposes of disposing of all claims, administering the distribution of assets, and performing any other functions necessary to conclude the affairs of the GWMA. This Agreement may not be terminated so long as the GWMA has any outstanding contractual obligations or other indebtedness.
17. Notices. Notices permitted or required to be sent pursuant to this Agreement shall be sent by registered mail, return receipt requested, or reputable overnight delivery service, addressed as follows:
To Member public agencies at each Member public agency’s official business address, personally addressed to that agency’s Governing Board member;
To the GWMA at 16401 Paramount Boulevard, Paramount,
California 90723. This address shall be the GWMA’s official business address. This address may be changed by approval of the Governing Board and the giving of written notice to each Member at their official business address.
18. Amendment. Except for amendments that change the GWMA’s powers, duties, indemnification requirements, or financial responsibilities, this Agreement may be amended by a super-majority vote of the Governing Board. Otherwise, this Agreement may be amended by a majority vote of the Governing Board and by a majority vote of the Members acting by resolution of their legislative bodies.
19. Legal Actions.
(a) Remedies. The GWMA is hereby authorized to take any and all legal or equitable actions, including but not limited to, seeking an injunction and/or specific performance, necessary or permitted by law, to enforce this Agreement. (b) Applicable Law and Forum. The laws of the State of California shall govern the interpretation and enforcement of this Agreement, without regard to conflict of law principles. Legal actions must be instituted and maintained in the Superior Court of the County of Los Angeles, State of California, in any other appropriate court in that county, or in the Federal District Court in the Central District of California.
(c) Acceptance of Service of Process. In the event that any legal action is commenced against the GWMA, service of process on the GWMA shall be made by personal service upon the Executive Officer or Secretary of the GWMA, or in such other manner as may be provided by law.
(d) Waivers. All waivers of any term or condition of this Agreement shall be in writing. No waiver of any term or same term or condition at a different time.
20. Liberal Construction; Severability. In the event of any litigation over the meaning of this Agreement or the GWMA of any agency of the GWMA, this Agreement shall be 14 12664-0001\3009909v6.doc
liberally construed to effectuate its purposes. Should any part, term or provision of this Agreement be decided by any court of competent jurisdiction to be illegal or in conflict with any law of the State of California or federal law, or otherwise be rend ered unenforceable or invalid, the validity of the remaining portions and/or provisions shall not be affected thereby.
21. Conflicts of Interest. No officers, official, or employee of the GWMA shall have any financial interest, direct or indirect, in the GWMA nor shall any such person participate in any decision relating to the GWMA which affects his or her financial interests, in violation of any State law or regulation.
22. Books and Records. All books, records, accounts, and documents of the GWMA shall be available at any reasonable time to the Directors and, to the extent provided by the California Public Records Act (Government Code Section 7920.000, et seq.) shall be public records. This Section does not authorize the release of any confidential records which are exempt from disclosure under the California Public Records Act or other applicable law or regulations.
23. Principal Office. The principal office of the GWMA shall be that of the office of the Executive Officer or as from time to time designated by the Board.
24. Successors. This Agreement shall be binding upon all Members and shall inure to the benefit of the successors of each of the Members provided, however, that no Member may assign any right or obligation under this Agreement without the written consent of the Governing Board.
25. Effectuate Counterparts. This Agreement may be executed in counterparts, which together shall constitute the same and entire agreement.
26. Filing with Secretary of State. The Executive Of ficer of the Governing Board is directed to file with the office of the California Secretary of State and State Controller a notice of adoption or amendment of this Agreement within thirty (30) days after the effective date of such adoption or amendment, as required by California Government Code Section s 6503.5 and 6503.6 and shall file all other official notices as may be required by law.
27. Entire Agreement. This Agreement constitutes the final, complete and exclusive statement of the terms of the agreement between the parties pertaining to the subject matter of this Agreement and amends, replaces, and supersedes all other prior or contemporaneous oral or writ ten understandings and agreements of the parties . [SIGNATURES ON FOLLOWI NG PAGES]
15 12664-0001\3009909v6.doc
IN WITNESS WHEREOF, each of the parties hereto have caused this Agreement to be executed and attested by its duly authorized officers as of the dates set forth below.
(signature)
Name:
Title:
City/Agency Name:
ATTEST BY: APPROVED AS TO FORM BY:
(signature) (signature)
Name: Name:
Title: Title:
16 660? BELLFLOWQe
MIG“ tmI-eport 15-G
TO: Honorable Mayor and Members of the City Council
ATTENTION: Ryan Smoot, City Manager
FROM: Elizabeth C. Oba, Director of Planning and Building Services SUBJECT: Consideration and possible action to approve the 2025 Fireworks Permits.
DATE: May 12, 2025
EXECUTIVE SUMMARY
Bellflower Municipal Code (“BMC”) Chapter 8.16 regulates the use and sale of fireworks in the City. Chapter 8.16 establishes the procedure for obtaining a permit. Each year, a list of all qualified applicants is presented to the City Council for formal acceptance. ~Upon approval by the City Council, Fireworks Permits are issued.
RECOMMENDATION TO CITY COUNCIL
1) Approve 14 Fireworks Permits; and
2) Authorize the City Manager to execute the necessary approvals for the Bellflower Chamber of Commerce and Bellflower Kiwanis Club to operate on City owned property; or
3) Alternatively, discuss and take other action related to this item.
FISCAL IMPACT
All 14 applicants submitted the required fees of $106. 00 for the Fireworks Permit and $179. 00 for the Miscellaneous Permit, for a total of $285 00 ($3, 990. 00 for all 14 applicants). A $150.00 cash bond was also collected from each applicant, for a total of $2, 100. 00, to guarantee faithful performance of the terms and provisions of the BMC.
The deposit IS refundable upon expiration of the permit and removal of the stand, minus any actual costs incurred by the City as a result of a permittee's failure to perform. The total amount collected is $6,090.00. All fees were collected before April 1, 2025.
DISCUSSION
Per BMC Chapter 8.16, the process to apply for a Fireworks Permit is as follows:
. In December, an invitation letter from the City is mailed out to all previous Fireworks Permit Holders requesting they once again apply for a Fireworks Permit and submit a “Letter of Intent" to the City to apply for a permit. 0 Upon the City’s receipt of “Letters of Intent,” a list is generated of those who wish to obtain a Fireworks Permit. Pursuant to BMC Subsection 8.16.060(D), the maximum number of permits to be issued is 14.