Agenda, joint meeting — Cudahy City Council, October 20, 2026 (part 1 of 2)

Page 1 of 5 ends

AGENDA

A REGULAR MEETING

OF THE CUDAHY CITY COUNCIL
and JOINT MEETING of the
CITY OF CUDAHY AS SUCCESSOR AGENCY and HOUSING SUCCESSOR AGENCY

TO THE CUDAHY DEVELOPMENT COMMISSION
October 20, 2026 – 6:30 P.M.

Written materials distributed to the City Council within 72 hours of the City Council meeting shall be available for public inspection at www.cityofcudahyca.gov In compliance with the Americans with Disabilities Act (ADA) if you need special assistance to participate in this meeting, you should contact the City Clerk’s Office at (323) 773-5143 at least 72 hours in advance of the meeting.

Rules of Decorum
Under the Government Code, the City Council may regulate disruptive behavior that impedes the City Council Meeting.

Disruptive conduct may include, but is not limited to:
• Screaming or yelling during another audience member’s public comments period; • Profane language directed at individuals in the meeting room; • Throwing objects at other individuals in the meeting room; • Verbal altercations with other individuals in the meeting room; and • Going beyond the allotted three-minute public comment period granted.

When a person’s or group’s conduct disrupts the meeting, the Mayor or presiding officer will request that the person or group stop the disruptive behavior and WARN the person or group that they will be asked to leave the meeting room if the behavior continues.

If the person or group refuses to stop the disruptive behavior, the Mayor or presiding officer may order the person or group to leave the meeting room and may request that those persons be escorted from the meeting room. Any person who, without authority of law, willfully disturbs or breaks up a City Council meeting is guilty of a misdemeanor. (Pen. Code, § 403.)
Cynthia Gonzalez, Mayor
Daisy Lomelí, Vice Mayor
Elizabeth Alcantar Loza, Council Member
Martin U. Fuentes, Council Member
Amanda Gomez, Council Member
This meeting will be conducted in person,
telephonically, and electronically.

Council Chambers/Bedwell Hall
5240 Santa Ana Street
Cudahy, CA 90201
Teleconference Phone Number:
1 (669) 900-6833
Meeting ID: 818 6073 3782
https://us06web.zoom.us/j/81860733782
City of Cudahy
City Council and Successor Agency
Regular Meeting Agenda
October 20, 2026, at 6:30 P.M.

Page 2 of 5 ends

1. CALL TO ORDER

2. ROLL CALL
Council / Agency Member Alcantar Loza
Council / Agency Member Fuentes
Council / Agency Member Gomez
Vice Mayor / Vice Chair Lomelí
Mayor / Chair Gonzalez

3. APPROVAL OF AGENDA

4. PLEDGE OF ALLEGIANCE

5. LAND ACKNOWLEDGMENT
We would like to acknowledge that the land we inhabit today was once known as Tovangaar, the home of the Gabrieleño-Tongva people. We show our respects to the Gabrieleño-Tongva people, as well as all Indigenous people, past, present, and future, and honor their labor as original caretakers of this land. We commit to uplifting the Gabrieleño-Tongva people, invite you to acknowledge the history, and join us in caring for this land.

6. PRESENTATIONS
A. Presentation of Check from Assemblymember Pacheco
B. Cudahy Mercadito Certificate of Recognition
C. Los Angeles County Affordable Housing Solutions Agency (LACAHSA) + Gateway Cities Council of Governments (GCCOG) City Council Briefing

7. PUBLIC COMMENTS
(Each member of the public may provide a public comment in person, telephonically or electronically.

In person participants must submit one comment card if they wish to address the City Council. Only speakers that submit a comment card within the first 20 minutes of the meeting will be permitted to speak. Remote participants may provide public comment by clicking the hand icon on Zoom or pressing star (*) nine (9) on the telephone, if they wish to address the City Council. Members of the public are permitted to speak for three (3) minutes concerning items under the City Council’s jurisdiction, including items on the council agenda.)
(Any person who, without authority of law, willfully disturbs or breaks up a City Council meeting is guilty of a misdemeanor. (Pen. Code, § 403).)

8. CITY COUNCIL COMMENTS / REQUESTS FOR AGENDA ITEMS (Each Council Member is limited to three minutes.)
City of Cudahy
City Council and Successor Agency
Regular Meeting Agenda
October 20, 2026, at 6:30 P.M.

Page 3 of 5 ends

(This is the time for the City Council / Agency to comment on any topics related to “City Business,” including announcements, reflections on city / regional events, response to public comments, suggested discussion topics for future council meetings, general concerns about particular city matters, questions to the staff, and directives to the staff (subject to approval / consent of the City Council majority members present, regarding staff directives). Each Council / Agency Member will be allowed to speak for a period not to exceed three (3) minutes. Notwithstanding the foregoing, the City Council Members shall not use this comment period for serial discussions or debate between members on City business matters not properly agendized. The City Attorney shall be responsible for regulating this aspect of the proceeding.)

9. CITY MANAGER REPORT (information only)

10. REPORTS REGARDING AD HOC, ADVISORY, STANDING, OR OTHER COMMITTEE

MEETINGS

11. WAIVER OF FULL READING OF RESOLUTIONS AND ORDINANCES (Consideration to waive full text reading of all Resolutions and Ordinances by single motion made at the start of each meeting, subject to the ability of the City Council / Agency to read the full text of selected resolutions and ordinances when the item is addressed by subsequent motion.) (COUNCIL / AGENCY)
Recommendation: Approve the Waiver of Full Reading of Resolutions and Ordinances.

12. CONSENT CALENDAR
(Items under the Consent Calendar are considered routine and will be enacted by one motion, prior to the vote to approve the Consent Calendar, each Council Member shall have a maximum of three (3) minutes to comment on the Consent Calendar as a whole. There will be no separate discussion of these items unless a Council / Agency Member so requests specific item(s) be removed from the Consent Calendar for separate action. Items may only be considered as a separate action if either (1) a Council Member must recuse themselves due to a conflict of interest or (2) a Council Member has specific questions for City Staff. Items called for separate discussion will be heard as the next order of business.) A. Adopt Resolution No. 26-44 Accepting Completion of Phase 1 of the Los Angeles River Area Improvement Project (page 7)
Presented by the Administrative Analyst
Recommendation: The City Council is requested to adopt Resolution No. 26-44:

1. Accepting completion of work performed by Simgel Co. Inc. for the Phase 1 of the Cudahy Los Angeles River Area Improvement Project - ABP-001.

City of Cudahy
City Council and Successor Agency
Regular Meeting Agenda
October 20, 2026, at 6:30 P.M.

Page 4 of 5 ends

2. Appropriate $358,663.12 to the project for design-related costs, construction management and inspection (CMCI) services, and associated staff costs. Staff will continue to evaluate funding sources to offset project expenditures that exceed currently available project funding.

3. Authorizing the City Manager to execute the Notice of Completion (NOC) and the City Clerk to file the NOC with the Los Angeles County Recorder’s Office.

B. Adoption of Resolution No. 26-45 Approving the Fifth Amendment to the Professional Services Agreement with Willdan Engineering for Additional Design Engineering Services and Appropriations for the Cudahy Park Renovation Project (PRE-001) (page 19) Presented by the Administrative Analyst
Recommendation: It is recommended that City Council adopt Resolution No. 26-45:

1. Authorizing the City Manager to enter into and execute the Fifth Amendment to Professional Services Agreement (PSA) with Willdan Engineering, Inc. (Willdan) to provide additional design engineering services for the Cudahy Park Renovation Project - PRE-001 in the additional amount of $8,662.00 for a new total not-to-exceed amount of $520,334.00; and

2. Approving an appropriation of $6,931.00 from Proposition 68 for the revisions of construction plans and $1,731.00 from the General Fund for planning of future parking lot improvements and assisting with cost estimates for a grant application for a total amount of $8,662.00.

C. Adoption of Resolution No. 26-46 Approving a Waiver of the Temporary Use Permit Application Fee for Three Community Food Distribution Events Requested by Kaiser Permanente on Behalf of Bienestar Is Wellbeing (page 161)
Presented by the Assistant to the City Manager
Recommendation: The City Council is requested to adopt Resolution 26-46 approving the waiver of the $1,359 Temporary Use Permit (“TUP”) application fee for three community food distribution events requested by Kaiser Permanente on behalf of Bienestar is Wellbeing (“Applicant”).

City of Cudahy
City Council and Successor Agency
Regular Meeting Agenda
October 20, 2026, at 6:30 P.M.

Page 5 of 5 ends

13. PUBLIC HEARING – NONE

14. BUSINESS SESSION - NONE

15. COUNCIL DISCUSSION - NONE

RECESS TO CLOSED SESSION

16. CLOSED SESSION
A. Closed Session Pursuant to Government Code Section 54956.9(e)(1) – Conference with Legal Counsel to Discuss Matter Involving Potential Litigation – One (1) Matter

RECONVENE TO OPEN SESSION

17. CLOSED SESSION ANNOUNCEMENT

18. ADJOURNMENT
I, Richard Iglesias, hereby certify under penalty of perjury under the laws of the State of California that the foregoing agenda was posted on the City’s Website, City Hall, Clara Park, and Lugo Park not less than 72 hours prior to the meeting. A copy of said Agenda is on file in the City Clerk’sOffice.

Dated this 17th day of October 2026
Richard Iglesias, CMC
City Clerk
Blank Page
“Serving The People” "Sirviendo A La Comunidad"
Staff Report
10/20/2026 Page 1 of 3

STAFF REPORT
Date: October 20, 2026
To: Honorable Mayor/Chair and City Council/Agency Members From: Christopher R. Lopez, City Manager/Executive Director Daniela Trujillo, Administrative Analyst
Subject: Adopt Resolution No. 26-44 Accepting Completion of Phase 1 of the Los Angeles River Area Improvement Project

RECOMMENDATION
The City Council is requested to adopt Resolution No. 26-44:

1. Accepting completion of work performed by Simgel Co. Inc. for the Phase 1 of the Cudahy Los Angeles River Area Improvement Project - ABP-001.

3. Authorizing the City Manager to execute the Notice of Completion (NOC) and the City Clerk to file the NOC with the Los Angeles County Recorder’s Office.

BACKGROUND

1. On May 15, 2022, the City entered into a Restricted Grant Agreement with the State of California acting by and through its Department of Transportation (CALTRANS) after securing grant funds in the amount of $4,874,304.00 through the Clean California Local Grant Program (CCLGP) to complete the Cudahy Los Angeles River Area Improvement Project. The deadline for completion of work was set for December 2024.

2. In March of 2024, the City secured additional grant funding from the State of California in the amount of $2,132,768.00 through the River and Mountains Conservancy (RMC) grant program. The scope of improvements was defined as improvements to the Los Angeles River pedestrian and bike trail within the city limits, improvements to the Clara Bridge slopes and construction of pocket park at the Item Number
12A
“Serving The People” "Sirviendo A La Comunidad"
Staff Report
10/20/2026 Page 2 of 3
intersection of Otis Avenue and Salt Lake Avenue. The deadline for completion of work was set for February 28, 2027.

3. On March 24, 2025, the City issued a Notice of Inviting Bids for the subject project which included improvements to the Clara Bridge Slopes, Cudahy River Park, and Otis Pocket Park.

4. A public bid opening was conducted on April 23, 2025. The City received 3 bids.

The lowest bid in the amount of $3,793,293.00 was received from Simgel Co. Inc, (Simgel). Subsequent to the bid opening, staff completed a comprehensive review of the submitted bids and determined that Simgel was the lowest responsive and responsible bidder.

5. On May 6, 2025, the City Council awarded a contract to Simgel in the amount of $3,793,293.00. Moreover, the City Council approved a construction contingency budget of $1,081,011.00.

6. On May 7, 2025, a time extension to complete the project was granted for the CCLGP with the completion date set as June 20, 2025.

7. On June 27, 2025, CALTRANS granted another time extension and set September 30, 2026, as the revised deadline for completion of work.

8. On December 8, 2025, RMC granted a timeline extension to the term of its agreement with the City and set the project’s completion date as February 28, 2027.

ANALYSIS
Due to the strict June 30, 2025, deadline imposed by Caltrans for the use of Clean California Grant funds, the City was required to accelerate the project schedule significantly from 160 working days (about 8 calendar months) to 45 working days (about 2 ½ calendar months) to ensure that construction activities would be completed by the deadline set by the State. In absence of timely completion of the project, the Clean California grant funding would have been forfeited.

Given these constraints, the City made the decision to complete the project in multiple phases to minimize the risk of losing grant funding. As such, the scope of work to be completed by Simgel was revised to include Clara Bridge Slopes improvements, construction of the parkettes (Cudahy River Park and Otis Pocket Park) and limited improvements (slurry seal of pavement and installation of new pavement markings and signs) of the Los Angeles River pedestrian and bike trail. Installation of pedestrian lights, new irrigation and landscaping, pedestrian gates as well murals were deferred to be completed in future phases.

Simgel started construction on May 7, 2025, and completed its work on September 18, 2025. During the course of construction, construction contract change orders with a total value of $1,011,600.71 were issued to the contractor. A summary of the contract change orders is included herewith (Attachment C). The total construction cost including the change orders is $4,804,893.71.

CONCLUSION
“Serving The People” "Sirviendo A La Comunidad"
Staff Report
10/20/2026 Page 3 of 3
Simgel completed all required improvements in conformance with the approved plans and specifications. The work was performed within contractually specified duration and to the City Engineer’s satisfaction. Therefore, staff respectfully request that the City Council adopt Resolution No. 26-44.

STRATEGIC PLAN CORRELATION
Goal E (City Infrastructure and Service Delivery), Objective:

1. Ensure high-quality infrastructure to continue connectivity throughout the community.

3. Complete the Capital Improvement Plan, which anticipates the capital needs of Cudahy over a five-year period.

FINANCIAL IMPACT
The final cost of construction is $4,804,893.71, consisting of the original contract amount of $3,793,293 and change orders totaling $1,011,600.71. The change orders are within the construction contingency approved by the City Council. The project was included in the City’s Fiscal Year 2025-26 Capital Improvement Program and funded with proceeds from the Clean California Local Grant Program and RMC grant. The total cost of Phase 1 of the project is currently $5,942,865.53, which includes design, construction, construction management and inspection (CMCI), and staff time.

Phase 1 was funded through Clean California Local Grant Program (CCLGP) and Rivers and Mountain Conservancy (RMC) grant. The CCLGP award has been fully expended. The remaining RMC balance is restricted to the improvements deferred to phase 2 and cannot be applied to the costs described below.

An appropriation of $358,663.12 is needed for design-related costs, CMCI services, and associated staff costs incurred that exceeded the CCLGP award and fall outside the RMC grant scope. Staff will continue to look for other eligible funding sources and, if any identified, staff will return to the City Council to reimburse the General Fund.

ATTACHMENTS
A. Resolution No. 26-44
B. Notice of Completion
C. Change Order Log
RESOLUTION NO. 26-44

A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF
CUDAHY, CALIFORNIA ACCEPTING PHASE 1 OF THE LOS
ANGELES RIVER AREA IMPROVEMENT PROJECT NO.

ABP-001 AS COMPLETE, AUTHORIZING STAFF TO

PREPARE AND FILE THE NOTICE OF COMPLETION WITH

THE LOS ANGELES COUNTY RECORDER, AND

APPROPRIATING FUNDS TO THE PROJECT
WHEREAS, on May 15, 2022, the City entered into a Restricted Grant Agreement with the State of California acting by and through its Department of Transportation (CALTRANS) after securing grant funds in the amount of $4,874,304.00 through the Clean California Local Grant Program (CCLGP) to complete the Cudahy Los Angeles River Area Improvement Project; and
WHEREAS, in March of 2024, the City secured additional grant funding from the State of California in the amount of $2,132,768.00 through the River and Mountains Conservancy (RMC) grant program; and
WHEREAS, on March 24, 2025, the City issued a Notice of Inviting Bids for the subject project which included improvements to the Clara Bridge Slopes, Cudahy River Park, and Otis Pocket Park; and
WHEREAS, a public bid opening for the Project was conducted on April 23, 2025, and three (3) bids were received; and
WHEREAS, the lowest bid, in the amount of $3,793,293.00, was submitted by Simgel Co., Inc. (“Simgel”); and
WHEREAS, on May 6, 2025, the City Council awarded a contract to Simgel in the amount of $3,793,293.00 and approved a construction contingency budget of $1,081,011.00; and
WHEREAS, on May 7, 2025, a time extension to complete the project was granted for the CCLGP with the completion date set as June 20, 2025; and WHEREAS, on June 27, 2025, CALTRANS granted an additional time extension and set September 30, 2026, as the revised deadline for completion of work; and WHEREAS, on December 8, 2025, RMC granted a timeline extension to the term of its agreement with the City and set the project’s completion date as February 28, 2027.

NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Cudahy, Attachment A
Resolution No. 26-44

Page 2 of 3 ends

California, as follows:

SECTION 1. Accept the Project as complete.

SECTION 2. Authorize the City Manager to execute the Project’s Notice of Completion.

SECTION 3. Authorize the City Clerk to file the Porject’s Notice of Completion with the Los Angeles County Recorder.

SECTION 5. Appropriate $358,663.12 to the project for design-related costs, construction management and inspection (CMCI) services, and associated staff costs.

Staff will continue to evaluate funding sources to offset project expenditures that exceed currently available project funding.

SECTION 6. The City Council now hereby authorizes the Finance Director, or designee, to appropriate funds from available fund balance and amend the FY 2026-2027 budget.

PASSED, APPROVED, AND ADOPTED by the City Council of the City of Cudahy at its regular meeting of this 20th day of October 2026.
__________________________
Cynthia Gonzalez
Mayor
ATTEST:
___________________________
Richard Iglesias
City Clerk
Resolution No. 26-44

Page 3 of 3 ends

CERTIFICATION

STATE OF CALIFORNIA )
COUNTY OF LOS ANGELES ) SS.

CITY OF CUDAHY )
I, Richard Iglesias, City Clerk of the City of Cudahy, hereby certify that the foregoing Resolution No. 26-44 was passed and adopted by the City Council of the City of Cudahy at a regular meeting held on the 20th day of October 2026 and that said Resolution was adopted by the following vote, to-wit:

AYES:

NOES:

ABSENT:

ABSTAIN:
________________________________
Richard Iglesias
City Clerk
(NO FEE PURSUANT TO GOVT. CODE SECT. 27383)
RECORDING REQUESTED BY:

CITY OF CUDAHY
AND WHEN RECORDED MAIL TO:

City Clerk’s Office
Attn: City Clerk
(Name)
5220 Santa Ana Street
(Street Address)
Cudahy, CA 90201
(City, State, and Zip)
SPACE ABOVE THIS LINE FOR RECORDER’S USE

NOTICE OF COMPLETION
Notice pursuant to Civil Code Section 9204, must be filed within 15 days after completion.

Notice is hereby given that:

1. The undersigned is owner and corporate officer of the owner of the interest or estate stated below in the property hereinafter described.

2. The full name of the owner is: CITY OF CUDAHY

3. The full address of the owner is: 5220 Santa Ana St, Cudahy, CA 90201

4. The nature of the interest or estate of the owner is: In Fee. (If other than Fee, strike “in fee” and insert, for example, “purchaser under contract of purchase”, or “lessee”)

5. The full names and full addresses of all persons, if any, who hold title with the undersigned as joint tenants or as tenants in common are:

NAMES ADDRESSES
NONE

6. The full names and fill addresses of the predecessors in interest of the undersigned. IF the property was transferred subsequent to the commencement of the work or improvements herein referred to:

NAMES ADDRESSES
NONE

7. A work of improvement on the property hereinafter described was completed on September 18, 2025.

The work was: Cudahy Los Angeles River Area Improvements Project – Phase 1 (ABP-001) included improvements at of four (4) sites within the City of Cudahy; Site 1 - LA River Bike path: Repaving, restriping, repainting the existing fencing. Site 2 - Cudahy River Park: Landscape improvements to a dilapidated park across River main entrance. Bike path accessibility improvements included pathway rehabilitation, biking amenities, landscaping, lighting, and irrigation system. Site 3 - Clara Bridge Slopes: Construct terrace gardens, LA River way finders, fencing upgrades, landscaping bridge slopes to deter littering, and create interest points toward river. Site 4 - Otis Avenue Pocket Park: Converting an undeveloped lot across a school into a pocket park. Landscaping, irrigation, and pedestrian pathway.

8. The name of the contract, if any, for such work of improvement was Simgel Co, Inc. May 6, 2025
(IF NO CONTRACTOR FOR WORK OF IMPROVEMENT AS A WHOLE, INSERT ‘NONE’) (DATE OF CONTRACT)

9. The property on which the work of improvement was completed is in Cudahy, County of Los Angeles, State of California, and is described as follows: City owned facilities

10. The street address of the property is: None

VERIFICATION
I, the undersigned, say: I am the City Manager of the City of Cudahy, the declarant of the foregoing notice of completion; I have read said notice of completion and know the content thereof; the same is true of my own knowledge. I declare under penalty of perjury that the foregoing is true and correct.

Executed on: , at Cudahy California By:
(CITY) (STATE) Christopher R. Lopez, City Manager, City of Cudahy Attachment B

1.1 1
Deductive change order to remove bid items 1.42, 1.43, 2.11, 2.12, 2.14, 2.15, 2.16, 2.21, 2.22, 2.23, 2.24, 2.37, 2.38, 2.39, 2.40, 2.41, 2.42, 2.43, 2.44, 2.45, 3.10, 3.11, 3.14, 3.15, 3.21, 3.23, 3.32, 3.33, 3.34, 3.35, 3.36, 3.37, from the contract to its entirety, as approved on City Council meeting dated May 6, 2025. -$1,305,280.00 -$1,305,280.00 $2,488,013.00 5/20/2025 5/20/2025

1.2 1
Following further review and coordination with the Contractor and the City, the following bid items are added back to the Contract: Bid items 1.42, 1.43, 2.14, 2.21, 2.22, 2.23, 2.24, 2.37, 2.39, 2.40, 2.41, 2.42, 2.43, 2.44, 2.45, 3.32. $595,076.00 -$710,204.00 $3,083,089.00 5/20/2025 5/20/2025 2 2
Accelerated construction to reduce the construction duration from 160 working days to 45 working days to fast track the field work in order to complete the improvements within the Project grant requirements. This change order includes additional labor cost and premium time markups. $399,468.00 -$310,736.00 $3,482,557.00 5/20/2025 5/20/2025 3 3
Additional work added to the contract for Site 1 Improvements including bike lane improvement at LA River Bike Trail, see backup documents for further detail regarding this CCO. $897,518.00 $586,782.00 $4,380,075.00 5/20/2025 5/20/2025 4 4 Removal and hauling out eight (8) trees, see backup documents for further detail regarding this CCO. $14,000.00 $600,782.00 $4,394,075.00 5/20/2025 5/20/2025 Transtech Engineers, Inc., Std CCO Log D:\Transtech Engineers Dropbox\Duane Tut\JOBRECRD\2025\250431 CUD LOS ANGELES RIVER AREA IMPROVEMENTS, ABP-001, CMCI\WIP\50 Construction Management\50.12 Change Orders (CCO)\01 CCO Log\ Attachment
C

5.1 5
Site 4 - Otis Avenue Pocket Park Cudhay Gateway Landmark. Due to the removal of the Irrigation Pump, the irrigation system was redesigned. RFI 7 was issued by the Contractor. Furnish and install 7 additional valves and 24 additional sprinklers. This work included the additional materials needed to incorporate the new irrigation system: valves, valve boxes, decoders, 2 wire system, pop up sprinklers, addition excavation of main line, and labor. See backup document for further detail regarding this CCO. $21,454.00 $622,236.00 $4,415,529.00 5/21/2025 5/21/2025

5.2 5
Site 4 - Otis Avenue Pocket Park Cudahy Gateway Landmark. The plans called to reuse the existing backflow preventor and enclosure. Field conditions found the need for a new backflow and enclosure. New plan revisions call for a new Backflow preventor and enclosure installation, see backup document for further detail regarding this CCO. $9,900.00 $632,136.00 $4,425,429.00 5/21/2025 5/21/2025 6 6 Removal and hauling out five (5) trees, see backup documents for further detail regarding this CCO. $23,500.00 $655,636.00 $4,448,929.00 6/3/2025 6/3/2025 7 7
Additional work added to the contract for Site 1 Improvements for one wall and Murals along the LA River Bike Trail, see backup documents for further detail regarding this CCO. $379,071.00 $1,034,707.00 $4,828,000.00 6/13/2025 6/18/2025 8 8
Site 3 - Tree replacement due to removal of (13) existing trees and design revisions.

Twelve (12) thirty six inch (36") box trees have been specified, see back up documents for further detail regarding this CCO. $25,627.00 $1,060,334.00 $4,853,627.00 6/16/2025 6/18/2025 Transtech Engineers, Inc., Std CCO Log D:\Transtech Engineers Dropbox\Duane Tut\JOBRECRD\2025\250431 CUD LOS ANGELES RIVER AREA IMPROVEMENTS, ABP-001, CMCI\WIP\50 Construction Management\50.12 Change Orders (CCO)\01 CCO Log\

CCO LOG
PROJECT NAME: Cudahy Los Angeles River Area Improvements Project - ABP-001Last Updated: 10-01-2026 TOTAL CONTRACT Dollar AmountTOTAL BASE BID AMOUNT $3,793,293.00TOTAL CHANGE ORDERS APPROVED $1,011,600.71 CCO No. PCO No. Description Amount for this
CCO
Authorized Cumulative Change Order
Cumulative Contract with CCO
Date Submitted
Date Approved
9 12
Site 2 - Cudahy River Park RFCO 04 was issued to the Contractor to clean and paint the existing fences, arches, pilasters, and site furniture. Also to include Pruning of existing trees.
$77,914.00 $1,138,248.00 $4,931,541.00 6/16/2025 7/9/2025

10.1 13
Site 3 - Deductive change order remove bid item 2.19 Construction – Clean and repaint W2: Mural paint existing retaining wall on one side, 5.5' High average; 370' Length. 25% (509 SF) completed, paid ($5,596.25) with Pay App 04. -$16,788.75 $1,121,459.25 $4,914,752.25 7/9/2025 7/28/2025

10.2 3 Site 1 - Deductive change order to remove CCO 3 item 1.11 Construction - Safety Graphic artwork at (E) crosswalk. -$5,388.00 $1,116,071.25 $4,909,364.25 7/9/2025 7/28/2025

10.3 7
Site 1 - Deductive change order to remove CCO 7 item 1.1 Demo & Paint – Scrapping & cleaning, then Paint & Anti-graffiti to W2: existing retaining wall on one side 6' H average; 3000' length, as shown and detailed on the drawings and item 1.2 Demo - Sandblast & clean, apply anti-graffiti on existing wood deck as shown and detailed. 40% (7,200 SF) completed, paid ($151,628.40) with Pay App 04. -$227,442.60 $888,628.65 $4,681,921.65 7/9/2025 7/28/2025

10.4 13
Site 3 - The Contractor submitted a change order for additional costs incurred due to Chevron's requirement to pot hole and not encroach their easement. This is in response to RFI's 1, 5, 6, 8, 18, 19, 24, 25, 25-1, 26, 27, & 31. See back up documents for further detail regarding this CCO.
$81,519.46 $970,148.11 $4,763,441.11 6/26/2025 7/28/2025

10.5 9
Site 3 - Due to Chevron requirements and design revisions per RFI 24, 25, & 25-1 the plant material quantities and layout changed, see backup documents for further detail regarding this CCO. $24,998.60 $995,146.71 $4,788,439.71 6/26/2025 7/28/2025 Transtech Engineers, Inc., Std CCO Log D:\Transtech Engineers Dropbox\Duane Tut\JOBRECRD\2025\250431 CUD LOS ANGELES RIVER AREA IMPROVEMENTS, ABP-001, CMCI\WIP\50 Construction Management\50.12 Change Orders (CCO)\01 CCO Log\

10.6 15
Site 3 - Due to Chevron requirements and design revisions per RFI 24, 25, & 25-1 the irrgation quantities and layout changed, see backup documents for further detail regarding this CCO.
$9,200.00 $1,004,346.71 $4,797,639.71 7/9/2025 7/28/2025 11 16
Site 3 Punch walk, the Tree pits could not be installed per the details due to the steep slope, additional pressure treated retaining material was proposed to stablize the slope behind the trees, see backup documents for further detail regarding this CCO. $7,254.00 $1,011,600.71 $4,804,893.71 8/12/2025 8/20/2025 Transtech Engineers, Inc., Std CCO Log D:\Transtech Engineers Dropbox\Duane Tut\JOBRECRD\2025\250431 CUD LOS ANGELES RIVER AREA IMPROVEMENTS, ABP-001, CMCI\WIP\50 Construction Management\50.12 Change Orders (CCO)\01 CCO Log\ Blank Page
“Serving The People” "Sirviendo A La Comunidad"
Staff Report
10/20/2026 Page 1 of 3

STAFF REPORT
Date: October 20, 2026
To: Honorable Mayor/Chair and City Council/Agency Members From: Christopher R. Lopez, City Manager/Executive Director Daniela Trujillo, Administrative Analyst
Subject: Adoption of Resolution No. 26-45 Approving the Fifth Amendment to the Professional Services Agreement with Willdan Engineering for Additional Design Engineering Services and Appropriations for the Cudahy Park Renovation Project (PRE-001)

RECOMMENDATION
It is recommended that City Council adopt Resolution No. 26-45:

BACKGROUND

1. On February 15, 2022, the City approved a sub-recipient agreement with the State Department of Parks and Recreation after securing funds from Proposition 68’s Statewide Park Development and Community Revitalization Program.

2. On October 6, 2022, the City issued an RFP to solicit design engineering services for this project.

3. On December 6, 2022, the City Council awarded a Professional Services Agreement for Design Engineering Services to Willdan Engineering Inc.

4. On July 18, 2023, the City Council approved a First Amendment to the PSA to Item Number
12B
“Serving The People” "Sirviendo A La Comunidad"
Staff Report
10/20/2026 Page 2 of 3
amend the scope of work and provide additional design engineering services in the amount of $40,866.

5. On November 7, 2023, the City Council approved a Second Amendment to the PSA to amend the scope of work and provide additional design engineering services in the amount of $94,400.

6. On September 3, 2024, the City Council approved a Third Amendment to the PSA to amend the scope of work to include additional soil analysis testing and new park electrical systems power supply upgrades in the amount of $34,900.

7. On October 7, 2025, the City Council approved a Fourth Amendment to the PSA to amend the scope of work to provide additional design engineering services in the amount of $20,606.

ANALYSIS
This Fifth Amendment is the result of correspondence and teleconference meetings between City staff and Willdan conducted from August 2025 through January 2026.

Discussions included review of a City-provided, marked-up park site plan illustrating requested revisions to the construction plans, as well as value engineering efforts to reduce the estimated construction cost to align with the City’s available budget.

Additional discussions addressed planning for future parking lot improvements and assistance with developing cost estimates for grant funding applications. The following revisions and requested tasks are included in this Fifth Amendment:

A. Construction Plans Updates

1. Revised construction drawings for the relocation of the tennis court and basketball court.
a. Court lighting plan and electrical plans
b. Irrigation modifications
c. Planting modifications
d. Bio-swale modifications

2. Adjust of construction plans in delineating Phase 1 and Phase 2.

3. Update Phase 1 construction bid package specifically material quantities adjustments.

B. Parking Lot Concepts

4. Prepared conceptual plans for parking lot improvements and EV stations.

5. Cost estimate updated for grant funding application.

CONCLUSION
Staff recommends City Council adopt Resolution No. 26-45 to authorize the City Manager to execute the Fifth Amendment with Willdan and appropriate funding to the Cudahy Park Renovation Project.

STRATEGIC PLAN CORRELATION
“Serving The People” "Sirviendo A La Comunidad"
Staff Report
10/20/2026 Page 3 of 3
Goal A (Community Services, Programs, and Activities for all), Objective:

3. Ensure parks are safe, clean, welcoming, and accessible to all.

FINANCIAL IMPACT
The Fifth Amendment increases the not-to-exceed amount of the Willan agreement by $8,662.00, from $511,672 to $520,334. The cost is allocated as follows:

1. $6,931.00 from “Other Grants” Proposition 68 (Fund Number 235) a. 235-7126-6720-000 Cudahy Park Renovation Project PRE-001

2. $1,731.00 from the General Fund (Fund Number 100)
a. 100-4330-6950-000 Public Works Administration Contractual

ATTACHMENTS
A. Draft Fifth Amendment
B. Resolution No. 26-45
1 2026

FIFTH AMENDMENT TO PROFESSIONAL SERVICES AGREEMENT
(Engagement: DESIGN PHASE ENGINEERING SERVICES)
(Parties: Willdan Engineering Inc. and City of Cudahy)
THIS FIFTH AMENDMENT (hereinafter, “Fifth Amendment”) to that certain agreement entitled “Professional Services Agreement”, dated December 6, 2022 (hereinafter, the “Master Agreement”), is hereby made and entered into this ____ day of October 2026 (hereinafter, the “Effective Date”) by and between the CITY OF CUDAHY, a municipal corporation (hereinafter, “CITY”) and WILLDAN ENGINEERING INC. (hereinafter, “CONSULTANT”). For purposes of this Fifth Amendment, the capitalized term “Parties” shall be a collective reference to both CITY and CONSULTANT. The capitalized term “Party” may refer to either CITY or CONSULTANT, interchangeably as appropriate.

RECITALS
This FIFTH AMENDMENT is made and entered into with respect to the following facts:

WHEREAS, on December 6, 2022, the Parties executed and entered into the Master Agreement for CONSULTANT to provide design engineering services for the Cudahy Park Renovation Project; and
WHEREAS, the Master Agreement was subsequently amended on July 18, 2023, by way of a First Amendment to amend the Scope of Work to provide additional design engineering services in the amount of FORTY THOUSAND EIGHT HUNDRED SIXTYSIX ($40,866) for a new total not-to-exceed amount of THREE HUNDRED FIFTY-NINE THOUSAND SEVEN HUNDRED SIXTY-SIX ($359,766) (hereinafter the “First Amendment”); and
WHEREAS, the Master Agreement was subsequently amended on November 7 , 2023, by way of a Second Amendment to amend the Scope of Work to provide additional design engineering services in the amount of NINETY-SIX THOUSAND FOUR HUNDRED ($96,400) for a new total not-to-exceed amount of FOUR HUNDRED FIFTYSIX THOUSAND ONE HUNDRED SIXTY-SIX ($456,166) (hereinafter the “Second Amendment”); and
WHEREAS, the Master Agreement was subsequently amended on September 3, 2024, by way of a Third Amendment to amend the Scope of Work to include additional soil analysis testing and new park electrical systems power supply upgrades in the amount of THIRTY-FOUR THOUSAND NINE HUNDRED ($34,900) for a new total notto-exceed amount of FOUR HUNDRED NINETY-ONE THOUSAND SIXTY-SIX ($491,066) (hereinafter the “Third Amendment”); and
WHEREAS, the Master Agreement was subsequently amended on October 7, 2025, by way of a Fourth Amendment to amend the Scope of Work to include additional design engineering services and increase the not-to-exceed sum in the amount of TWENTY THOUSAND SIX HUNDRED SIX ($20,606) for a new total not-to-exceed amount of FIVE HUNDRED ELEVEN THOUSAND SIX HUNDRED SEVENTY-TWO Attachment A
2 ($511,672) (hereinafter the “Fourth Amendment”); and
WHEREAS, the Master Agreement as amended by way of the First Amendment, Second Amendment, Third Amendment, and Fourth Amendment is attached and incorporated hereto as Exhibit “A”; and
WHEREAS, the Parties now agree to amend the Scope of Work to provide additional design engineering services and increase the not-to-exceed sum; and WHEREAS, on October 20, 2026, the City Council authorized the City Manager to execute the Amendment as identified in Section 1.2 (Scope of Services) and Section 1.4 (Compensation) of the Master Agreement.

NOW, THEREFORE, in consideration of the mutual agreements contained herein, and other good and valuable consideration, the receipt and sufficiency of which is hereby acknowledged, and intending to be legally bound hereby, the Parties agree as follows:

SECTION 1. The foregoing recitals are true and correct and are incorporated by reference.

SECTION 2. Section 1.2 “Scope of Services” of the Master Agreement is hereby amended to include additional design phase engineering services and incorporated hereto as Exhibit “B”.

SECTION 3. The Not-To-Exceed Sum as set forth in Section 1.4 “Compensation” of the Master Agreement is hereby increased by an additional EIGHT THOUSAND SIX HUNDRED SIXTY-TWO ($8,662) for a new Not-to-Exceed Sum of FIVE HUNDRED TWENTY THOUSAND THREE HUNDRED THIRTY-FOUR ($520,334).

SECTION 4. Except as otherwise set forth in this FIFTH Amendment, the Master Agreement, as amended by the way of the Fourth Amendment, Third Amendment, Second Amendment, and First Amendment shall remain binding, controlling, and in full force and effect. The Amendments and Master Agreement including exhibits shall constitute the entire, complete, final, and exclusive expression of the Parties with respect to the matters addressed in all documents.

SECTION 5. In the event of any conflict or inconsistency between the provisions of this Fourth Amendment and the provisions of the Master Agreement, the provisions of this Fourth Amendment shall govern and control to the extent of the conflict or inconsistency and no further.
(SIGNATURES ON NEXT PAGE)
3 IN WITNESS WHEREOF, the Parties hereto have caused this Fifth Amendment to be executed on the day and year first appearing above.

CITY OF CUDAHY:

By:

Christropher R. Lopez
City Manager

Date:_______________________
APPROVED AS TO FORM:

By:

Shelley Preisler
City Attorney

Date:_______________________
WILLDAN ENGINEERING INC.:

By:

Name:

Title:

Date:_______________________
4 EXHIBIT “A”

MASTER AGREEMENT / AMENDMENTS
1 2022

PROFESSIONAL SERVICES AGREEMENT
(Engagement: DESIGN PHASE ENGINEERING SERVICES)
(Parties: Willdan Engineering Inc. and City of Cudahy)
THIS PROFESSIONAL SERVICES AGREEMENT (hereinafter, “Agreement”) is made and entered into this 6th day of December 2022 (hereinafter, the “Effective Date”) by and between the CITY OF CUDAHY, a municipal corporation (hereinafter, “CITY”) and Willdan Engineering Inc., (hereinafter, “CONSULTANT”). For the purposes of this Agreement, CITY and CONSULTANT may be referred to collectively by the capitalized term “Parties.” The capitalized term “Party” may refer to CITY or CONSULTANT interchangeably, as appropriate.

RECITALS
WHEREAS, CITY requires design phase engineering services; and WHEREAS, CITY staff has determined that CONSULTANT possesses the experience, skills and training necessary to competently provide such services to CITY; and
WHEREAS, the execution of this Agreement was approved by the Cudahy City Council at its Regular Meeting of December 6, 2022.

NOW, THEREFORE, for and in consideration of the mutual covenants and conditions herein contained, CITY and CONSULTANT agree as follows:

ENGAGEMENT TERMS

1.1 TERM: This Agreement shall have a term commencing from the Effective Date through completion of this project (hereinafter, the “Term”). Nothing in this Section shall operate to prohibit or otherwise restrict the CITY’s ability to terminate this Agreement at any time for convenience or for cause as provided under Article V (Termination), below.

1.2 SCOPE OF SERVICES:

A. Subject to the terms and conditions of this Agreement, CONSULTANT agrees to provide the services and tasks described in that certain Request for Proposals of CITY entitled “Request for Proposal Translation Services” (hereinafter, “CITY RFP”) and the written proposal of CONSULTANT entitled “Design Phase Engineering Services for the preparation of PS&E (Plan, Specifications, and Estimates) for the Cudahy Park Renovation Project” (hereinafter, the “CONSULTANT Proposal”). The CITY RFP and the CONSULTANT Proposal are attached and incorporated hereto as 2 Exhibit “A” and “B” respectively. The term “Scope of Work” shall be a collective reference to the CITY RFP and the CONSULTANT Proposal. The capitalized term “Work” shall be a collective reference to all the various services and tasks referenced in the Scope of Work. In the event of any conflict or inconsistency between the provisions of the document entitled CITY RFP and the provisions of the document entitled CONSULTANT Proposal, the requirements of the document entitled CITY RFP shall govern and control but only to the extent of the conflict or inconsistency and no further. In the event of any conflict or inconsistency between the provisions of the Scope of Work and the provisions of this Agreement to which the Scope of Work is attached, the provisions of this Agreement shall govern and control.”

1.3 PROSECUTION OF WORK:

A. CONSULTANT shall perform the Work contemplated under this Agreement on an on-call, as-needed basis. Nothing in this Agreement shall be construed to grant CONSULTANT the exclusive right to perform any of the types of services or tasks contemplated under this Agreement nor shall anything in this Agreement be construed to entitle CONSULTANT to the receipt of any sums under this Agreement, except to the extent CITY requests the performance of any Work in the manner described below and such Work is in fact performed and completed by CONSULTANT and accepted by CITY. CITY requests for the performance of specific services or tasks contemplated under this Agreement shall be made in the form of a written work order(s) issued by the City Representative (each such written request hereinafter referred to as a “Work Order”). Each Work Order shall include the following information:

1. A detailed description of the specific services or tasks requested;

2. The location of where the particular services or tasks are to be performed, if applicable;

3. A not-to-exceed budget for performing the services or tasks;

4. A timeline for completing the requested services or tasks;

5. Any other information CITY deems necessary and relevant to the requested services or tasks; and

6. The signature of the City Representative, confirming that the services or tasks have been authorized by the City Representative.

B. CONSULTANT shall perform no Work under this Agreement without a written request from the City Representative, containing the information set forth in Section 1.3(A) above;
C. CONSULTANT shall perform the Work continuously and with due diligence so as to complete the Work by the completion date indicated in each Work Order. CONSULTANT shall cooperate with CITY and in no manner interfere with the work of CITY, its employees or other consultants, contractors or agents;
3 D. CONSULTANT shall not claim or be entitled to receive any compensation or damage because of the failure of CONSULTANT, or its subconsultants, to have related services or tasks completed in a timely manner; E. CONSULTANT shall at all times enforce strict discipline and good order among CONSULTANT’s employees; and
F. CONSULTANT, at its sole expense, shall pay all sales, consumer, use or other similar taxes required by law.

1.4 COMPENSATION: CONSULTANT shall perform the Work in accordance with the “Fee Estimate Proposal” which is attached and incorporated hereto as Exhibit “C” (hereinafter, the “COMPENSATION RATE”). The foregoing notwithstanding, CONSULTANT’s total compensation for the performance of all Work contemplated under this Agreement, will not exceed the aggregate budgeted sum of THREE HUNDRED EIGHTEEN THOUSAND NINE HUNDRED DOLLARS ($318,900) (hereinafter, the “Not-to-Exceed Sum”) during the Term of this Agreement, unless such added expenditure is first approved by the City Council. In the event CONSULTANT’s charges are projected to exceed the Aggregate Not-to-Exceed Sum prior to the expiration of this Agreement, CITY may suspend CONSULTANT’s performance pending CITY approval of any anticipated expenditures in excess of the Aggregate Not-to-Exceed Sum or any other CITY approved amendment to the compensation terms of this Agreement.

1.5 PAYMENT OF COMPENSATION: The Not-to-Exceed Sum will be paid to CONSULTANT in monthly increments as the Work is completed. Following the conclusion of each calendar month, CONSULTANT will submit to CITY an itemized invoice indicating the services performed and tasks completed during the recently concluded calendar month, including services and tasks performed and the reimbursable out-of-pocket expenses incurred. If the amount of CONSULTANT’s monthly compensation is a function of hours worked by CONSULTANT’s personnel, the invoice should indicate the number of hours worked in the recently concluded calendar month, the persons responsible for performing the Work, the rate of compensation at which such services and tasks were performed, the subtotal for each task and service performed and a grand total for all services performed. Within thirty (30) calendar days of receipt of each invoice, CITY will notify CONSULTANT in writing of any disputed amounts included in the invoice.

Within forty-five (45) calendar days of receipt of each invoice, CITY will pay all undisputed amounts included on the invoice. CITY will not withhold applicable taxes or other authorized deductions from payments made to CONSULTANT.

1.6 ACCOUNTING RECORDS: CONSULTANT will maintain complete and accurate records with respect to all matters covered under this Agreement for a period of three (3) years after the expiration or termination of this Agreement. CITY will have the right to access and examine such records, without charge, during normal business hours. CITY will further have the right to audit such records, to make transcripts therefrom and to inspect all program data, documents, proceedings, and activities.
4 1.7 ABANDONMENT BY CONSULTANT: In the event CONSULTANT ceases to perform the Work agreed to under this Agreement or otherwise abandons the undertaking contemplated herein prior to the expiration of this Agreement or prior to completion of any or all tasks set forth in the Scope of Services, CONSULTANT will deliver to CITY immediately and without delay, all materials, records and other work product prepared or obtained by CONSULTANT in the performance of this Agreement. Furthermore, CONSULTANT will only be compensated for the reasonable value of the services, tasks and other Work performed up to the time of cessation or abandonment, less a deduction for any damages, costs or additional expenses which CITY may incur as a result of CONSULTANT’s cessation or abandonment.

II.

PERFORMANCE OF AGREEMENT

2.1 CITY’S REPRESENTATIVE: The CITY hereby designates Alfonso Noyola, City Manager (hereinafter, the “CITY Representative”) to act as its representative for the performance of this Agreement. The CITY Representative or their designee will act on behalf of the CITY for all purposes under this Agreement.

CONSULTANT will not accept directions or orders from any person other than the CITY Representative or their designee.

2.2 CONSULTANT REPRESENTATIVE: CONSULTANT hereby designates Tyrone Peter to act as its representative for the performance of this Agreement (hereinafter, “CONSULTANT Representative”). CONSULTANT Representative will have full authority to represent and act on behalf of the CONSULTANT for all purposes under this Agreement. CONSULTANT Representative or His/Her designee will supervise and direct the performance of the Work, using his best skill and attention, and will be responsible for all means, methods, techniques, sequences and procedures and for the satisfactory coordination of all portions of the Work under this Agreement. Notice to the CONSULTANT Representative will constitute notice to CONSULTANT.

2.3 COORDINATION OF SERVICE; CONFORMANCE WITH REQUIREMENTS:

CONSULTANT agrees to work closely with CITY staff in the performance of the Work and this Agreement and will be available to CITY staff and the CITY Representative at all reasonable times. All work prepared by CONSULTANT will be subject to inspection and approval by CITY Representative or his or her designees.

2.4 STANDARD OF CARE; PERFORMANCE OF EMPLOYEES: CONSULTANT represents, acknowledges and agrees to the following:

A. CONSULTANT will perform all Work skillfully, competently and to the highest standards of CONSULTANT’s profession;
B. CONSULTANT shall at all times employ such force, plant, materials, and tools as will be sufficient in the opinion of the CITY to perform the Services 5 within the time limits established, and as provided herein. It is understood and agreed that said tools, equipment, apparatus, facilities, labor, and material shall be furnished and said Services performed and completed as required by the Agreement, and subject to the approval of the CITY’s authorized representative.

C. CONSULTANT will perform all Work in a manner reasonably satisfactory to the CITY;
D. CONSULTANT will comply with all applicable federal, state and local laws and regulations, including the conflict of interest provisions of Government Code Section 1090 and the Political Reform Act (Government Code Section 81000 et seq.) CONSULTANT shall be liable for all violations of such laws and regulations in connection with Services. If CONSULTANT performs any work knowing it to be contrary to such laws, rules and regulations, CONSULTANT shall be solely responsible for all costs arising therefrom; E. CONSULTANT understands the nature and scope of the Work to be performed under this Agreement as well as any and all schedules of performance;
F. All of CONSULTANT’s employees and agents possess sufficient skill, knowledge, training and experience to perform those services and tasks assigned to them by CONSULTANT; and
G. All of CONSULTANT’s employees and agents (including, but not limited to, subcontractors and subconsultants) possess all licenses, permits, certificates, qualifications and approvals of whatever nature that are legally required to perform the tasks and services contemplated under this Agreement and all such licenses, permits, certificates, qualifications and approvals will be maintained throughout the term of this Agreement and made available to CITY for copying and inspection.

The Parties acknowledge and agree that CONSULTANT will perform, at CONSULTANT’s own cost and expense and without any reimbursement from CITY, any services necessary to correct any errors or omissions caused by CONSULTANT’s failure to comply with the standard of care set forth under this Section or by any like failure on the part of CONSULTANT’s employees, agents, contractors, subcontractors and subconsultants. Such effort by CONSULTANT to correct any errors or omissions will be commenced immediately upon their discovery by either Party and will be completed within seven (7) calendars days from the date of discovery or such other extended period of time authorized by the CITY Representative in writing and in her sole and absolute discretion. The Parties acknowledge and agree that CITY’s acceptance of any work performed by CONSULTANT or on CONSULTANT’s behalf will not constitute a release of any deficiency or delay in performance. The Parties further acknowledge, understand and agree that CITY has relied upon the foregoing representations of CONSULTANT, including but not limited to the representation that CONSULTANT possesses the skills, training, knowledge and experience necessary to perform the 6 Work skillfully, competently and to the highest standards of CONSULTANT’s profession.

2.5 ASSIGNMENT: The skills, training, knowledge and experience of CONSULTANT are material to CITY’s willingness to enter into this Agreement. Accordingly, CITY has an interest in the qualifications and capabilities of the person(s) who will perform the services and tasks to be undertaken by CONSULTANT or on behalf of CONSULTANT in the performance of this Agreement. In recognition of this interest, CONSULTANT agrees that it will not assign or transfer, either directly or indirectly or by operation of law, this Agreement or the performance of any of CONSULTANT’s duties or obligations under this Agreement without the prior written consent of the CITY. In the absence of CITY’s prior written consent, any attempted assignment or transfer will be ineffective, null and void and will constitute a material breach of this Agreement.

2.6 SUBSTITUTION OF KEY PERSONNEL: CONSULTANT has represented to CITY that certain key personnel will perform and coordinate the Services under this Agreement. Should one or more of such personnel become unavailable, CONSULTANT may substitute other personnel of at least equal competence upon written approval of CITY. In the event that CITY and CONSULTANT cannot agree as to the substitution of key personnel, CITY shall be entitled to terminate this Agreement for cause. As discussed below, any personnel who fail or refuse to perform the Services in a manner acceptable to the CITY, or who are determined by the CITY to be uncooperative, incompetent, a threat to the adequate or timely completion of the Project or a threat to the safety of persons or property, shall be promptly removed from the Project by the CONSULTANT at the request of the CITY.

2.7 CONTROL AND PAYMENT OF SUBORDINATES; INDEPENDENT
CONTRACTOR: The Work will be performed by CONSULTANT or under CONSULTANT’s strict supervision. CONSULTANT will determine the means, methods and details of performing the Work subject to the requirements of this Agreement. CITY retains CONSULTANT on an independent contractor basis and not as an employee. CONSULTANT reserves the right to perform similar or different services for other principals during the term of this Agreement, provided such work does not unduly interfere with CONSULTANT’s competent and timely performance of the Work contemplated under this Agreement and provided the performance of such services does not result in the unauthorized disclosure of CITY’s confidential or proprietary information. Any additional personnel performing the Work under this Agreement on behalf of CONSULTANT are not employees of CITY and will at all times be under CONSULTANT’s exclusive direction and control. CONSULTANT will pay all wages, salaries and other amounts due such personnel and will assume responsibility for all benefits, payroll taxes, Social Security and Medicare payments and the like. CONSULTANT will be responsible for all reports and obligations respecting such additional personnel, including, but not limited to: Social Security taxes, income tax withholding, unemployment insurance, disability insurance, workers’ compensation insurance and the like.
7 2.8 REMOVAL OF EMPLOYEES OR AGENTS: If any of CONSULTANT’s officers, employees, agents, contractors, subcontractors or subconsultants is determined by the CITY Representative to be uncooperative, incompetent, a threat to the adequate or timely performance of the tasks assigned to CONSULTANT, a threat to persons or property, or if any of CONSULTANT’s officers, employees, agents, contractors, subcontractors or subconsultants fail or refuse to perform the Work in a manner acceptable to the CITY, such officer, employee, agent, contractor, subcontractor or subconsultant will be promptly removed by CONSULTANT and will not be reassigned to perform any of the Work.

2.9 COMPLIANCE WITH LAWS: CONSULTANT will keep itself informed of and in compliance with all applicable federal, state or local laws to the extent such laws control or otherwise govern the performance of the Work. CONSULTANT’s compliance with applicable laws will include, without limitation, compliance with all applicable Cal/OSHA requirements and applicable regulations of the U.S.

Department of Housing and Urbanization.

2.10 NON-DISCRIMINATION: CONSULTANT represents that it is an equal opportunity employer and it shall not discriminate against any subconsultant, employee or applicant for employment because of race, religion, color, national origin, handicap, ancestry, sex or age. Such non-discrimination shall include, but not be limited to, all activities related to initial employment, upgrading, demotion, transfer, recruitment or recruitment advertising, layoff or termination.

2.11 INDEPENDENT CONTRACTOR STATUS: The Parties acknowledge, understand and agree that CONSULTANT and all persons retained or employed by CONSULTANT are, and will at all times remain, wholly independent contractors and are not officials, officers, employees, departments or subdivisions of CITY.

CONSULTANT will be solely responsible for the negligent acts and/or omissions of its employees, agents, contractors, subcontractors and subconsultants.

CONSULTANT and all persons retained or employed by CONSULTANT will have no authority, express or implied, to bind CITY in any manner, nor to incur any obligation, debt or liability of any kind on behalf of, or against, CITY, whether by contract or otherwise, unless such authority is expressly conferred to CONSULTANT under this Agreement or is otherwise expressly conferred by CITY in writing.

III.

INSURANCE

3.1 DUTY TO PROCURE AND MAINTAIN INSURANCE: Prior to the beginning of and throughout the duration of the Work, CONSULTANT will procure and maintain policies of insurance that meet the requirements and specifications set forth under this Article. CONSULTANT will procure and maintain the following insurance coverage, at its own expense:

A. Commercial General Liability Insurance: CONSULTANT will procure and maintain Commercial General Liability Insurance (“CGL Coverage”) as broad as Insurance Services Office Commercial General Liability coverage 8 (occurrence Form CG 0001) or its equivalent. Such CGL Coverage will have minimum limits of no less than One Million Dollars ($1,000,000.00) per occurrence and Two Million Dollars ($2,000,000.00) in the general aggregate for bodily injury, personal injury, property damage, operations, products and completed operations, and contractual liability.

B. Automobile Liability Insurance: CONSULTANT will procure and maintain Automobile Liability Insurance as broad as Insurance Services Office Form Number CA 0001 covering Automobile Liability, Code 1 (any auto). Such Automobile Liability Insurance will have minimum limits of no less than Two Million Dollars ($2,000,000.00) per accident for bodily injury and property damage.

C. Workers’ Compensation Insurance/ Employer’s Liability Insurance: A policy of workers’ compensation insurance in such amount as will fully comply with the laws of the State of California and which will indemnify, insure and provide legal defense for both CONSULTANT and CITY against any loss, claim or damage arising from any injuries or occupational diseases occurring to any worker employed by or any persons retained by CONSULTANT in the course of carrying out the Work contemplated in this Agreement.

D. Errors & Omissions Insurance: For the full term of this Agreement and for a period of three (3) years thereafter, CONSULTANT will procure and maintain Errors and Omissions Liability Insurance appropriate to CONSULTANT’s profession. Such coverage will have minimum limits of no less than Two Million Dollars ($2,000,000.00) per claim.

3.2 ADDITIONAL INSURED REQUIREMENTS: The CGL Coverage and the Automobile Liability Insurance will contain an endorsement naming the CITY and CITY’s elected and appointed officials, officers, employees, agents and volunteers as additional insureds.

3.3 REQUIRED CARRIER RATING: All varieties of insurance required under this Agreement will be procured from insurers admitted in the State of California and authorized to issue policies directly to California insureds. Except as otherwise provided elsewhere under this Article, all required insurance will be procured from insurers who, according to the latest edition of the Best’s Insurance Guide, have an A.M. Best’s rating of no less than A:VII. CITY may also accept policies procured by insurance carriers with a Standard & Poor’s rating of no less than BBB according to the latest published edition the Standard & Poor’s rating guide. As to Workers’ Compensation Insurance/ Employer’s Liability Insurance, the CITY Representative is authorized to authorize lower ratings than those set forth in this Section.

3.4 PRIMACY OF CONSULTANT’S INSURANCE: All policies of insurance provided by CONSULTANT will be primary to any coverage available to CITY or CITY’s elected or appointed officials, officers, employees, agents or volunteers. Any insurance or self-insurance maintained by CITY or CITY’s elected or appointed 9 officials, officers, employees, agents or volunteers will be in excess of CONSULTANT’s insurance and will not contribute with it.

3.5 WAIVER OF SUBROGATION: All insurance coverage provided pursuant to this Agreement will not prohibit CONSULTANT or CONSULTANT’s officers, employees, agents, subcontractors or subconsultants from waiving the right of subrogation prior to a loss. CONSULTANT hereby waives all rights of subrogation against CITY, its officials, officers, employees, agents and volunteers.

3.6 VERIFICATION OF COVERAGE: CONSULTANT acknowledges, understands and agrees, that CITY’s ability to verify the procurement and maintenance of the insurance required under this Article is critical to safeguarding CITY’s financial well-being and, indirectly, the collective well-being of the residents of the CITY.

Accordingly, CONSULTANT warrants, represents and agrees that it will furnish CITY with original certificates of insurance and endorsements evidencing the coverage required under this Article on forms satisfactory to CITY in its sole and absolute discretion. The certificates of insurance and endorsements for each insurance policy will be signed by a person authorized by that insurer to bind coverage on its behalf, and will be on forms provided by the CITY if requested. All certificates of insurance and endorsements will be received and approved by CITY as a condition precedent to CONSULTANT’s commencement of any Work or any of the Work. Upon CITY’s written request, CONSULTANT will also provide CITY with certified copies of all required insurance policies and endorsements.

3.7 FAILURE TO MAINTAIN COVERAGE: In the event any policy of insurance required under this Agreement does not comply with these specifications or is canceled and not replaced immediately so as to avoid a lapse in the required coverage, CITY has the right but not the duty to obtain the insurance it deems necessary, and any premium paid by CITY will be promptly reimbursed by CONTRACTOR or CITY will withhold amounts sufficient to pay premium from Consultant payments. In the alternative, CITY may cancel this Agreement effective upon notice.

3.8 SPECIAL RISKS OR CIRCUMSTANCES. City reserves the right to modify these requirements, including limits, based on the nature of the risk, prior experience, insurer, coverage, or other special circumstances.

IV.

INDEMNIFICATION

4.1 The Parties agree that CITY and CITY’s elected and appointed officials, officers, employees, agents and volunteers (hereinafter, the “CITY Indemnitees”) should, to the fullest extent permitted by law, be protected from any and all loss, injury, damage, claim, lawsuit, cost, expense, attorneys’ fees, litigation costs, or any other cost arising out of or in any way related to the performance of this Agreement. Accordingly, the provisions of this indemnity provision are intended by the Parties to be interpreted and construed to provide the CITY Indemnitees 10 with the fullest protection possible under the law. CONSULTANT acknowledges that CITY would not enter into this Agreement in the absence of CONSULTANT’s commitment to indemnify, defend and protect CITY as set forth herein Notwithstanding the foregoing, to the extent CONSULTANT’s services are subject to Civil Code Section 2782.8, the above indemnity shall be limited, to the extent required by Civil Code Section 2782.8, to Claims that arise out of, pertain to, or relate to the negligence, recklessness, or willful misconduct of the CONSULTANT.

CONSULTANT’s obligation to indemnify shall not be restricted to insurance proceeds, if any, received by the CITY, its officials, officers, employees, agents or volunteers.

4.2 To the fullest extent permitted by law, CONSULTANT shall indemnify, hold harmless and defend the CITY Indemnitees from and against all liability, loss, damage, expense, cost (including without limitation reasonable attorneys’ fees, expert fees and all other costs, and fees of litigation) of every nature arising out of or in connection with CONSULTANT’s performance of work hereunder or its failure to comply with any of its obligations contained in this Agreement, except such loss or damage which is caused by the sole negligence or willful misconduct of the CITY.

4.3 CITY shall have the right to offset against the amount of any compensation due to CONSULTANT under this Agreement, any amount due to CITY from CONSULTANT as a result of CONSULTANT’s failure to either pay CITY promptly for any costs associated with CONSULTANT’s obligations to indemnify the CITY Indemnitees under this Article, or related to CONSULTANT’s failure to either (i) pay taxes on amounts received pursuant to this Agreement or (ii) comply with applicable workers’ compensation laws.

4.4 The obligations of CONSULTANT under this Article will not be limited by the provisions of any workers’ compensation act or similar act. CONSULTANT expressly waives its statutory immunity under such statutes or laws as to CITY and CITY’s elected and appointed officials, officers, employees, agents, and volunteers.

4.5 CONSULTANT agrees to obtain executed indemnity agreements with provisions identical to those set forth herein this Article from each and every subcontractor or any other person or entity involved by, for, with or on behalf of CONSULTANT in the performance of this Agreement. In the event CONSULTANT fails to obtain such indemnity obligations from others as required herein, CONSULTANT agrees to be fully responsible and indemnify, hold harmless and defend CITY and CITY’s elected and appointed officials, officers, employees, agents, and volunteers from and against any and all claims and losses, costs or expenses for any damage due to death or injury to any person and injury to any property resulting from any alleged intentional, reckless, negligent, or otherwise wrongful acts, errors or omissions of CONSULTANT’s subcontractors or any other person or entity involved by, for, with or on behalf of CONSULTANT in the performance of this Agreement. Such costs and expenses shall include reasonable attorneys’ fees incurred by counsel of CITY’s choice.
11 4.6 CITY does not, and shall not waive any rights that it may possess against CONSULTANT because of the acceptance by CITY, or the deposit with CITY, of any insurance policy or certificate required pursuant to this Agreement. This hold harmless and indemnification provision shall apply regardless of whether or not any insurance policies are determined to be applicable to the claim, demand, damage, liability, loss, cost, or expense.

4.7 This Article and all provisions contained herein (including but not limited to the duty to indemnify, defend, and hold free and harmless) shall survive the termination or normal expiration of this Agreement and is in addition to any other rights or remedies which the CITY may have at law or in equity.

TERMINATION

5.1 TERMINATION WITHOUT CAUSE: CITY may immediately terminate this Agreement at any time for convenience and without cause by giving prior written notice of CITY’s intent to terminate this Agreement which notice shall specify the effective date of such termination. Upon such termination for convenience, CONSULTANT will be compensated only for those services and tasks which have been performed by CONSULTANT up to the effective date of the termination.

CONSULTANT may not terminate this Agreement except for cause as provided under Section 5.2, below. If this Agreement is terminated as provided herein, CITY may require CONSULTANT to provide all finished or unfinished Documents and Data, as defined in section 6.1 below, and other information of any kind prepared by CONSULTANT in connection with the performance of the Work.

CONSULTANT will be required to provide such Documents and Data within fifteen (15) calendar days of CITY’s written request. No actual or asserted breach of this Agreement on the part of CITY pursuant to Section 5.2, below, will operate to prohibit or otherwise restrict CITY’s ability to terminate this Agreement for convenience as provided under this Section.

5.2 EVENTS OF DEFAULT; BREACH OF AGREEMENT:

A. In the event either Party fails to perform any duty, obligation, service or task set forth under this Agreement (or fails to timely perform or properly perform any such duty, obligation, service or task set forth under this Agreement), an event of default (hereinafter, “Event of Default”) will occur. For all Events of Default, the Party alleging an Event of Default will give written notice to the defaulting Party (hereinafter referred to as a “Default Notice”) which will specify: (i) the nature of the Event of Default; (ii) the action required to cure the Event of Default; (iii) a date by which the Event of Default will be cured, which will not be less than the applicable cure period set forth under Sections 5.2B and 5.2C below or if a cure is not reasonably possible within the applicable cure period, to begin such cure and diligently prosecute such cure to completion. The Event of Default will constitute a breach of this Agreement if the defaulting Party fails to cure the Event of Default within the applicable cure period or any extended cure period allowed under this Agreement.
12 B. CONSULTANT will cure the following Events of Defaults within the following time periods:
i. Within ten (10) business days of CITY’s issuance of a Default Notice for any failure of CONSULTANT to timely provide CITY or CITY’s employees or agents with any information and/or written reports, documentation or work product which CONSULTANT is obligated to provide to CITY or CITY’s employees or agents under this Agreement.

Prior to the expiration of the 10-day cure period, CONSULTANT may submit a written request for additional time to cure the Event of Default upon a showing that CONSULTANT has commenced efforts to cure the Event of Default and that the Event of Default cannot be reasonably cured within the 10-day cure period. The foregoing notwithstanding, CITY will be under no obligation to grant additional time for the cure of an Event of Default under this Section 5.2B.i. that exceeds seven (7) calendar days from the end of the initial 10-day cure period; or ii. Within fourteen (14) calendar days of CITY’s issuance of a Default Notice for any other Event of Default under this Agreement. Prior to the expiration of the 14-day cure period, CONSULTANT may submit a written request for additional time to cure the Event of Default upon a showing that CONSULTANT has commenced efforts to cure the Event of Default and that the Event of Default cannot be reasonably cured within the 14-day cure period. The foregoing notwithstanding, CITY will be under no obligation to grant additional time for the cure of an Event of Default under this Section 5.2B.ii that exceeds thirty (30) calendar days from the end of the initial 14-day cure period.

In addition to any other failure on the part of CONSULTANT to perform any duty, obligation, service or task set forth under this Agreement (or the failure to timely perform or properly perform any such duty, obligation, service or task), an Event of Default on the part of CONSULTANT will include, but will not be limited to the following: (i) CONSULTANT’s refusal or failure to perform any of the services or tasks called for under the Scope of Work; (ii) CONSULTANT’s failure to fulfill or perform its obligations under this Agreement within the specified time or if no time is specified, within a reasonable time; (iii) CONSULTANT’s and/or its employees’ disregard or violation of any federal, state, local law, rule, procedure or regulation; (iv) the initiation of proceedings under any bankruptcy, insolvency, receivership, reorganization, or similar legislation as relates to CONSULTANT, whether voluntary of involuntary; (v) CONSULTANT’s refusal or failure to perform or observe any covenant, condition, obligation or provision of this Agreement; and/or (vii) CITY’s discovery that a statement representation or warranty by CONSULTANT relating to this Agreement is false, misleading or erroneous in any material respect.

C. CITY will cure any Event of Default asserted by CONSULTANT within fortyfive (45) calendar days of CONSULTANT’s issuance of a Default Notice, unless the Event of Default cannot reasonably be cured within the 45-day 13 cure period. Prior to the expiration of the 45-day cure period, CITY may submit a written request for additional time to cure the Event of Default upon a showing that CITY has commenced its efforts to cure the Event of Default and that the Event of Default cannot be reasonably cured within the 45-day cure period. The foregoing notwithstanding, an Event of Default dealing with CITY’s failure to timely pay any undisputed sums to CONSULTANT as provided under Section 1.5, above, will be cured by CITY within five (5) calendar days from the date of CONSULTANT’s Default Notice to CITY.

D. CITY, in its sole and absolute discretion, may also immediately suspend CONSULTANT’s performance under this Agreement pending
CONSULTANT’s cure of any Event of Default by giving CONSULTANT written notice of CITY’s intent to suspend CONSULTANT’s performance (hereinafter, a “Suspension Notice”). CITY may issue the Suspension Notice at any time upon the occurrence of an Event of Default. Upon such suspension, CONSULTANT will be compensated only for those services and tasks which have been rendered by CONSULTANT to the reasonable satisfaction of CITY up to the effective date of the suspension. No actual or asserted breach of this Agreement on the part of CITY will operate to prohibit or otherwise restrict CITY’s ability to suspend this Agreement as provided herein.

E. No waiver of any Event of Default or breach under this Agreement will constitute a waiver of any other or subsequent Event of Default or breach.

No waiver, benefit, privilege, or service voluntarily given or performed by a Party will give the other Party any contractual rights by custom, estoppel, or otherwise.

F. The duties and obligations imposed under this Agreement and the rights and remedies available hereunder will be in addition to and not a limitation of any duties, obligations, rights and remedies otherwise imposed or available by law. In addition to any other remedies available to CITY at law or under this Agreement in the event of any breach of this Agreement, CITY, in its sole and absolute discretion, may also pursue any one or more of the following remedies:
i. Upon written notice to CONSULTANT, the CITY may immediately terminate this Agreement in whole or in part;
ii. Upon written notice to CONSULTANT, the CITY may extend the time of performance;
iii. The CITY may proceed by appropriate court action to enforce the terms of the Agreement to recover damages for CONSULTANT’s breach of the Agreement or to terminate the Agreement; or
iv. The CITY may exercise any other available and lawful right or remedy.

CONSULTANT will be liable for all legal fees plus other costs and expenses 14 that CITY incurs upon a breach of this Agreement or in the CITY’s exercise of its remedies under this Agreement.

G. In the event CITY is in breach of this Agreement, CONSULTANT’s sole remedy will be the suspension or termination of this Agreement and/or the recovery of any unpaid sums lawfully owed to CONSULTANT under this Agreement for completed services and tasks.

5.3 SCOPE OF WAIVER: No waiver of any default or breach under this Agreement will constitute a waiver of any other default or breach, whether of the same or other covenant, warranty, agreement, term, condition, duty or requirement contained in this Agreement. No waiver, benefit, privilege, or service voluntarily given or performed by a Party will give the other Party any contractual rights by custom, estoppel, or otherwise.

5.4 SURVIVING ARTICLES, SECTIONS AND PROVISIONS: The termination of this Agreement pursuant to any provision of this Article or by normal expiration of its term or any extension thereto will not operate to terminate any Article, Section or provision contained herein which provides that it will survive the termination or normal expiration of this Agreement.

VI.

MISCELLANEOUS PROVISIONS

6.1 DOCUMENTS & DATA; LICENSING OF INTELLECTUAL PROPERTY: All Documents and Data will be and remain the property of CITY without restriction or limitation upon their use or dissemination by CITY. For purposes of this Agreement, the term “Documents and Data” means and includes all reports, analyses, correspondence, plans, designs, notes, summaries, strategies, charts, schedules, spreadsheets, calculations, lists, data compilations, documents or other materials developed and/or assembled by or on behalf of CONSULTANT in the performance of this Agreement and fixed in any tangible medium of expression, including but not limited to Documents and Data stored digitally, magnetically and/or electronically. This Agreement creates, at no cost to CITY, a perpetual license for CITY to copy, use, reuse, disseminate and/or retain any and all copyrights, designs, and other intellectual property embodied in all Documents and Data. CONSULTANT will require all subcontractors and subconsultants working on behalf of CONSULTANT in the performance of this Agreement to agree in writing that CITY will be granted the same right to copy, use, reuse, disseminate and retain Documents and Data prepared or assembled by any subcontractor or subconsultant as applies to Documents and Data prepared by CONSULTANT in the performance of this Agreement.

6.2 CONFIDENTIALITY: All data, documents, discussion, or other information developed or received by CONSULTANT or provided for performance of this Agreement are deemed confidential and will not be disclosed by CONSULTANT without prior written consent by CITY. CITY will grant such consent of disclosure as legally required. Upon request, all CITY data will be returned to CITY upon the termination or expiration of this Agreement. CONSULTANT will not use CITY’s 15 name or insignia, photographs, or any publicity pertaining to the Work in any magazine, trade paper, newspaper, television or radio production or other similar medium without the prior written consent of CITY.

6.3 FALSE CLAIMS ACT: CONSULTANT warrants and represents that neither CONSULTANT nor any person who is an officer of, in a managing position with, or has an ownership interest in CONSULTANT has been determined by a court or tribunal of competent jurisdiction to have violated the False Claims Act, 31 U.S.C., Section 3789 et seq. and the California False Claims Act, Government Code Section 12650 et seq.

6.4 NOTICES: All notices permitted or required under this Agreement will be given to the respective Parties at the following addresses, or at such other address as the respective Parties may provide in writing for this purpose:

CONSULTANT: CITY:

Willdan Engineering Inc.
13191 Crossroads Parkway
North, Suite 405
Industry, CA 91746-3443
Attn: Tyrone Peter
Phone: 562-908-6200
City of Cudahy
Administrative Services Department
5220 Santa Ana Street
Phone: 323-773-5143
Attn: Brenda Rodriguez
Such notices will be deemed effective when personally delivered or successfully transmitted by facsimile as evidenced by a fax confirmation slip or when mailed, forty-eight (48) hours after deposit with the United States Postal Service, first class postage prepaid and addressed to the Party at its applicable address.

6.5 COOPERATION; FURTHER ACTS: The Parties will fully cooperate with one another, and will take any additional acts or sign any additional documents as are reasonably necessary, appropriate or convenient to achieve the purposes of this Agreement.

6.6 SUBCONTRACTING: CONSULTANT will not subcontract any portion of the Work required by this Agreement, except as expressly stated herein, without the prior written approval of CITY. Subcontracts (including without limitation subcontracts with subconsultants), if any, will contain a provision making them subject to all provisions stipulated in this Agreement, including provisions relating to insurance requirements and indemnification.

6.7 CITY’S RIGHT TO EMPLOY OTHER CONSULTANTS: CITY reserves the right to employ other contractors in connection with the various projects worked upon by CONSULTANT.

6.8 PROHIBITED INTERESTS: CONSULTANT warrants, represents and maintains that it has not employed nor retained any company or person, other than a bona fide employee working solely for CONSULTANT, to solicit or secure this Agreement. Further, CONSULTANT warrants and represents that it has not paid nor has it agreed to pay any company or person, other than a bona fide employee 16 working solely for CONSULTANT, any fee, commission, percentage, brokerage fee, gift or other consideration contingent upon or resulting from the award or making of this Agreement. For breach or violation of this warranty, CITY will have the right to rescind this Agreement without liability. For the term of this Agreement, no member, officer or employee of CITY, during the term of his or her service with CITY, will have any direct interest in this Agreement, or obtain any present or anticipated material benefit arising therefrom.

6.9 TIME IS OF THE ESSENCE: Time is of the essence for each and every provision of this Agreement.

6.10 GOVERNING LAW AND VENUE: This Agreement will be interpreted and governed according to the laws of the State of California. In the event of litigation between the Parties, venue, without exception, will be in the Los Angeles County Superior Court of the State of California. If, and only if, applicable law requires that all or part of any such litigation be tried exclusively in federal court, venue, without exception, will be in the Central District of California located in the City of Los Angeles, California.

6.11 ATTORNEYS’ FEES: If either Party commences an action against the other Party, legal, administrative or otherwise, arising out of or in connection with this Agreement, the prevailing Party in such litigation will be entitled to have and recover from the losing Party reasonable attorneys’ fees and all other costs of such action.

6.12 SUCCESSORS AND ASSIGNS: This Agreement will be binding on the successors and assigns of the Parties.

6.13 NO THIRD-PARTY BENEFIT: There are no intended third-party beneficiaries of any right or obligation assumed by the Parties. All rights and benefits under this Agreement inure exclusively to the Parties.

6.14 CONSTRUCTION OF AGREEMENT: This Agreement will not be construed in favor of, or against, either Party but will be construed as if the Parties prepared this Agreement together through a process of negotiation and with the advice of their respective attorneys.

6.15 SEVERABILITY: If any portion of this Agreement is declared invalid, illegal, or otherwise unenforceable by a court of competent jurisdiction, the remaining provisions will continue in full force and effect.

6.16 AMENDMENT; MODIFICATION: No amendment, modification or supplement of this Agreement will be valid or binding unless executed in writing and signed by both Parties, subject to CITY approval. The requirement for written amendments, modifications or supplements cannot be waived and any attempted waiver will be void and invalid.

6.17 CAPTIONS: The captions of the various articles, sections and paragraphs are for convenience and ease of reference only, and do not define, limit, augment, or 17 describe the scope, content, or intent of this Agreement.

6.18 INCONSISTENCIES OR CONFLICTS: In the event of any conflict or inconsistency between the provisions of this Agreement and any of the exhibits attached hereto, the provisions of this Agreement will control.

6.19 ENTIRE AGREEMENT: This Agreement, including all attached exhibits, constitutes the entire, complete, final and exclusive expression of the Parties with respect to the matters addressed herein and supersedes all other agreements or understandings, whether oral or written, which may have been entered into between CITY and CONSULTANT prior to the execution of this Agreement. Any statements, representations, or other agreements, whether oral or written, made by either Party that is not embodied herein will not be valid or binding on the Parties. No amendment, modification or supplement to this Agreement will be valid and binding unless in writing and duly executed by the Parties pursuant to Section

6.16, above.

6.20 COUNTERPARTS: This Agreement will be executed in three (3) original counterparts each of which will be of equal force and effect. No handwritten or typewritten amendment, modification or supplement to any one counterpart will be valid or binding unless made to all three counterparts in conformity with Section

6.16, above. One fully executed original counterpart will be delivered to CONSULTANT and the remaining two original counterparts will be retained by CITY.
(SIGNATURES ON NEXT PAGE)
lN WITNESS WHEREOF, the Parties hereto have caused this Agreement to be executed the day and year first appearing in this Agreement, above.

CITY OF CUDAHY: Willdan Engineering lnc.

Noyola, Manager Vanessa Munoz
Date tl Title President
Date: 12t21t2022
APPROVED AS TO FORM:

City Attorney
Date
18 January 17, 2023
19 EXHIBIT “A”

CITY RFP

REQUEST FOR PROPOSALS (RFP)

TO PROVIDE DESIGN PHASE ENGINEERING SERVICES

FOR THE PREPARATION OF PS&E (PLAN, SPECIFICATIONS AND ESTIMATES)

FOR THE CUDAHY PARK RENOVATION PROJECT

IN THE CITY OF CUDAHY, CALIFORNIA
October 6, 2022

DELIVERY ADDRESS
City of Cudahy
5220 Santa Ana St,
Cudahy, CA 90201
Attn: Victor Maria Santiago
Parks and Recreation Manager

REQUIRED NUMBER OF PROPOSALS
Three (3) hard copies and one (1) electronic
copy (pdf)

CONTACT INFORMATION FOR INQUIRIES
contact via e-mail only, no telephone calls
Victor Maria Santiago
Parks and Recreation Manager
[email protected]

PRE-PROPOSAL MEETING
None

PROPOSAL DUE DATE
November 3, 2022; 3:00 PM
RFP to Provide Design Phase Engineering Services for The Preparation of PS&E (Plan, Specifications and Estimates) For the Cudahy Park Renovation Project
City of Cudahy, California Table of Contents
Table of Contents

1. Introduction 1

2. Project Description 1

3. RFP Schedule 2

4. Scope of Services 2

5. Key Personnel 3

6. City’s Standard Professional Services Agreement 4

7. Insurance Coverage Limits and Requirements 4

8. Consultant Selection Methodology 4

9. Contract Award 5

10. Required Format for Technical Proposal Submittal 5

11. Fee Estimate Proposal Submittal 6

12. Questions Regarding This RFP 8

13. Proposal Submittal Protocol 8

14. Pre-Contractual Expenses In Responding To The RFP Preparation 8 Attachments:

Attachment A – Affidavit of Non-Collusion
Attachment B – Claims History
Attachment C – Sample Professional Services Agreement
Attachment D – Insurance Requirements
Attachment E - Project Conceptual Scope
RFP to Provide Design Phase Engineering Services for The Preparation of PS&E (Plan, Specifications and Estimates) For the Cudahy Park Renovation Project
City of Cudahy, California Cover Page

REQUEST FOR PROPOSALS (RFP)

TO PROVIDE DESIGN PHASE ENGINEERING SERVICES

FOR THE PREPARATION OF PS&E
(PLAN, SPECIFICATIONS AND ESTIMATES)

FOR THE CUDAHY PARK RENOVATION PROJECT

IN THE CITY OF CUDAHY, CALIFORNIA
November 3, 2022
To interested and qualified Consultants:

The City of Cudahy is soliciting Proposals from qualified firms TO PROVIDE DESIGN PHASE

ENGINEERING SERVICES FOR THE PREPARATION OF PS&E (PLAN, SPECIFICATIONS AND ESTIMATES) FOR THE CUDAHY PARK RENOVATION PROJECT.

Requirements for this RFP are enclosed.

In order to be considered in the selection process, interested parties shall submit three (3) hard copies and one (1) electronic copy (pdf) of their Proposals no later than 3:00 PM, November 3, 2022, to:

Victor Maria Santiago
Parks and Recreation Manager
5220 Santa Ana St,
Cudahy, CA 90201
If you have any questions, please contact via email (no telephone calls):

Victor Maria Santiago
Parks and Recreation Manager
[email protected]
Late proposals will not be accepted.

Sincerely,
Victor Maria Santiago
Parks and Recreation Manager
City of Cudahy
RFP to Provide Design Phase Engineering Services for The Preparation of PS&E (Plan, Specifications and Estimates) For the Cudahy Park Renovation Project
City of Cudahy, California RFP, Page 1

REQUEST FOR PROPOSALS (RFP)

TO PROVIDE DESIGN PHASE ENGINEERING SERVICES

FOR THE PREPARATION OF PS&E (PLAN, SPECIFICATIONS AND ESTIMATES)

FOR THE CUDAHY PARK RENOVATION PROJECT

IN THE CITY OF CUDAHY, CALIFORNIA
November 3, 2022

1. INTRODUCTION
The City of Cudahy is soliciting Proposals from qualified firms TO PROVIDE DESIGN PHASE

ENGINEERING SERVICES FOR THE PREPARATION OF PS&E (PLAN, SPECIFICATIONS AND ESTIMATES) FOR THE CUDAHY PARK RENOVATION PROJECT.

2. PROJECT DESCRIPTION
The city has received a $6,902,951 Proposition 68 Statewide Park Development and Community Revitalization Program to renovate Cudahy Park. Total grant amount includes costs for pre-construction, design, construction, and construction management costs. The project focuses on parkwide renovation improvements such as renovating basketball, baseball, tennis courts, as well as the playground and skate park. Additions to the park include a community stage, splash pad, exercise equipment, picnic area, and shade structures. A copy of the concept designs is included in Attachment D.

The project is located in the City of Cudahy, adjacent to the Los Angeles River between Wilcox Avenue and River Road in Cudahy.

3. RFP SCHEDULE
Below is the RFP schedule. Below tentative schedule is subject to change by the City:

Request for Proposals Posted and Issued Thursday, October 6, 2022 Deadline for Receipt of Questions Thursday, October 20, 2022, 4:00 PM Addendum (if necessary) to Respond to
Questions
Monday, October 24, 2022
Deadline for Receipt of Proposals (RFP Due
Date)
Thursday, November 3, 2022, 3:00
PM
Contract Awarded by City Council (tentative) December 2022 RFP to Provide Design Phase Engineering Services for The Preparation of PS&E (Plan, Specifications and Estimates) For the Cudahy Park Renovation Project
City of Cudahy, California RFP, Page 2

4. SCOPE OF SERVICES
The project scope includes preparation of all necessary plans and to provide to the City a complete PS&E Bid Package ready for bidding. The following description of work defines the general project requirements. Associated tasks and provisions necessary for a complete project, but not specifically defined herein are to be addressed in the proposal and undertaken within the proposed “Not to Exceed” contract fee.

The following scope of services is provided as a general guidance.

The proposers shall provide a detailed scope of services to provide all necessary services to complete the project in compliance with applicable, standards and requirements and provide the City a complete set of plans, specifications and estimates ready for bidding and provide necessary support services during bidding and construction phases.

Phase 1. PS&E Phase Services:
▪ Kickoff and Ongoing Meetings: Meet with City staff at the beginning of project and routinely during this phase to review design components and ensure milestones are being met. Discuss exploring different options for skate park design (Pre-manufactured vs. in-ground skate park).
▪ Assemble Existing Data: Assemble and review available information pertaining to the project, including existing survey data, as-built improvement plans, City map, aerial photographs, utility information, and other available record data. ▪ Field Surveys: Field reviews will be performed to identify and/or verify existing conditions such as potential utility conflicts, etc.
▪ Utility Coordination/Notices: Coordinate with the utility companies in order to identify all existing underground and overhead utility lines which may interfere with the installation of proposed park equipment/amenities. For electrical services, coordinate with Southern California Edison Company. Consultant shall be responsible to send out preliminary utility notices to all utility companies, obtaining utility maps and plans, showing all utilities on the plans and sending final utility notices when the plans are approved.
▪ PA & ED (Environmental Studies and Permits): Prepare project approval and environmental documents to comply with applicable regulatory agencies (NEPA/CEQA requirements, etc).
▪ PS&E (plans, specifications, estimates): Prepare complete Plans, Specifications, and Estimates (PS&E). Include architectural renderings of proposed improvements. Submittals include 30%, 60%, 90% and 100% submittals. Plans must meet all project requirements and limitations, include those RFP to Provide Design Phase Engineering Services for The Preparation of PS&E (Plan, Specifications and Estimates) For the Cudahy Park Renovation Project
City of Cudahy, California RFP, Page 3
of the landowners, grant guidelines, local, state, and federal regulations, and those created by existing conditions such as existing utility facilities. ▪ Review land-use covenant between City of Cudahy and Department of Toxic Substances Control (DTSC) and Remediation Plan. Provide recommendations to ensure project design compliance with restrictions.
▪ Permitting: Receive approvals and permits from all required parties, including, LA County Fire, City of Cudahy, and any other involved regulatory agency. ▪ Council Presentation: Attend Council Meeting for approval of design plans before preparation of final working documents.

Design phase shall be completed within 4 months of issuance of City’s NTP.

Final Product: PS&E Bid Package ready for bidding, including one wet signed plan set, two hard copies, AutoCAD file of plans, hard copy and Ms Word file of Specifications, hardy copy and, Excel file of Estimates, pdf file of all other documents.

Phase 2. Bidding Phase Services:

The Consultant shall provide necessary support services, including but not limited to:
• Attending pre-bid meeting (1 assumed).
• Responding to bidder’s questions.
• Provide bid analysis. Review bid costs/schedule of values of 3 low bidders, and inform City if the costs are in line with estimates. • Recommend lowest and responsive bidder.

Phase 3. Construction Phase Services:
• Provide support to City’s on-site Construction Manager to answer questions and clarifying items which relate to the PS&E package prepared by the consultant. • When requested, review and approve construction submittals and shop drawings to be submitted by the contractor as per the PS&E package.

Phase 4. Additional Construction Phase Services:

On-call construction support services as City deems necessary, which may include but RFP to Provide Design Phase Engineering Services for The Preparation of PS&E (Plan, Specifications and Estimates) For the Cudahy Park Renovation Project
City of Cudahy, California RFP, Page 4
not be limited to the following tasks:
• When requested, attending monthly construction meetings with the City’s Construction Manager, contractor, and other involved parties. • When requested, reviewing contractor change order requests, and providing necessary information to the City’s Construction Manager as they relate to the consultant’s design.
• When requested, attending project walk-throughs and assisting in preparation of punch list(s).

5. KEY PERSONNEL
It is imperative that the key personnel providing the consulting services have the background, experience, and qualifications to complete the project. The City reserves the right to approve all key personnel individually for work on this contract. All key staff shall be named in the contract. After the contract is signed, the proposer may not replace key staff unless their employment is terminated or agreed upon by the City. The City must approve replacement staff before a substitute person is assigned to the Project.

The City reserves the right to request that the proposer replace a staff person assigned to the contract should the City consider such a replacement to be for the good of the project.

6. CITY’S STANDARD PROFESSIONAL SERVICES AGREEMENT
The RFP includes a sample of City’s Professional Services Agreement as Attachment C.

Proposers shall review the Agreement and provide a statement that they will comply with all aspects of the Agreement, or provide any comments that they would like the City to consider. The City Attorney will review any comment received and make a final decision if all or part or any of such comments may be considered.

7. INSURANCE COVERAGE LIMITS AND REQUIREMENTS
Consultant shall provide Insurance Coverage Limits and Requirements as indicated in this RFP as provided in Attachment D.

RFP to Provide Design Phase Engineering Services for The Preparation of PS&E (Plan, Specifications and Estimates) For the Cudahy Park Renovation Project
City of Cudahy, California RFP, Page 5

8. CONSULTANT SELECTION METHODOLOGY
Upon receipt of Proposals, City’s consultant selection committee will rank the responding consultants. The City, at its sole discretion may invite top 3 ranked qualified consultants to for interviews, or negotiate final scope and fee with the most qualified consultant.

Evaluation Criteria Max
Points
Compliance with the RFP Requirements 15
Project Understanding and Approach 25
Experience 25
Level of effort, schedule and cost effectiveness to provide efficient services. 35
Total Points 100

9. CONTRACT AWARD
Any contract resulting from this RFP will be awarded to a firm whose Proposal meet the technical requirements of the RFP and is evaluated as the highest ranked proposal.

Proposals will be ranked in accordance with the evaluation criteria stated in this RFP.

Negotiations regarding a fair and reasonable price will occur subsequent to consultant selection. Should the City be unable to obtain a fair and reasonable price through negotiations with the highest qualified proposer, the City shall enter into negotiations with the next highest qualified proposer and may award that contract if the parties are able to arrive at a fair and reasonable price. If that is unattainable, the City shall enter into negotiations with the next highest qualified proposer in sequence until an agreement is reached.

10.REQUIRED FORMAT FOR TECHNICAL PROPOSAL SUBMITTAL
Please submit your Technical Proposal in the format specified below:

1. Cover Letter:

Emphasize strong points of the project team and the firm’s experience. Include the name, address, telephone number, title, and signature of the firm’s contact person for this proposal. The cover letter shall state that the submittal is valid for 90 days.

2. Project Specific Approach, Scope of Work:

RFP to Provide Design Phase Engineering Services for The Preparation of PS&E (Plan, Specifications and Estimates) For the Cudahy Park Renovation Project
City of Cudahy, California RFP, Page 6
Provide your understanding of the project, and describe your approach to accomplishing the City’s goal in the most efficient and cost effective manner (including AQ/QC control).

Note: It is expected that the Firms should not simply restate the information contained in this RFP; rather identify critical issues in implementing the proposed improvements, and provide an approach to resolving such critical issues the most efficient and cost effective manner.

3. Proposed Project Specific Staff:

This section should include a project organization chart showing proposed staff members and any subconsultants, and resumes of key project persons. It is imperative that the key personnel providing the required services have the background, experience, and qualifications in similar projects.

4. Similar Projects and References:

Provide a list of similar projects where your firm and proposed project staff have provided similar services. Also provide minimum 3 Public Agency references that City can contact for similar projects and services.

5. City Standard Contract:

The RFP includes City’s Standard Contract as Attachment. Proposers shall review the Agreement and provide any comments that they would like the City to consider.

6. Required Attachments:

Below attachments shall be signed and submitted with the proposal:
• Attachment A - Affidavit of Non-Collusion
• Attachment B - Claims History
The Fee Proposal shall be submitted in a separate envelope as indicated in the following section.

11.FEE ESTIMATE PROPOSAL SUBMITTAL
The Fee Estimate Proposal shall be submitted in a separate sealed envelope. The fee shall be broken in major project components and phases.

RFP to Provide Design Phase Engineering Services for The Preparation of PS&E (Plan, Specifications and Estimates) For the Cudahy Park Renovation Project
City of Cudahy, California RFP, Page 7
Consultant shall also provide its Schedule of Standard Hourly Fee Rates to determine pricing for on-call construction support services.

12.QUESTIONS REGARDING THIS RFP
All questions regarding this RFP must be submitted via email:

Victor Maria Santiago
Parks and Recreation Manager
[email protected]
Questions regarding this proposal shall be submitted via email no later than 10 calendar days prior to proposal due date. In response to all questions received by this date, City will issue an Addendum no later than 5 calendar days prior to the proposal submittal due date. The addendum will be emailed to all RFP recipients on record.

13.PROPOSAL SUBMITTAL PROTOCOL
In order to be considered in the selection process, interested parties shall submit three (3) copies and one (1) electronic copy (pdf) of their Proposals no later than 3:00 PM, November 3, 2022 to the following address:

Victor Maria Santiago
Parks and Recreation Manager
5220 Santa Ana Street
Cudahy, CA 90201
Late proposals will not be accepted.

15.GENERAL INFORMATION
A. Public Record – All proposals submitted in response to this RFP will become the property of the City upon submission and a matter of public record pursuant to applicable law. City reserves the right to make copies of all proposals available for inspection and copying by interested members of the public as records of the City and City shall be under no obligation to the Proposer to withhold such records. In so far as a proposal contains information that the Proposer regards as proprietary and confidential, it shall be the responsibility of the Proposer (and not the City) to specifically identify which items of information are proprietary and clearly identify in writing which specific pieces of information RFP to Provide Design Phase Engineering Services for The Preparation of PS&E (Plan, Specifications and Estimates) For the Cudahy Park Renovation Project
City of Cudahy, California RFP, Page 8
are proprietary. It shall be insufficient for the Proposer to merely identify the entire proposal or an entire page or set of pages of proprietary. With respect to information deemed proprietary, the procedures set forth under subsection (T) below shall be observed. Not-to-exceed sums, hourly rates and the like that may be set forth in a proposal shall not constitute proprietary information nor shall any information readily available to the general public or any other information not regarded as proprietary and confidential under federal or state law.

B. Right to Request Additional Information – During the evaluation process the City reserves the right, where it may serve the City’s best interest, to request additional information or clarifications from Proposers, or to allow corrections of errors or omissions. At the discretion of the City, firms submitting proposals may be requested to make oral presentations as part of the evaluation process.

C. Reserving Rights - The City reserves the right to reject any and all proposals received as a result of this RFP. City’s potential award of a contract will not be based on any single factor nor will it be based solely or exclusively on the lowest cost proposal. If a contract is awarded, it will be awarded to the proposer who in the judgment of the City has presented an optimal balance of relevant experience, technical expertise, technological innovation, price, quality of service, work history and other factors which the City may consider relevant and important in determining which proposal is best for the City.

D. Discrimination - The Proposer and all subcontractors must not discriminate, nor permit discrimination against any person on the grounds of race, national origin, sex, handicap, sexual orientation, or veteran status in their employment practices, in any of their contractual arrangements, in all services and accommodations they offer the public or in their business operations.

E. Gratuity Prohibition - Proposer shall not offer any gratuities, favors or anything of monetary value to any official, employee or agent of the City for the purpose of influencing consideration of this proposal.

15.PRE-CONTRACTUAL EXPENSES IN RESPONDING TO THE RFP PREPARATION The City shall not be liable for any pre-contractual expenses incurred by any proposer or by any selected consultant. Each proposer shall protect, defend, indemnify, and hold harmless the City from any and all liability, claims, or expenses whosoever incurred by, or on behalf of, the entity participating in the preparation of its response to this RFP. Precontractual expenses are defined as expenses incurred by proposers and the selected consultant, if any, in:
▪ Preparing and submitting information in response to this RFP RFP to Provide Design Phase Engineering Services for The Preparation of PS&E (Plan, Specifications and Estimates) For the Cudahy Park Renovation Project
City of Cudahy, California RFP, Page 9
▪ Negotiations with the City on any matter related to this procurement ▪ Costs associated with interviews, meetings, travel or presentations ▪ All other expenses incurred by a proposer/consultant prior to the date of award and a formal notice to proceed.

The City reserves the right to amend, withdraw and cancel this RFP. The City reserves the right to reject all responses to this request at any time prior to contract execution, or only award a partial contract for a limited scope of work. The City reserves the right to waive minor irregularities and request or obtain additional information about any and all proposals.

END OF RFP

ATTACHMENTS TO FOLLOW

Attachment A Affidavit of Non-Collusion
Attachment B Claims History
Attachment C Sample Professional Services Agreement
Attachment D Insurance Requirements
Attachment E Project Conceptual Scope

ATTACHMENT A

AFFIDAVIT OF NON-COLLUSION
I state that I am _____________________________________ (title) of __________________________________ (name of firm) and that I am authorized to make this affidavit on behalf of my firm, and its owners, directors, and officers. I am the person responsible in my firm for the price(s) and the amount of this Offer.

I state that:
(1) The price(s) and amount of this Offer have been arrived at independently and without consultation, communication or agreement with any other Proposer or potential Proposer. (2) That neither the price(s) nor the amount of this Offer, and neither the approximate price(s) nor approximate amount of this Offer, have been disclosed to any other firm or person who is a Proposer or potential Proposer, and they will not be disclosed before Solicitation opening. (3) No attempt has been made or will be made to induce any firm or person to refrain from bidding on this contract, or to submit an Offer higher than this Offer, or to submit any intentionally high or noncompetitive Offer or other form of complementary Offer. (4) The Offer of my firm is made in good faith and not pursuant to any agreement or discussion with, or inducement from, any firm or person to submit a complementary or other noncompetitive Offer. (5) ________________________________________ (name of firm), its affiliates, subsidiaries, officers, directors and employees are not currently under investigation by any governmental agency and have not in the last four years been convicted of or found liable for any act prohibited by State or Federal law in any jurisdiction, involving conspiracy or collusion with respect to bidding on any public contract, except as described in the attached appendix.

I state that________________________________________ (name of firm) understands and acknowledges that the above representations are material and important, and will be relied on by the City of Cudahy in awarding the contract(s) for which this Offer is submitted. I understand and my firm understands that any misstatement in this affidavit is and shall be treated as fraudulent concealment from the City of Cudahy of the true facts relating to the submission of Offers for this contract.
_________________________________________________
(Authorized Signature)
_________________________________________________
(Name of Company/Position)
Sworn to and subscribed before me this _______ day of __________________, 20___. _________________________________________________
Notary Public for California
My Commission Expires: ______________________

ATTACHMENT B

CLAIMS HISTORY
Each Consultant shall submit a summary of whether or not any of the following events have occurred within the past (10) years and, if so, a brief description of the circumstances involved (including, without limitation, the names of parties involved, current status and final disposition of the matter of dispute):

Failure to disclose any circumstances requested in the following paragraphs is grounds for disqualification.
▪ Failure by Consultant or any sub-consultant to enter into a contract to which it has received an award by a public entity.
▪ Forfeiture of a bid or proposal bond by proposer or any sub-consultant. ▪ Termination for default under a contract awarded by a public entity to Consultant or any sub-consultant.
▪ Debarment of Consultant or any sub-consultant by any municipal, county, state, federal, or local agency (note: debarment is grounds for automatic disqualification). ▪ The filing of a lawsuit or arbitration in which the Consultant or a sub-consultant was a defendant or cross-defendant at any time within the past ten (10) years that involved the performance of project, program, or engineering services and that involved an amount in controversy sought to be recovered from Consultant or the sub-consultant of more than $100,000.00.
▪ Conviction of Consultant, a sub-consultant, or any of their principals or officers for violation of a state or federal antitrust law involving bid rigging, collusion, or restriction on competition between bidders, or conviction of violating any other federal or state law relating to bidding or contract performance (note: such conviction is grounds for automatic disqualification).
▪ Any publications involving firm or principals alleging or claiming corruption (such claims are grounds for automatic disqualification).
▪ Any suspension, revocation, or other disciplinary proceeding relating to a contracting or professional license issued to proposer or a sub-consultant.

ATTACHMENT C
Professional Services Contract

ATTACHMENT D
Insurance Requirements

ATTACHMENT E
Project Conceptual Scope
20 EXHIBIT “B”

CONSULTANT PROPOSAL
City of Cudahy
Proposal
Provide Design Phase Engineering
Services for the Preparation of PS&E for
the Cudahy Park Renovation Project
November 3, 2022
Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation ii
City of Cudahy
Table of Contents

1. Cover Letter .............................................................................................................................................................. 1

2. Project Specific Approach, Scope of Work................................................................................................................ 3 Introduction............................................................................................................................................................... 3 Firm’s Understanding of Objectives .......................................................................................................................... 5 Proposed Improvements – Discussion on the Major Items................................................................................... 6 Key Issues............................................................................................................................................................... 8 Project-Specific Approach.......................................................................................................................................... 9 Scope of Work .........................................................................................................................................................12

3. Proposed Project Specific Staff..............................................................................................................................18 Organizational Chart................................................................................................................................................18 Project Staffing ........................................................................................................................................................18 Subconsultants ........................................................................................................................................................19 Key Project Team Members.....................................................................................................................................21 Resumes...................................................................................................................................................................23

4. Similar Projects and References ............................................................................................................................45

5. City Standard Contract...........................................................................................................................................51

6. Required Attachments...........................................................................................................................................52 Attachment A – Affidavit of Non-Collusion .............................................................................................................52 Attachment B - Claims History................................................................................................................................. 54 In accordance with the City’s RFP, Willdan’s Fee Estimate Proposal has been submitted in a separate sealed envelope.

1. Cover Letter
November 3, 2022
City of Cudahy
5220 Santa Ana Street
Cudahy, CA 90201
Attn: Victor Maria Santiago
Parks and Recreation Manager
Subject: Proposal for Design Phase Engineering Services for the Preparation of PS&E (Plan, Specifications and Estimates) for the Cudahy Park Renovation Project The City of Cudahy is interested in contracting with an experienced and qualified firm to provide professional design services for the Cudahy Park renovations. Willdan’s qualifications include:

Industry Leader with Significant Park Renovation Experience Willdan Engineering (Willdan), a Southern California-based firm, has been a consistent industry leader for more than 58 years providing all aspects of municipal and infrastructure engineering, building and safety, public works, public financing, planning, and construction management services. Willdan has assembled a team who are committed to providing top-quality services to the City of Cudahy (City). We believe that we are highly qualified to undertake this assignment because of the special challenges involved in the project.

Deep Understanding of the City’s Requirements
Willdan thoroughly understands the City’s priorities and processes. We currently have staff working at the City through our On-call City Engineering contract including our proposed Technical Advisor Mr. Sal Lopez, who is serving as the City’s Community Development Director. During the last five-plus years, Mr.

Lopez has shepherded the adoption of the City’s General Plan and Zoning Code update, successfully acquiring grant funding to support the update to the city’s Housing Element and the adoption of an Inclusionary Housing Element. He continues to assist the City with their Successor Agency needs, and was instrumental in the City’s pursuit of Proposition 68 funding for the proposed improvements to Cudahy Park. He is very familiar with the site and its opportunities and challenges.

Strong and Talented Leadership
Leading our Willdan team, as the Project Manager, is Mr. John Hidalgo. Mr. Hidalgo’s background is a blend of public and private practice. He is very experienced in park planning, sports facilities, recreational developments, residential, streetscape and urban beautification projects; as well as regional, community, and neighborhood parks. Mr. Hidalgo will be fully supported by our in-house staff of civil, geotechnical, planning and construction management professionals.

Willdan’s proposed personnel are all experienced in working as an integral part of agency staff and, therefore, are familiar with municipal standards, guidelines, and procedures. This knowledge and experience will allow Willdan to be most responsive to your requirements. As a multidisciplinary firm, we have a full complement of resources under one roof to provide thorough and accurate design and project management.

City of Cudahy
Cudahy Park Renovation Project

Page 2 ends

Specialty Consultants
Augmenting our Willdan staff our four specialty subconsultants with experience and qualifications in the City’s scope of work. M Y Engineering, Inc. (Electrical and Lighting Design) is a professional consulting engineering firm providing full mechanical, electrical, plumbing (MEP) on-call engineering services. ELMT (Contaminated Soils) has 50+ years of experience providing timely and cost-effective environmental solutions and planning services. Spohn Ranch (Skate Park Design) is an award-winning skate park designbuild firm with 30 years of municipal skate park projects spanning 40+ states in the nation. AWu Government Services (Architectural Design) is a full-service architectural firm with a professional staff of architects, planners, and design specialists who have completed over 2,000 projects for over 50 different municipalities/public agencies.

Highly Relevant Park Renovation Experience
Willdan has provided landscape architectural design services for a vast number of park renovations, including:
 Children’s play areas
 Walking trails
 Sports fields
 General recreational facilities
modifications
 Shade shelters
 Fitness facilities
 Water play
 Skate parks
Our experience also includes over 40 public use facilities with similar features including recreational and fitness facilities, residential uses, schools, bike paths, redevelopment districts, city beautification projects, and high-profile multi-use venues including Artesia Live I and II Specific Plans and the new Sofi Stadium in Inglewood.

As Principal-in-Charge, I will ensure Willdan Engineering resources are made available to meet the needs of the project task assignments and will be available to the City throughout the duration of the contract.

Willdan acknowledges the receipt of the City’s Response to Q&A and the Land Use Covenant issued on 10/27/2022. Willdan’s submittal is valid for 90 days.

If you have any questions or need additional information, you may contact me at 657-223-8557 and/or by email at [email protected]. You may also contact Mr. Hidalgo at (562) 364-8505 and/or by email at [email protected]. I hope we convey herein our sincere interest in working with the City, and I look forward to further discussing how Willdan Engineering may continue to assist you with meeting your park renovation goals for this contract.

Respectfully submitted,

WILLDAN ENGINEERING
Tyrone Peter, PE
Deputy Director of Engineering
2401 E. Katella Avenue, Suite 300
Anaheim, CA 92806
P: (657) 223-8557
Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
3 2. Project Specific Approach, Scope of Work
Introduction
Willdan Engineering (Willdan), a California Corporation, is part of Willdan Group, Inc. (WGI), a NASDAQ publicly traded Delaware Corporation and nationwide firm serving more than 800 public agencies and private sector clients. Founded in 1964
and headquartered in Anaheim,
California, Willdan was originally
established as a civil engineering firm
specializing in providing solutions for
our public agency clients. Since that
time, we have evolved into a
professional consulting firm offering a
broad array of services that allows us
to provide a comprehensive and
integrated approach to our clients’
planning, engineering, financial,
economic, public facility, public safety,
and energy sustainability solutions.

Today, Willdan has over 1,500 employees operating in 56 offices across 26 states. We have supported the implementation of community visions through engineering, construction management, inspection, planning, building safety, and staff augmentation services. Willdan has completed various types of projects for over 90 percent of the cities and counties in California.

Throughout our 58-year history, Willdan has sustained consistently healthy financial performance.

Willdan has the financial strength and wherewithal to complete all projects we undertake. This is due, in part, to a respected reputation in the municipal engineering industry for providing timely, cost-effective, innovative engineering solutions that exceed our clients’ expectations and for providing exceptional customer service to our many clients. The firm has the resources and appropriate staffing to perform and complete all contractual project obligations. Financial information, including information on revenue, earnings, and cash flow, is issued quarterly and can be found on the Investors page of our website at https://ir.willdangroup.com/.

Willdan possesses expertise in most facets of the public sector marketplace. The varied experience and background of our staff experience is an added value of our services. No other firm matches Willdan’s combined breadth of directly relevant technical and operational expertise and depth of experience.

Willdan's corporate-wide capabilities include a full range of civil and structural engineering, land planning, financial and economic consulting, geology and geotechnical engineering, environmental health and safety, and energy efficiency solutions consulting services.

We provide professional services in all phases of City activities from project development, grant funding application assistance and administration, site analysis, and conceptual development to final design, construction management, observation, and project close-out.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
4 Willdan Staff of Experts
 Municipal Engineering and Management
 Highway and Freeway Engineering
 Building Safety Services
 Environmental Planning
 Geotechnical/Geological Engineering
 Assessment Engineering
 Computer-Aided Analysis and Design
 Geographical Information System (GIS)
 Program and Construction Management
 Construction Inspection and Support
 Traffic and Transportation
 Water and Wastewater
 Urban and Regional Planning
 Drainage and Flood Control
 Structural Engineering
 Right-of-Way Engineering
 Landscape Architecture
Among all the services we provide, Willdan’s Landscape Architecture Department plays a key role in providing a unique sense of place for our clients in developing their park projects.

Landscape Architecture
Willdan has registered landscape architects with support personnel. In developing quality projects and plans, these landscape architects apply their talents and knowledge in site analysis, user needs programming, site design, urban design, landscape preservation, park master planning, land management, and water conservation. With their combined experience on almost 70 major parks, mostly in California, our landscape architects offer an essential array of services and expertise that adds long-term value to projects and communities.

Willdan’s landscape architects enjoy the support of related disciplines such as survey, civil, structural, traffic engineering, building and safety, environmental and construction management and observation.

In-house peer review at critical stages is practiced.

Unlike most firms, Willdan works primarily for governmental entities, thereby minimizing potential conflicts of interest. Willdan’s staff assists its clients to economically streamline projects from concept through planning, design, construction and management. This approach ensures long-term relationships with the jurisdictions we service and allows Willdan to add the necessary staffing to meet the needs of our clients and maintain mutually beneficial relationships.

Services
The list below illustrates services that are currently offered by Willdan’s landscape architectural group:

Design
 Recreation Facilities
 Park and Master Plans
 Urban Beautification
 Bidding and Construction
Documents
 Design Manual and
Guidelines
 Irrigation Systems
Inventories
 Drought Adaptive
Plantings
Urban Forestry
 Street Tree Inventory
 Arboriculture
Landscape Management
 Construction and Administration
 Plan Check Services
 Maintenance Specifications
Planning
 Site
 Urban
Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
5 Firm’s Understanding of Objectives
In general, it is the City’s goal to transform the existing park into an aesthetically pleasing productive park with the installation of a variety of amenities and uses that a broad spectrum of the community can benefit from and utilize. Cudahy Park is estimated at 5.9 acres. The entire Cudahy complex encompasses an estimated 8 acres. The complex includes the civic center such as City Hall, a branch of the Los Angeles County Public Library system and a community building for multi-purpose uses named Bedwell Hall. The shape of the site is primarily rectangular with a relatively flat topography with mature trees. The park site is bordered by residential, an elementary school and the Los Angeles River. The existing park has mature trees; therefore, careful attention will be made to protect in place those trees and design the improvements away from any root intrusion. A few of the trees will need to be removed to accommodate the new improvements.

The City conducted a series of community workshops to obtain input and feedback regarding the planning for the renovations. A final schematic site plan was prepared and accepted by the community and City representatives. The funding for the improvements is made available through a Statewide Park Development and Community Revitalization Grant program in the amount of $6.9 million.

It is our understanding, based on the City-furnished schematic plan, the City would like the following improvements at Cudahy Park:
 New shaded all-inclusive ADA accessible playground
 New ADA-accessible drinking fountains
 New trash receptacles and bench seating
 New stage
 Renovate the basketball courts
 Renovate the multi-purpose fields
 Renovate the tennis courts
 Renovate the skate park
 Renovate the playground
 New shaded splash pad
 New walking trails
 New shaded fitness stations
 New area lighting
 New shaded area for picnic tables and barbeques
 Upgrade irrigation system to meet California Model Water Efficient Landscape Ordinance (MWELO), e.g., “Smart” technology
 The installation of a planting palette consisting of trees, shrubs and groundcovers that are California native and drought-adaptive species for this geographic region of the Los Angeles basin
Additionally, it is our understanding that the park site currently has onsite parking and offsite parking.

Our scope of work will include reviewing the existing park for ADA-compliant parking stalls and ADA path of travel routes to the various park amenities.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
6 Furthermore, Willdan understands that the City has in place a “Covenant to Restrict Use of Property” (recorded in Los Angeles County) between the Department of Toxic Substances Control. Two locations within the park project limits will require specific requirements regarding the development in those respective areas.

Proposed Improvements – Discussion on the Major Items
Playground and Fitness Stations. The playground equipment will be selective based on an all-inclusive playground system that promotes a high-value experience for the various age groups. These play systems will encourage and challenge the park user. Additionally, the play equipment can improve coordination and strength along the way.

The exercise stations will be selected based on accessibility and ease of use to accommodate multiple types of physical fitness levels for strength building and coordination. Additionally, the selection of the equipment will be based on a fitness circuit approach that can be utilized by the users as an option.

Rubberized Surfacing. The surface material for the playgrounds and fitness areas will be the latest technology in rubberized components and one that is sustainable and produced with recycled materials.

The surface material will be one of having long-lasting durability and wearability and having the proper coefficient of friction suitable for this type of play and exercise value.

Walkways and Park Lighting. These areas are designed per Illumination Institute Standards (IES) with special attention paid to energy efficiency. We have started to use L.E.D. fixtures in addition to the standard Metal Halide approach when cost effective. Time clocks and photo-cell control will also be included, along with vandal resistance and glare. The lighting fixtures will be selected based on the latest advanced technology in lighting efficiency. Reducing glare to adjacent properties is especially important and will be controlled through fixture type and aiming. The optimum light direction will be determined to set the pole heights, the pole placement, and the light levels required for this park site Basketball Courts, Tennis Courts and Multi-Use Fields. The multi-use fields will be designed with the latest technology in sub-soil base and amendments for proper drainage and moisture retention. The basketball and tennis courts’ design will be a regulation size full court size with a non-slip surfacing suitable for outdoor play. The proper placement of expansion joints and control joints enables resistance for concrete crack control.

Sports Lighting. The lighting fixtures will be selected based on the latest advanced technology in lighting efficiency. Reducing glare to adjacent properties is very important and will be controlled through fixture type and aiming. Due to various leagues using these fields, the optimum “class of play” must be determined to set the pole heights, the pole placement, and the light levels required for the most restrictive use. This can be determined after meetings with the stakeholders and City staff.

Picnic Shade Shelters and Community State Architectural Design. Willdan will be utilizing the services of a design-build and manufacturing company that specializes in pre-engineered shade shelters and community stage coverings. As we have learned in past projects, this is a cost-effective and timesensitive approach for this type of construction in a park environment. The manufacturing company makes available many options and amenities that allow for a customized appearance. The shelters will be designed with the most current in construction materials technology. Special attention will be placed on the use of recycled materials for the shelters. For lighting consideration, the use of photovoltaic (solar) systems will be implemented. The specified products and materials for the shelter will be the latest in "Green" technology and efficiency.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
7 Walking Paths and General Pedestrian Circulation. Many park users come to this park for both sports and leisure activities. Willdan's design will look at the walking paths throughout the improvement areas and ensure the pathway network has a continuous paved surface. This pathway will include access from the street and other various locations. In addition, these improvements will facilitate a designated pathway for the pedestrian, thus offering a safe and understood environment within the park site.

Furthermore, the walks/pathways will be designed to comply with current guidelines under the Americans with Disabilities Act (ADA).

Energy Conservation. Consideration will be given to any concepts the City would like used, including photo-voltaic solar systems and LED lighting. Other emerging technologies will be used as they become cost-effective.

Irrigation and Planting. The development of the landscape design will incorporate all aspects of local and state water conservation standards, including meeting the requirements of the California Model Landscape Efficient Ordinance (MWELO). The turf species selected for the open field use will be for its low maintenance, good durability, fast recovery, pest resistance and suitability for this particular geographic region. It has been our experience that the second most important aspect of turf fields (first being irrigation coverage) is the backfill mix within the root zone. Having the proper mixture of organic and inorganic materials in the soil mix allows adequate percolation as well as inhibits soil compaction.

Furthermore, the routine maintenance of soil amendments, such as humate soil conditioners, strengthens the turf for drought tolerance, durability and recovery.

The tree, shrub and groundcover palette will be comprised of drought-tolerant species suitable for the geographic area, along with a well-designed irrigation system that delivers the highest efficiency. All plants will be chosen based on low maintenance requirements such as trimming/pruning cycles, mowing, fertilization needs, and hardiness. Willdan has demonstrated experience in integrating drought-tolerant and low-maintenance plant materials in major urban designs such as sports complexes, city streetscapes, freeways and demonstration gardens.

For the irrigation systems, careful analysis and assessment will be considered. New irrigation mainlines and points of connection (meter and backflow prevention location) will be part of the renovations, along with all new sprinklers/dripline/rotors that achieve maximum water distribution to the planting material. This will start a clean slate for many years to come.

Site Amenities. Along with these major improvements, simple amenities such as bicycle racks, trash receptacles, drinking fountains, and benches will be incorporated into the park site. In addition, overhead shading structures are planned for the playground and picnic table. All these amenities noted will be selected based on sustainability materials, ease of replacement parts and durability for public park use.

Splash Pad. The splash pad design will include a variety of experiences for the users. Options will be presented to the City prior to the final design. The water output among the various spray fountains and water collection buckets will offer unique play values. The mechanical equipment such as pumps, sanitizing reservoirs, filters, and electronics will be the latest technology in efficiency and water conservation.

Bioswales. Willdan will include an analysis and design to include bioswale facilities within the park in accordance with the guidelines outlined in the LA County LID Manual.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
8 Water and Sewer Improvements. Willdan will include water and sewer design for connections and pipelines to service the splash pad and drinking fountains in accordance with the water purveyor and County of Los Angeles Department of Health Standards.

Key Issues
Willdan identifies the following “key” issues that may be encountered on the Project based on our prior experiences.

Utilities
Willdan’s initial review of existing utilities within the project area will be conducted based on available contract documents or as-built plans from City and County records. Utilities that appear to be impacted by the project will be identified, field verified and discussed with the utility owner so that both physical and cost impacts can be appropriately addressed in the design. Willdan will coordinate and maintain a liaison with known area utilities. Potholing for underground utilities impacted by subsurface construction activities may be necessary to determine actual depths and locations of known utilities (this will be performed as additional services if necessary). Willdan will send notifications to utility companies so that planned utility installations are performed prior to park construction. In addition, Willdan will submit a set of preliminary plans to each affected utility company for comments and coordinate the potholing of utilities that interfere with proposed improvements, either by the utility company or by an independent contractor as extra work if the utility has prior rights. Furthermore, we will submit a set of final plans to each affected utility company with final notification for the completion of utility work. Finally, Willdan will provide the City with a brief written summary of the utility coordination status upon delivery of final construction contract documents to the City.

Site Grading and Drainage and Topographic Survey
In general, the park site topography is relatively flat, and all four sides of the site are bounded by hardscape surfaces, e.g., asphalt paving, and concrete sidewalks. For this reason, site grading will be straightforward, with the goal of ensuring sufficient slope to maintain drainage and the retention of current drainage patterns. Some of the modifications will include area drain relocation and additions. A topographic survey will be performed to document current conditions such as existing grades, surface culture and any other existing items/structures, along with assisting with designing/placement of the new developments, e.g., community stage.

Water quality management measures will be implemented for this project. Those structures include bio-swales and stormwater filtration chambers. Furthermore, Willdan will work closely with the jurisdictions/agencies of the storm drainage system involved in the adjacent/vicinity of the park site.

Post Construction
Along with a well-thought-out design, the long-term effects regarding the maintenance of the facilities are a consideration we feel is highly important. An area may appear to be optimal, but the cost of maintenance is a question that sometimes gets overlooked. Our design will address maintenance concerns, such as low, medium or high maintenance, along with budgets to consider. Willdan believes good, effective design should be compatible with reasonable maintenance costs. Such elements of the design we look at include planting material selection, paving materials and transitions, and general access for serviceability.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
9 Tree Preservation
Willdan will make tree preservation a priority when designing the new improvements. Our site reconnaissance will assist in determining proper distances from tree trunks with respect to the walkways and other significant features.

Hazardous Material Remediation:

Hazardous material remediation design will include the recommendations of the Los Angeles Department of Toxic Substances Control (DTSD) Covenant and Agreement with the City regarding the presence of toxic materials along the River Road Areas and the Tree Areas. A Soil Management Plan has been included in our scope and any related design would address the required remediation of the excavation soils based on the recommendations of the City/DTSD Covenant and Agreement.

Project-Specific Approach
Projects, no matter how big or small, are approached similarly by the Willdan team in that they are thought out clearly and carefully during the earliest stages of the project. This equates to a detailed study of the project requirements during the proposal stage, the assignment of a project manager experienced in those project requirements, and the establishment of a project team with individual expertise in their assigned tasks.

Our vision is that the park renovations should be unique, an asset to the surrounding community and maintain its identity as a recreational environment.

Good planning is an essential element of any design – whether the design is for a recreational park or institutional facility. Willdan understands the importance of well-designed park planning and is experienced in integrating solid design and planning into any setting. As we envision, community parks are divided into several components corresponding to their various uses and are situated in park-like settings complete with walkways, sitting areas and shade areas. This tranquil and aesthetically pleasing setting translates into an effective and conducive space for play and relaxation. Willdan shall strive to create a unique experience for the park improvements that is harmonious with the surroundings and strive for congruency within the project site.

Furthermore, safety and circulation are important factors in design, particularly in a well-planned park environment. These two basic design elements in a public space cannot be compromised or overemphasized. Indeed, one of the most important functions of landscape architecture in a park environment is to convey safe and comfortable surroundings. A well-designed park environment can only generate enthusiasm among its users.

The above considerations will be the driving force behind the design throughout this project. While minor subtleties can occur in smaller spaces such as small gathering plazas, the overall design should offer diversity while maintaining a common thread in the landscape that unifies the park site as a whole.

Willdan’s design philosophy follows the Frank Lloyd Wright maxim: Form Follows Function. This does not mean rigidity in any sense, but that a successful design must work for its intended use. The logical design process then is:
 Determine the users.
 Ascertain goals and needs.
 Development spatial requirements for the intended uses.  Analyze the site for constraints and opportunities to meet desired spatial needs.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
10  Develop use/space relationships that integrate like uses and segregate unlike uses. (Conceptual alternatives in relation to site opportunities.)
 Use circulation as the means of connecting spaces and creating form. Use plantings to define spaces, including buffers.
 In the construction drawing implementation, use the economy of means principle. This, basically, is value engineering. It is concerned with a useful life, constructability, efficiency of maintenance, low water use, etc.

The final result is a design product that is creative in landscape personality, respective of site attributes, and provides the client and public the most value for their tax dollars. Landscape architecture should be unique; an asset to the surrounding area yet maintain its identity in its final form and function.

Project Execution - Over the course of the past 52 years, Willdan has developed very practical and successful techniques to project development and delivery. In essence, the following summarizes our approach to delivering your projects on time and within budget.

Once the course of action is established, Willdan will develop a project schedule. The schedule will be circulated to the City and other pertinent stakeholders for review and acceptance. The schedule will be developed with the City’s project completion date in mind and will include and measurable milestones to ensure the project completion date is met and is consistent with the City’s timeline. Below is a summary of work:
 Willdan will conduct regular project progress meetings with the City to report progress, any outstanding issues, and proposed resolutions including updating the City with status reports regarding other agency(s) having jurisdiction with this project. Meeting minutes with action items will be provided.
 Willdan will coordinate with City and pertinent stakeholders to schedule the review of project deliverables.
 Willdan will coordinate with the City and pertinent stakeholders to schedule the required meetings with regulatory agencies for deliverables review and approval  Willdan will complete all required revisions and obtain approval from the City and regulatory agencies for the project deliverables.

Quality Assurance and Control Procedures - Quality assurance and control procedures are critical to ensuring sound technical practices are in place and quality deliverables are produced. Willdan operates daily under a company-wide Quality Assurance/Control Program.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
11 Ms. Vanessa Muñoz, PE, TE, PTOE will serve as
Quality Assurance Manager for the Cudahy Park
renovation contract. In this role, she will be
responsible for ensuring Willdan's quality
assurance/control policies are followed and will
coordinate with our project staff to develop and
implement project-specific quality
assurance/control activities at the beginning of
the project. Typical activities entail:
 Assigning appropriate technical staff
 Developing and implementing proper
project technical approach
 Establishing project schedule meeting City
deadlines
 Determining the proper level of quality
assurance/control reviews
To provide quality deliverables to all our clients,
Willdan has implemented strict quality control review processes and procedures. Mr. Hidalgo will be responsible for the planning and successful execution of the quality assurance reviews. All deliverables must be reviewed under our quality assurance procedures. The two major components of the review are technical and editorial reviews ensuring:
 Data is interpreted correctly
 Calculations are complete and accurate
 Conclusions or recommendations are sound and appropriate  Deliverables meet the requirements of the scope of work The technical editorial review ensures deliverables are well organized, easy for the non-technical reader to understand and follow, adheres to Willdan's standards and the City's requirements, and all grammatical and spelling errors are corrected. There are three levels of our quality assurance/control review for project deliverables:
 Level 1 - peer technical review and consultation
 Level 2 - peer technical review and consultation and editorial review (document)  Level 3 - peer technical review and consultation, editorial review, and professional engineer review
In general, the appropriate review level will be determined during the planning stage and reviewers will be identified to ensure the quality assurance reviewer can participate throughout the project. All reviews and corrective actions will be documented and incorporated in the project file for future reference.

Mr. Hidalgo will perform a final quality assurance review to monitor quality assurance/control activities to ensure the City's project objectives are met at the completion of the project with project deliverables provided within identified timeframes.

Quality Assurance Review Goals
 Allocate time for quality assurance under a
project management task or as a separate line item
in all proposals
 Review all work products for grammatical
correctness and format by administrative staff prior
to technical content review by senior staff
 Peer review all major work products for technical
content by appropriately qualified senior planning
staff prior to submittal to Cudahy
 Use templates that have been generated over time
for all major work products to ensure they meet
City standards and are compliant with applicable
and up-to-date state and/or federal regulatory
requirements and industry standards
 Perform post-project follow-up to ensure work
products met Cudahy's expectations
Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
12 Scope of Work
Willdan acknowledges and understands the scope of work and deliverables presented in the City’s request for proposal. The scope of services below provides additional information related for the implementation of the project.

Preliminary Design
Kick-Off Meeting. Upon receiving the notice to proceed from the City, Willdan will prepare a project schedule based on the scope of work presented in the proposal. The schedule will be submitted to the City for review and acceptance. If other items come up after the original schedule was accepted, Willdan will revise/update the schedule to meet the City’s timeframe. Willdan will participate in a kick-off meeting to include the decision-makers from the City and other agencies such as gas and electrical and other agencies that become known to us resulting from our research. The meeting will be used to discuss project scope and schedule including design goals and criteria, roles and responsibilities, work program, budgeting, utility coordination, plan and specifications preparation, cost estimate, submittal reviews, and anticipated construction issues.

Topographic Survey, Field Review, Research and Data Gathering. Willdan will conduct a field investigation to verify existing topographic conditions and identify unusual or special conditions and review available improvement plans, utility plans, and data records within the project area. A topographic survey will be performed to document current conditions such as existing grades, surface culture and any other existing items/structures, along with assisting with designing/placement of the renovations/improvements.

As part of our field review, research and data gathering, Willdan would like to arrange a meeting with the City's maintenance facilities managers and/or supervisor to obtain as much detailed information as possible regarding the proposed improvements (e.g., drainage, hardscape, circulation, irrigation, plant material, etc.). This input will provide specific recommendations pertaining to the improvements for the purposes of maximizing the budgets. Additionally, the purpose of the meeting is to get first-hand knowledge about the existing irrigation system and discuss proposed modifications to accommodate the new landscaping. Furthermore, this field review will also identify potential design constraints and conflicts and observe general site conditions.

Geotechnical Investigation. Willdan will review the available subsurface data or published geologic and geotechnical maps and documents to determine general subsurface conditions at the project site; and determine the most appropriate locations for borings. The proposed field investigation will include site reconnaissance and subsurface exploration. Geotechnical laboratory testing will be performed on representative samples of soil to evaluate the engineering characteristics of these materials. This information will be valuable in determining the subsurface drainage as well as the footing design for the structural design of the shade shelter and community stage, general paving installations, bioswales and water quality management, thus managing the construction costs at the beginning. Known clearance of subsurface utilities from Underground Service Alert will be obtained prior to commencement of field exploration.

Utilities. Willdan will conduct a utilities investigation (i.e., water, sewer, gas, electrical, cable, telephone, stormwater) of known utilities within and near the project improvements. The investigation will identify any potential or conflicting issues that can have a significant impact on the project. By knowing this information at the beginning stage, the limits and constraints can be planned accordingly.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
13 Willdan will review and present specific requirements for utility facilities including protection, relocation, right-of-way, and construction methods within the vicinity of the utility.

Utility information will be requested from each utility company that has facilities within the limits of the project. This information will be incorporated into the design plans and plotted per the atlases provided by each utility company. Willdan will forward plans to the utility companies requesting verification. At this time, any potential utility conflicts will be identified and presented to the City for discussion and proposed solutions. (Note: Willdan will provide a fee proposal for design services for utility relocation, if required.) A review of the utility information will be performed to determine the impact of the project on the various utilities and any required potholing by utility companies will be coordinated.

Environmental. Willdan will review the environmental documents to determine whether there are any mitigation measures that are required to be fulfilled in the design of the proposed improvements.

Said mitigation measures will be incorporated into the design of the park and associated park improvements.

Design Development Plan and Preliminary Opinion of Probable Costs. Following the survey, research, site data gathering and base mapping, Willdan will prepare a design development plan based on the descriptions of improvements presented in the City-furnished schematic plan. The design development plan will address in further detail an understanding of the spatial requirements and relationship for the renovation improvements including circulation functions, landscape and irrigation, utility infrastructure, shade shelter and community stage architecture, electrical engineering, and grading and drainage systems. In addition, specific items that will be illustrated in the plan are:
 Address easements and drainage patterns.
 Address the footprint of the pre-engineered shade shelter and community stage including elevations.
 Address fencing materials.
 Address the playgrounds.
 Address the skate park.
 Address the fitness station equipment.
 Address the rubberized surfacing for the playgrounds and fitness stations.  Address planting palette suggestions for trees, shrubs, and groundcovers, along with their respective locations. Species shall include drought-adaptive and California native plants.  Address irrigation systems and relocation (i.e., smart controllers, control valves, and low-flow drip).  Address hardscape and softscape surfacing materials for the walkways such as PCC concrete and stabilized decomposed granite.
 Address the preservation of trees and/or other noteworthy features.  Address pedestrian circulation.
 Address site amenities, (i.e., tables, benches, trash receptacles, urns and drinking fountains).  Identify infrastructure, (i.e., electrical and storm drainage).  Address low retaining walls and seat walls
 Address ADA-accessible pathways and path of travel.
 Address area lighting.
 Address the hazardous materials locations within the park site.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
14 Willdan will submit the design development plan design to the City for review and comments. Upon the review and comments from the City staff, Willdan will present a final site design development plan design for final review and acceptance that addresses the comments from all parties. The construction documents for the improvements will not commence until the City has reviewed and accepted the final design development plan design.

All illustrative renderings and drawings submitted will be in a form suitable for public presentations such as City and stakeholders' meetings.

Preliminary Opinion of Probable Cost Estimation and Construction Schedule. Based on the City-accepted design development plan, Willdan will prepare a detailed cost estimate for the categories of work to be performed in construction. If the cost estimate exceeds the available funding, Willdan will make the necessary revisions and adjustments to meet the financial limitations of the City. Once the City reviews and accepts the opinion of probable costs, Willdan will proceed with the preparation of the final construction documents.

Based on the scope of work depicted on the City-accepted construction opinion of probable costs, Willdan will prepare an estimated project schedule for construction. Milestones for the schedule shall include the bidding period, bid opening, award of project, preconstruction/kick-off meeting, start of construction, the midpoint of construction, final construction, closeout and notice of completion.

Final Construction Drawings, Specifications, and Cost Estimate Construction Documents. This task will be for the entire construction document package encompassing specific plans drawn to a measured scale with construction notes that provide clear direction for the contractor. The package will include technical specifications with special provisions in "Greenbook" format (Standard Specifications for Public Works Construction, current edition the City has adopted), and a final detailed engineer's estimate. The plans, specifications, and estimate (PS&E) will be prepared and submitted to the City at four stages – 30 percent, 60 percent, 90 percent, and final 100 percent. The construction document package will be completed in a form sufficient for the solicitation of competitive public bidding.

The construction documents shall address the requirements of governing agencies. In addition, Willdan shall obtain approvals from governing agencies prior to advertising of public bidding. If any of the permitting agencies require lengthy submittal processes, Willdan shall alert the City of a potential slowdown or stoppage of the project.

Our scope of work for the improvements includes:

1. Prepare detail sheets with the required cross sections and details, including conformance with accessibility requirements for ADA path of travel.

2. Prepare a demolition plan for the removal of existing improvements and existing trees, shrubs, etc. conflicting with proposed improvements.

3. Prepare a grading plan for the playground and fitness stations surfacing, shade shelter and community stage locations, skate park, seat walls, PCC sidewalks, and elevations for compliance with accessibility requirements, and for proper drainage.

4. Prepare a site amenities plan showing the locations/placements of the benches, tables, shade shelters, community stage, fitness stations, drinking fountain, and trash receptacles.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
15 5. Prepare the landscape and irrigation modification plans.

6. Prepare a playground and fitness stations layout plan with associated details.

7. Prepare the electrical plans for the lighting layout.

8. Prepare a Soil Management Plan for the hazardous materials areas.

The project will include the following submittals and deliverables. The deliverables will be in electronic form (PDF format) and paper hard copies in full-size 24-inch by 36-inch sheet size.

Preliminary Plans, Specifications and Estimates at 30, 60 and 90 Percent Stages.

Preliminary plans, specifications and cost estimate will be prepared in conformance with the approved design development plan. These documents will be prepared in AutoCAD (and converted to PDF format) and submitted to the City and other responsible parties/governing agencies for preliminary review and acceptance.

Final Plans, Specifications and Estimates at 100 percent Stage. Following the review and acceptance of the 30, 60 and 90-percent stages, Willdan will adjust the plans, specifications, and cost estimate to conform to plan check requirements and comments of the City. The final construction PS&E will be completed in detail and submitted to the City and responsible parties/governing agencies for review and final acceptance, including the city building department and governing fire department. The contract documents will be completed in a form sufficient for the solicitation of competitive public bids, along with all permit compliances. Willdan shall advise the City of any adjustments to previous estimates of probable construction cost indicated by changes in requirements or general market conditions. The final submittal and deliverable materials will include:
 100-percent construction plans stamped by the landscape architect, civil and electrical engineers, and structural engineer as required.
 100-percent technical specifications and special provisions including bid items schedule and city boilerplate specifications
 Final engineer’s estimate including bid items unit cost.

A summary of anticipated plans for the construction document package will include:
 Title sheet with vicinity map, general notes, signature and approvals blocks, legend, sheet index, and utility contact information.
 Detail sheets with construction notes – scale as required  Civil/grading improvement plans – 20 scale
 Typical sections and details – scale as required
 Erosion control plan – 20 scale
 Demolition plan – 20 scale
 Construction layout plan – 20 scale
 Playground equipment and fitness equipment layout plan and details – 10 scale  Skate Park – 20 scale
 Splash Pad – 20 scale
 Utility plan (sewer, water and electrical) – 40 scale  Planting and irrigation modification plans – 20 scale  Hardscape layout and site amenities plan – 20 scale
 Architectural plans for the pre-engineered shade shelters and community stage shelter – 1/8 scale
 Electrical and lighting plans and details – 20 scale
Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
16  Property/topographic survey
 Water quality and LID plan – 20 scale
A summary of anticipated specifications and reports for the construction document package will include:
 Construction specifications with special provisions and technical specifications.  Construction cost estimate.
 Geotechnical report (for the shade shelter, community stage, infiltration rates and general pavement installations).
 LID Report.
 Drainage Report.
 Soil Management Plan.

Constructability Review. Willdan will provide a constructability review of the project as part of the design process. This review is a standard quality control measure used by Willdan to help prevent change orders. This review will include a) performing a job walk, reviewing the existing improvements, and identifying potential conflicts, including pedestrian, access, utilities, and right-of-way issues, and b) reviewing the design and specifications to identify potential construction issues.

Deliverables.

A summary of anticipated deliverables for the plans, specifications and cost estimate ready for bidding includes:
 One wet-signed mylar plan set.
 Six hard copies wet signed.
 AutoCAD files of plans.
 Microsoft Word file of Specifications.
 Excel file of cost estimates.
 PDF files of all other documents.

Bid Support Services
Bidding Assistance. Willdan will be available throughout the bid period to review and respond to questions and provide analysis and interpretation of the drawings and specifications.

Willdan will provide the City with the following items during the bidding period:
 Attend one pre-bid meeting.
 Respond to questions during the project advertising phase.  Assist with the preparation of addenda.
 Assist with reviews of "or equal" products prior to bid opening.  Review and analyze bid results and prepare bid summary.  Verify contractor's references, and contractor's license.  Provide recommendations to award project
Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
17 Construction Support Services
Willdan will be available to provide the analysis and interpretation of the drawings and specifications, review and respond to material submittals and review shop drawings for compliance with the contract.

We have assumed twenty material submittals and fifteen request for information (RFI) requests.  Shop Drawings Review - Willdan will review the contractor's shop drawings, material submittals and respond to requests for information (RFI). The shop drawings and submittals will be logged in once we received them and a project file setup for record-keeping and tracking purposes.

Turnaround time for the reviews will be between 5-7 working days, depending on the complexity of the submittal.

Additional Construction Support Services
Willdan will assist the City during the construction phase by attending a pre-construction meeting.

Additionally, Willdan can assist the City with reviewing change orders and prepare project bulletins.

Furthermore, Willdan will be available for a pre-final and final acceptance observation walk-through with associated punch list items and the preparation of as-built record drawings. Our services are described in detail below:
 Acceptance Inspection (Punch List) - Willdan will perform a pre-final walk-through and followup with a final check of the project to ensure that the work is completed as intended, along with assisting the City in obtaining required turnover items. A punch list (at the pre-final and final) will be prepared by Willdan prior to final acceptance by the City.

As-Built Record Drawings - Willdan will review and approve the contractor's as-built drawings. In preparing the record drawings, Willdan will take the original construction drawings (and any bulletins issued during construction and redlines by the contractor) and make drafting notations to reflect as-built conditions and submit to the City as record drawings. The final deliverables will be on mylar plan sheets.

EXCLUSIONS
 Perform hazardous materials (asbestos, lead paint, aerially deposited lead, etc.) testing and related services.
 Plan check, permit, or similar fees to governmental agencies.  Removal or treatment of hazardous materials encountered on or at the site.  Acoustic analysis, reports, design, or consultation by an acoustical consultant.  SWPPP - Note, this document will be noted in the construction documents to be prepared and furnished by the awarding Contractor.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
18 3. Proposed Project Specific Staff
Organizational Chart
Willdan’s organization is shown below. Our team brings significant experience in park planning, sports facilities, recreational developments, residential, streetscape and urban beautification projects; as well as regional, community, and neighborhood parks.

Project Staffing
Willdan proposes to assign Mr. John Hidalgo, RLA, as Project Manager and Principal Landscape Architect. Mr. Hidalgo has over 31 years of diverse experience in park design, urban streetscapes, and a full range of landscape architectural projects. Mr. Hidalgo has completed numerous recreational projects in Southern California, including a variety of special facilities. His experience includes the development of an 8-acre Salud Park in the City of Paramount, California. The park consists of multi-use trails, planting areas with California native vegetation, play fields, exercise stations, 400-meter rubberized track, restroom buildings, picnic shelters, parking lot and playgrounds. In the Town of Pahrump, Nevada, Mr. Hidalgo was the Project Manager for a Draft Master Development Plan for Last Chance Mountain Park. The park consists of 1,520 acres in Bureau of Land Management property. The Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
19 master plan document includes park general standards/details for mapping of trails, equestrian facilities, restrooms, points of interest signage, hiking markers and information kiosks.

Another project was the 22-acre Fountain Valley Recreation Center Expansion and in the City of Blythe, prior to employment with Willdan, Mr. Hidalgo was the landscape architect responsible for the design of the 18-acre Quechan Regional Park adjacent to the Colorado River. The project included city and local governing agencies (Bureau of Land Management and Palos Verdes Water District) review and approvals, construction drawings, cost estimates and construction observation. The park consists of trails, a new roadway into the park, parking lots, picnic shelters, a restroom building, soccer/baseball fields, regional-specific planting material, a beach area along the river’s edge, large open lawn areas and a future water park area.

As Project Manager, Mr. Hidalgo will:
 Establish appropriate organizational staffing to best provide the services needed;  Monitor, review and report on the project’s status to the City at regular intervals;  Participate in presentations to the City and other stakeholders;  Solicit information from and coordinate reviews by the City;  Be the primary contact and focus of project correspondence in order to maximize communications between the City, other agencies, and the Willdan team; and  Monitor the general progress of the project and will thoroughly review all major documents prior to submittal to the City.

As the project manager, Mr. Hidalgo will ensure that Willdan’s staff is efficiently utilized and dedicated to fulfilling the desires of the City. Mr. Hidalgo will monitor the general progress of the project and will thoroughly review all major documents prior to submission to the City. His responsibilities will include administrative supervision of the project and quality assurance.

Mr. Hidalgo’s background is a blend of public and private practice. He is experienced in park planning, sports facilities, recreational developments, residential, streetscape and urban beautification projects; as well as regional, community, and neighborhood parks. His experience extends from project planning and development through design, construction and maintenance. This broad base of experience, which is specifically relevant to expected project requirements, provides the necessary credentials to guide your projects through various phases and tasks to a successful completion.

Summary qualifications of the Willdan team are presented on the following pages. Our subconsultant team is introduced below.

Subconsultants
M Y Engineering, Inc. (Electrical and Lighting Design – Splash Pad, Community Stage, Sports Courts and Play Fields) is a professional consulting engineering firm providing full mechanical, electrical, plumbing (MEP) engineering services. The firm applies a full-service approach to a wide variety of sectors, including recreational facilities, commercial buildings, educational institutions, industrial buildings, residential areas, health care facilities, and government establishments. M Y Engineering has provided on-call engineering services to the City of Rosemead, City of Monrovia, City of Covina and County of Los Angeles Internal Services Department (responsible for Beaches and Harbors, Fire Department, Health Services, Library, Parks & Recreation, Probation, Registrar-Recorder / County Clerk, Sheriff, and Superior Courts). The firm Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
20 recently completed work on an amphitheater power and lighting system with new park lighting for the City of Covina.

ELMT (Contaminated Soils) has 50+ years of experience providing timely and cost-effective environmental solutions and planning services. The firm provides biological resource assessments, Biological Resources Studies, Jurisdictional Delineations, Cultural/Historical/Archeological & Paleontological Studies, Climate Change/Air Quality/Greenhouse Gas (GHG) Studies, Transportation & Traffic Studies, Noise Studies, Health Risk Studies, Phase I and Phase II Environmental Site Assessments, Arborist Studies, Light/Glare Studies, Energy Analyses, and Environmental Remediation Planning and Project Management. ELMT has worked with Mr. Hidalgo on previous projects and is highly qualified to perform the respective services.

Spohn Ranch (Skate Park Design) is an award-winning skate park design-build firm with 30 years of municipal skate park projects spanning 40+ states in the nation. With a firsthand passion for skateboarding and wheel sports, Spohn Ranch’s highly skilled designers, and craftsmen – including iron workers, grading wizards and ACI-certified shotcrete nozzlemen – pride themselves on designing and building skate parks. The firm has won numerous awards for its skate parks including:
 Award for Excellence in Design, 2020 (Manzanita Skate Park - Anaheim, CA), California Park and Recreation Society
 Project of the Year, 2017 (Marine Park Skate Park – Manhattan Beach, CA), APWA Southern California Chapter
 Award of Excellence in Park Planning, 2017 (Stanton Skate Park – Stanton, CA), California Park and Recreation Society
 Finalist for “Crews that Rock” Award, 2011 & 2013 (Dew Tour Bowl & BSA Summit), World of Concrete
 Award for Excellence Nominee, 2010 (Daybreak Skate Park – South Jordan, UT), American Society of Landscape Architects
 Award of Excellence for Recreation, 2009 (Fontana Skate Parks – Fontana, CA), California Park and Recreation Society
 The Future of Skatepark Design,” 2008 (Daybreak Skate Park – South Jordan, UT), Huck Magazine
AWu Government Services (Architectural Design – Community Stage) is a full-service architectural firm located in Torrance, California. Since 1956, the firm’s professional staff of architects, planners, and design specialists have completed over 2,000 projects for over 50 different municipalities / public agencies. AWu has designed government facilities for city, county, state, federal, other municipal government agencies, military, and school districts. The firm has designed, produced construction documents and provided construction administration for various projects in the City of Rancho Palos Verdes including Eastview Park and Hesse Park. Since 1987, AWu has worked on more than 40 projects for the City of Torrance.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
21 Key Project Team Members
Team Member,
Yrs of Experience, & Role
License/Certifications Qualifications
John Hidalgo, RLA
31 Years of Experience
Project Manager &
Landscape Architect Lead
 Landscape Architect,
California No. 3551
 Licensed Contractor,
California C-27, No. 713613
 BS, Landscape Architecture, California State
Polytechnic University, Pomona, CA
Salvador Lopez Jr.
22 Years of Experience
Technical Advisor &
Environmental Lead
 Advance and Environmental
Planning
 Active Transportation
Planning (ATP)
 BS, Urban and Regional Planning, California
State Polytechnic University, Pomona
Vanessa Muñoz, PE, TE
25 Years of Experience
QA/QC Manager
 Civil Engineer, California No.
67583
 Professional Traffic
Operations Engineer
 Traffic Engineer, California
No. 2341
 Doppler Traffic Operator
 BS, Civil Engineering, California State
Polytechnic University, Pomona
Bryan Nguyen, RLA
19 Years of Experience
Landscape Architect
 Landscape Architect,
California No. 4967
 BS, Landscape Architecture, California State
Polytechnic University, Pomona, CA
Carlos Espinoza, RLA
13 Years of Experience
Landscape Architect
 Landscape Architect, California
No. 6534
 BS, Landscape Architecture, California State
Polytechnic University, Pomona, CA
 Skills Certificate in Geographical Information
Computer Systems (ArcGIS 9.2), Mt. San
Antonio College, Walnut, CA
Tyrone Peter, PE
16 Years of Experience
Civil Engineering Lead
 Civil Engineer,
California No. 81888
 BS, Engineering and Civil Engineering, Tamil
Nadu College of Engineering
 Civil Engineering, Murugappa Polytechnic
Gary Gordon, PE
37 Years of Experience
Structural Engineer
 Civil Engineer, California No.
42176
 BS, Civil Engineering, California State
University, Chico
Ross Khiabani, PE, GE
47 Years of Experience
Geotechnical Engineer
 Civil Engineer, California No.
37156
 Geotechnical Engineer,
California No. 2202
 MS, Geotechnical Engineering, California State
University, Long Beach
 Geology, Pahlavi University, Iran
Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
22 Team Member,
Yrs of Experience, & Role
License/Certifications Qualifications
David Woolley, PLS
31 Years of Experience
Survey
 Professional Land Surveyor,
California PLS No. 7304
 Survey & Mapping Coursework at Santiago
Canyon College
 Courses: Ethics, Business & Professions Code,
ALTA/NSPS Courses, Copyright Law and Land
Surveying
Diane Rukavina, PE
36 Years of Experience
Grant Funding
 Civil Engineer, California No.
36380
 BS, Civil Engineering, Loyola Marymount
University
Jeffrey Lau, PE, TE, ENV SP
19 Years of Experience
Traffic Engineering Lead
 Civil Engineer, California No.
83887
 Traffic Engineer, California No.
2835
 Doppler Radar Operator
 BS, Civil Engineering Polytechnic State
University, Pomona
Kevin Custado, EIT, ENV SP
8 Years of Experience
Electrical (Site Lighting)
 Engineer-in-Training, California
No. 153964; Envision
Sustainability Professional
 BS, Civil Engineering, California Polytechnic
State University, Pomona
Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
23 Resumes
Salvador Lopez Jr.

Technical Advisor and Environmental Lead
Profile Summary
Education:  BS, Urban and Regional Planning, California State Polytechnic University, Pomona Experience: 22 Years
Mr. Salvador Lopez possesses planning expertise and experience spanning all aspects of planning, including current, advance, and environmental planning, as well as active transportation planning and housing and community development. He is highly experienced at managing multi-disciplinary teams in the development of policy and long-range planning documents for public agencies. Mr. Lopez has provided planning services to the City of Cudahy since 2017. In his capacity as Interim Community Development Director, Mr. Lopez has successfully maintained the stability of the department while the city recruited a permanent Director. During the last five-plus years, Mr. Lopez has shepherded the adoption of the General Plan and Zoning Code update, successfully acquiring grant funding to support the update to the city’s Housing Element and the adoption of an Inclusionary Housing Element. He continues to assist the City with their Successor Agency needs, and was instrumental in the City’s pursuit of Proposition 68 funding for the proposed improvements to Cudahy Park. Mr. Lopez’s institutional knowledge of the city, experience in grants administration and environmental expertise make him a key asset to this project.

Relevant Project Experience
Contract Planning Services, City of Cudahy, California. Project Manager responsible for overall project management and oversight for staffing resources provided to the City. Willdan provides full-time contract planning services for the City's Planning Division as well as for Interim Community Development Director.

On-Call CEQA/NEPA Planning Services, City of Claremont, California. Project Manager responsible for overall project management and oversight for CEQA/NEPA documentation services necessary to implement the City's planned developments. Willdan's planning project managers prepare environmental documents pursuant to CEQA and NEPA and other environmental documentation or technical studies and assist with securing and complying with required regulatory permits. The range of environmental documents encompasses initial studies, negative/mitigated negative declarations, and environmental impact reports pursuant to CEQA, categorical exclusions, environmental assessments/findings of no significant impacts, and environmental impact statements pursuant to NEPA.

Contract Planning Services, City of Long Beach, California. Project Manager responsible for overall project management and oversight for staffing resources provided to the City. Staff planners assist with current planning, advance planning, special projects planning, development project review, entitlement processing, CEQA document preparation and review, historic assessments, community outreach, and other long-range planning activities.

Contract Planning Services, City of Ojai, California. Project Manager responsible for overall project management and oversight for staffing resources provided to the City. Staff planners assist with day-today current planning activities, design review, entitlement processing, counter assistance, and environmental review. Willdan is providing on-call planning services – including contract staff augmentation – to assist the Planning Division with general current planning activities.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
24 On-Call Current Planning Services, City of Elk Grove, California. Project Manager responsible for overall project management and oversight of planning services provided to the City. Assigned planners will be responsible for on-call current planning services for all types of projects requiring entitlements, including – but not limited to – conditional use permits, variances, design reviews, rezones, zoning and general plan amendments, and tentative subdivision maps.

On-Call Planning Services, City of Desert Hot Springs, California. Project Manager responsible for overall project management and oversight of on-call planning services provided to the City. Contract planning services emphasize discretionary case processing and long-range advanced planning programs.

Programs involved land use planning; complex land use development projects; general administration of City-initiated planning work and studies; conceptual plans; land use entitlement applications; general plan, specific plan, and zoning code updates and map amendments; and initial studies under the California Environmental Quality Act and related environmental documents. As-sociated staff reports, resolutions, and ordinances were prepared and presented as needed.

Special Project Planning Services, City of Artesia, California. Project Manager responsible for overall project management and oversight of on-call planning services provided to the City. Contract planning services encompass re-viewing and processing land use entitlement applications; preparing general plan text or map amendments; preparing or amending specific plans; preparing zoning code text or map amendments; and preparing related environmental studies. Performance of these responsibilities requires expertise and knowledge in general plan compliance and implementation, CEQA/NEPA conformance, project management, and general planning procedures.

On-Call Planning Services, City of Willows, California. Program Manager responsible for overall on-call project assignment management and oversight for staffing resources provided to the City. Staff planners assist with current, advanced, and special project planning; development project review; entitlement processing, including general plan and zoning amendments; CEQA document preparation and review; and other long-range planning activities.

Garfield Avenue Corridor Improvements, City of Paramount, California. Environmental Task Manager responsible for overall environmental services necessary for the street improvements. Willdan provided design engineering services for street improvements through the Garfield Avenue corridor between the North and South City limits. The design involved street widening to accommodate a third lane in each direction; street resurfacing; two concrete intersections; concrete sidewalk, curb and gutter, and driveway approach reconstruction; catch basin construction; streetscape improvements for raised landscaped medians and modifications to existing medians; two entry monument signs; and traffic signal modifications at nine locations along the Garfield Avenue corridor. Services included civil, traffic, and drainage engineering; survey and mapping; utility relocation; landscape architecture; and pavement management. Willdan prepared an initial study checklist and a mitigated negative declaration pursuant to CEQA requirements.

Firestone Boulevard Corridor Capacity Enhancement, City of South Gate, California. Environmental Task Manager responsible for overall environmental services necessary for the street improvements.

Willdan provided engineering services for the complete rehabilitation of roadway improvements from Alameda Street to Hunt Avenue. Improvements included but are not limited to increasing the number of lanes from 4 to 6, pavement rehabilitation along with localized removal and replacement of the failed portions of the roadway; installation of landscaped and hardscaped medians with drought-resistance plants, irrigation system, and lighting system; reconstruction of any deficient sidewalk, curb and gutter, driveway approaches, non-compliant ADA curb ramps; and street parkway trees without irrigation.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
25 John J. Hidalgo, RLA
Project Manager and Landscape Architecture Lead
Profile Summary
Education:  BS, Landscape Architecture, California State Polytechnic University, Pomona  Summer of 1987, European Study Tour, California Polytechnic State University, School of Architecture, Pomona
Registration:  Landscape Architect, California No. 3551  Licensed Contractor, California C-27, No. 713613 (inactive) Experience: 31 Years
Mr. John Hidalgo possesses in-depth expertise in landscape architecture design development, preparation of plans and specifications, plan reviews, and construction observation. Mr. Hidalgo is familiar with various local, state, and federal codes, regulations, procedures, and standards relating to construction, safety, park and facility planning, and other landscape and irrigation amenities. He has successfully completed projects in compliance with these various standards. Mr. Hidalgo has experience representing project owners during the plan review process. He possesses comprehensive experience in both field observation and construction. Mr. Hidalgo responsibilities include managing park and street beautification design, stormwater management/low-impact developments, plan reviews, and construction observation.

Relevant Project Experience
Salud Park, City of Paramount, CA. Project Manager. Willdan was involved with this 8-acre park project from the very beginning of planning, through the grant application submittal and the preparation of construction documents and construction management services. The project includes synthetic turf play fields, a 400-meter walking/running track, multi-use soft-footed trails, exercise stations, parking, security lighting, and enclosed decorative steel fencing for the entire park. The park development is located within Southern California Edison right-of-way, therefore went through a lengthy review process and adhered to all requirements set forth in SCE conditions of approval. Funding for this park development was available through a park grant from Proposition 84.

La Puente Park Beautification Project, Paramount, California. Project Manager. Willdan provided landscape architecture design services involving the enhancement of an existing community park. The park is estimated at 20 acres and encompasses a variety of activities such as baseball, softball and football fields, playgrounds, open lawn areas, a community center, picnic shelters, restrooms, and City maintenance yard. The new additions include an expanded decorative concrete promenade area for the softball and little league fields, parking lot reconfiguration, ballfield lighting, shade trees, benches, pedestrian lighting and a new landscape and state-of-the-art irrigation system. Willdan is currently providing construction management and inspections.

Recreation Center Master Plan Expansion, Fountain Valley, California. Project Manager. Responsible for the rehabilitation of an existing 55-acre sports complex and an addition of 23 acres to produce a new 78-acre regional sports facility. The project provides the community with six new softball fields, six Little and Pony League fields, four soccer fields, a utility field, a large concert-in-the-park and assembly area, two new concession/restroom buildings, a new maintenance building and over one mile of natural hiking trails that connect to the existing County hiking trail system in Mile Square Park. The new improvements add to the existing tennis courts, indoor and outdoor basketball courts, handball and racquetball courts and recreation building.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
26 Riverfront Park, City of Maywood, California. Project Manager/Landscape Architect. Responsible for the design and preparation of construction documents and specifications of a 7.3-acre park. Portions of the land were considered “Brown Fields” (contaminated soil). A thorough remediation program administered by the Environmental Protection Agency allowed the reclamation of the land for public use. Development of the park includes restroom facilities, retaining walls, landscaping, sidewalks, bicycle paths, a staging area for those using the Los Angeles River bicycle trail, a bridge, trails, a demonstration garden, lawn and picnic areas, a basketball court, a soccer field, and the incorporation of a swale to add to a natural habitat setting and aid in the control of runoff.

Orange Line Extension, Metropolitan Transportation Authority. Task Manager. Responsible for providing landscape design for this design-build project for the 4-mile extension of the rapid bus line along Canoga Avenue. Scope included preparation of arborist report, tree inventory plans, tree replacement plans, planting and irrigation plans as well as coordinating all landscape and irrigation aspects for the implementation of the design-build process. Site work included, a multi-purpose trail, raised landscaped medians, an irrigation system, ADA Access curb ramps, bio-retention basins, bicycle paths, park and ride and parking lot facilities.

Urban Greening Bicycle Trail, City of Lynwood, California. Landscape Architecture Task Manager responsible for providing and overseeing all landscape and irrigation design required to develop a sustainable, integrated, and efficient design for a bicycle trail within the community consistent with the City's year-round recreational programs. The $2.85 million, 1.2-mile project improvements are being designed to meet the City's general plan objectives and incorporate landscaping and decorative/commemorative points of interest along the trail. The ultimate bicycle path will provide safe connectivity between parks, bus and light rail transit stops, city hall, and other City attractions and shopping areas. Willdan is providing full engineering design services encompassing field surveys, rightof-way engineering, geotechnical engineering and inspection, landscape architecture, environmental documentation, preliminary and final design, drainage and water quality, utility coordination, traffic design, and safety and visibility lighting design.

Lakewood Boulevard Regional Corridor Capacity Enhancement, City of Lakewood, California.

Landscape Architecture Task Manager responsible for providing and overseeing all landscape and irrigation design required for complete street/green street improvements between the north city limits and Del Amo Boulevard. Improvements involved street widening and median improvements; Class II bike lanes in both directions; turn lanes; landscape planting and irrigation; overhead distribution and transmission power undergrounding; sidewalk, curb and gutter, and driveway approach reconstruction; street resurfacing; catch basin construction; stormwater quality improvements to comply with Green Streets policy; bike lockers, bus shelter, and traffic signal modifications. Services include civil, traffic, pavement, drainage, and geotechnical engineering; landscape architecture, survey and right-of-way engineering, and utility coordination and relocation.

Paramount Boulevard Urban Renovation and Complete Street Improvements, City of Paramount, California. Landscape Architecture Task Manager responsible for providing and overseeing all landscape and irrigation design required for street improvements necessary to transform Paramount Boulevard from a four-lane arterial roadway into a scenic, multi-modal complete street corridor lined with shade trees and LED lighting to foster a more walkable and vibrant downtown atmosphere. The improvements involved traffic-calmed vehicle lanes with bulb-outs, two mid-block pedestrian crossings enhanced with rectangular rapid flashing beacons, a new traffic signal, LED street and pedestrian lighting, a parklet, bus shelters, new sidewalks, monument signs, and drought-tolerant streetscaping.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
27 Vanessa Muñoz, PE, TE
QA/QC Manager
Profile Summary
Education:  BS, Civil Engineering, California State Polytechnic University, Pomona Registration:  Civil Engineer, California No. 67583
 Professional Traffic Operations Engineer
 Traffic Engineer, California No. 2341
 Doppler Traffic Operator
Experience: 25 Years
Ms. Vanessa Muñoz is an accomplished engineer for multi-discipline and multi-agency traffic and transportation projects and has designed over 1,000 signalized intersections and supervised the completion of over 2,000 projects for a variety of large- to small-scale projects. She has 25 years of traffic engineering and transportation planning experience in traffic impact studies, engineering and traffic surveys, design and operations, municipal engineering, and operational analyses. Ms. Muñoz is responsible for the analysis, coordination, and preparation of plans, specifications, and estimate for traffic signals, signing, striping, traffic control, flashing beacons, street lighting, interconnect, parking lots, street widening and resurfacing projects. She has performed street lighting inventories for master plans, developed design plans and performed energy audits for street lighting conversions and street lighting upgrades. Ms. Muñoz serves on an on-call basis as the City Traffic Engineer for the Cities of Rolling Hills and Inglewood and has served in a traffic engineer capacity or as City Traffic Engineer for the Cities of Arcadia, Camarillo, and Fontana.

Ms. Muñoz has secured funding through the Safe Routes to School (SR2S) and Highway Safety Improvement Program (HSIP) grants and has managed projects that include federal funds such as SRTS, HSIP, ARRA, STIP, and STPL. She is extremely familiar with the Local Assistance Procedures Manual and has coordinated the approval of NEPA/CEQA, understands the procedures for allocation of construction funds and issuance of the E-76 form.

Relevant Project Experience
Palos Verdes Drive North Bike Lane, City of Rolling Hills Estates, California. Project Manager responsible for securing federal STPL funds in the amount of $2,081,000 (Call for Projects Grant) and state fund in the amount of $554,580 (SR2S Grant) that will serve as the local match for the design and construction of the Palos Verdes Drive North Bike Lanes between Crenshaw Boulevard and the West City Limits. Willdan Engineering provided engineering and construction engineering services to the City of Rolling Hills Estates for the Palos Verdes Drive North Bike Lane Project. The design aspect of the project included the roadway widening approximately 1.26 miles long for the addition of 5-foot bike lanes within a 200-foot right-of-way, as well as the addition of a second through lane at major intersections to increase capacity. The improvements included the installation of raised medians, street resurfacing and traffic signal modifications. Other services provided by Willdan Engineering and essential to the success of the project included utility coordination/relocation, federal funding administration; environmental clearance (NEPA and CEQA); contract administration and construction inspection.

Richmond Road Bike Path, City of Ridgecrest, California. Lead Traffic Engineer. Lead Traffic Engineer for the design of a new Class I bike path on Richmond Road between Ridgecrest Blvd and the Bowman Bike Path. Willdan provided professional engineering and environmental compliance services for the Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
28 extension of the existing Class I Bowman Bike Path along Richmond Road from the existing bike path (north of Upjohn Avenue) to Ridgecrest Boulevard.
12 Park Lighting Analysis, City of Norwalk, California. Project Manager. Willdan Engineering provided professional energy and engineering services for the lighting analysis and audit on 12 parks in the City of Norwalk. The City is interested in retrofitting the existing parks’ lighting fixtures in order to reduce the energy consumption throughout the parks, as well as supplementing the existing lighting with additional lighting to improve safety in and around the parks and reduce crime. Furthermore, three parks have ballfields that are not currently lit and the City is requesting a lighting analysis be performed to assess how much it would cost to install energy-efficient ballfield lighting. Willdan Energy will perform Park Lighting Energy audits that will meet or exceed the minimum requirements of ASHRAE energy audit guidelines (RP-669). For sites where it is not appropriate or customary to include certain elements and/or deliverables outlined in the ASHRAE Level 2 audit (for example, pools and sports complexes), it is allowable to not address all specified components and deliverables noted in the audit description.

Drummonds Avenue Widening Project (HSIP), City of Ridgecrest, California. Project Manager.

Responsible for providing engineering services to perform environmental, design engineering, and federal compliance services for the City’s Drummond Avenue Widening project. The project includes the design of new curb, gutter, sidewalks, crosswalks, ADA curb ramps, asphalt concrete paving, signing and striping along Drummond Avenue between Downs Street and Inyo Street. We understand that the proposed improvements are funded by the Highway Safety Improvement (HSIP) federal programs and require the services of a consultant with expertise in the management of federally-funded projects. The grant amount is $293,000. The Drummond Avenue widening will provide two lanes of travel for each direction and will align with the existing cross section at Downs Street and Inyo Street. Willdan prepared the NEPA Categorical Exclusion with technical studies including hazardous material, biological resources and cultural studies. The CEQA was a negative declaration or mitigated negative declaration documents. The grant paperwork included preliminary engineering, field review and right of way certifications. Other services provided by Willdan included geotechnical study and utility coordination.

Firestone Boulevard Capacity Enhancement, City of South Gate, California. California. Project Manager. Responsible for traffic engineering design and studies required for the corridor improvements from Alameda Street to Hunt Avenue. The improvements involved roadway widening from four to six lanes; pavement rehabilitation; landscape and hardscape medians; median lighting; sidewalk, curb and gutter, and driveway approach reconstruction; ADA-compliant ramps; parkway trees; artistic elements and corridor entrance monument; bus shelter and bus turnouts; and traffic signal modifications.

Services provided included civil, traffic, pavement, and drainage engineering; landscape architecture, survey and right-of-way engineering; and utility relocation.

Lakewood Boulevard Regional Corridor Capacity Enhancement, City of Lakewood, California. Project Manager. Responsible for oversight of traffic engineering services provided for 1½-mile complete street/green street improvements between the north City limit and Del Amo Boulevard to provide for a regional bicycle path in compliance with the Gate-way Council of Governments Active Transportation Plan and improve pedestrian access to retail/commercial establishments. The design entailed coordination of pedestrian and bicycle movements into the current County Traffic Signal Synchronization Program, undergrounding utility distribution and transmission, Green Streets stormwater quality treatment, and drought-tolerant landscaping. Other improvements involved upgraded traffic signal equipment to improve safety, bicycle parking and lockers, improved transit stops, sidewalk additions within the corridor to meet ADA requirements, street resurfacing, and irrigation.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
29 Bryan Nguyen, RLA
Landscape Architectural
Profile Summary
Education:  BS, Landscape Architecture, California State Polytechnic University, Pomona  Street Tree Seminars
Registration:  Landscape Architect, California No. 4967 Experience: 19 Years
Mr. Bryan Nguyen has over 19 years of landscape architecture and graphic design experience. Mr.

Nguyen's experience includes the development of conceptual landscape plans with extensive graphic vignettes such as photographic before and after simulations; the preparation of construction documents; and plan checking services for many public agencies. Mr. Nguyen is proficient in AutoCAD, MicroStation, SketchUp Pro, LandFX, and Adobe Photoshop. Other duties include the preparation of irrigation water and landscape management construction documents and performing third-party landscape plan reviews.

Relevant Project Experience
As-Needed Landscape Architecture Staff Augmentation for the Los Angeles County Department of Public Works, Design Division. Landscape Architect. Willdan provided landscape architectural staff augmentation services to the Los Angeles County Department of Public Works, Design Division. Duties include assisting the County’s landscape architect project manager with various tasks, e.g. construction documentation preparation, conceptual exhibits preparation, construction plan and specification reviewing etc.

Prop 84 Implementation Grant Application, City of Lakewood, CA. Grant Application Preparer.

Willdan was retained to assist in the preparation of Prop 84 Implementation Grant Application related to water conservation in the landscape. Grant funding paid for the conversion of existing turf medians to drought-adaptive low water use landscape. Scope of work included project information questionnaire, a Powerpoint presentation, cost estimates and view simulations of the proposed improvements. The City was awarded the requested $1 million dollars, and the project was completed in the spring of 2020.

Salud Park, City of Paramount, CA. Designer. Funding for this 8-acre park development was through a park grant from Proposition 84. Willdan was involved with this project from the very beginning of planning, through the grant application submittal and the preparation of construction documents.

Willdan also handled the construction management services. The project includes a synthetic turf play fields, 400-meter walking/running track, multi-use soft-footed trails, exercise stations, parking, security lighting, and enclosed decorative steel fencing for the entire park. Willdan went through a lengthy review process and adhered to all requirements set forth in SCE conditions of approval.

Metropolitan Transit Authority (MTA) Right-of-Way (ROW) Multi-Purpose Trail, City of Paramount, CA. Landscape Architect. The project involved the construction of an estimated ½ mile multi-purpose trail consisting of decorative overhead lighting, benches, bollards, landscape and irrigation, trash receptacles, and bicycles racks. The project is located within the MTA ROW easements, from Lakewood Boulevard to Somerset Boulevard. This segment is part of the City’s 2.5 miles of trails within the MTA ROW that are currently in the planning stage and will be constructed when funds are available. Willdan was responsible for the conceptual plans and illustrations, construction documents, and construction support services. As which included the preparation of; and preparation of construction documents.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
30 Carlos A. Espinoza
Landscape Architect
Profile Summary
Education:  Skills Certificates in Landscape Irrigation Science and Turf Grass Management Mt. San Antonio College, Walnut, CA
 Skills Certificate in Geographical Information Computer Systems (ArcGIS 9.2) Mt. San Antonio College, Walnut, CA
 BS, Landscape Architecture, California State Polytechnic University, Pomona  Landscape Architecture Study Abroad, Castiglione Fiorentino, Italy  ITALART Associazione Culturale Centro Studi, S. Chiara. Cal Poly Pomona Tuscany, Italy  AA, General Education, Chaffey College, Rancho Cucamonga, California Registration: Landscape Architect, California No. 6534
Experience: 13 Years
Mr. Carlos Espinoza has been involved in the preparation of planting, irrigation, and hardscape construction documents for county and municipal entities, large commercial sites, and custom-built residential. He prepares documents including site inventories documenting existing conditions. Mr.

Espinoza managed and executed planting selection, and coordinated with nurseries for plant availability, and allocation of planting material per availability. He observed the planting process to ensure accurate onsite installation per specifications. He coordinated with outside consultants on multiple aspects of projects, including structural engineers and civil engineers to ensure the timely completion of landscape projects. Mr. Espinoza performed pre-construction and post-construction site visits to ensure that landscape plans, specifications and details are followed. He prepared cost-estimation documents. He is proficient in ArcGIS 9.2, AutoCAD, MS Office Suite, Adobe Photoshop, and Sketch-Up software. Mr.

Espinoza is fluent in the Spanish language, both written and spoken.

Relevant Project Experience
As Needed Landscape Architecture & Engineering Design Services, County of Los Angeles, CA.

Designer. The County of Los Angeles retained Willdan to provide as-needed landscape architectural design services for staff augmentation at the Alhambra office location.

Clarksdale Skate Park Renovations, City of Hawaiian Gardens, CA. Field Observer. Willdan was retained to design a skate park at Clarkdale Park. The skating elements will be a combination of concrete elevated bowls and ramps along with jump boxes and stair rails. Our services include concepts, construction drawings and bidding support.

Quality Control Inspection/Customer Services, City of Yorba Linda, CA. Landscape Architect/Task Manager Assistant. As part of Willdan's current on-call services with the City of Yorba Linda, the City's Landscape Department has requested a landscape Inspection/Quality Control Staff Member to assist with the City's Landscape Maintenance District day-to-day operations. Services include field visits and interaction with contractors and local residents; plans reviewer; construction management services for the renovations of landscape medians to drought adaptive planting material- citywide; additionally, has requested for the preparation of a construction documents for the conversion of city medians to drought adaptive landscapes.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
31 Tyrone Peter, PE
Civil Engineering Lead
Profile Summary
Education:  BS, Engineering and Civil Engineering, Tamil Nadu College of Engineering  Civil Engineering, Murugappa Polytechnic
Registration:  Civil Engineer, California No. 81888
Experience: 16 Years
Mr. Tyrone Peter is an accomplished civil engineer for multi-discipline and multi-agency infrastructure projects and is known for providing innovative, quality engineering services to ensure project delivery within budget and schedule. His years of experience managing and designing all types of public works projects provide a solid foundation to understand what is needed to deliver a successful project and make him the perfect fit for overseeing the entire project as well as specific civil engineering tasks. Mr.

Peter's comprehensive experience includes the design of state highway, new street, street widening, street realignment, pavement rehabilitation, light rail and railroad, grade separation, flood control facility, water, and sewer projects. He has supervised feasibility study, project study report, project report, construction document preparation as well as grade certification issuance, construction administration, and construction inspection.

Relevant Project Experience
City of Westlake Village Westlake Village Community Park and YMCA Building, Westlake Village, California. Project Manager. Willdan provided project management design environmental clearance and construction management and inspection services for this multi-phased project to construct a new 20-acre park and YMCA facility. Construction contracts completed for this project encompass mass grading drainage improvements on-site utility installations, three booster pump stations enclosed within new buildings, two concessions, restroom buildings, retaining walls, access roads, a skate park, playground and fitness areas, beach volleyball courts, baseball and soccer fields and a 10,000-squarefoot YMCA building. Overall earthwork involved remediation and cut-and-fill quantities of over 1 million cubic yards of earth. The design involved backbone storm drain infrastructure as well as debris and retention basin. The site utility plan included services for water, sanitary sewer, gas and electric.

Willdan managed the design of MIG Inc. and provided on-site design as necessary for aspects of the work such as ADA-compliant ramp installations, slope landscaping redesign and fire lane permitting.

Willdan procured coordinated and managed dozens of contracts and oversaw all aspects of building and safety water pressure health and safety and construction, acting as the general contractor to support the City Council’s direction to phase the work out and use inventive procurement methods to reduce the cost of installations like grates lighting poles and a gazebo. This state-of-the-art project would be impossible for most cities the size of Westlake Village; but the cohesive commitment by the City Council, City management and City staff added to the dedication and effort of the Willdan team made this amazing park possible.

Urban Greening Bicycle Trail, City of Lynwood, California. Project Manager responsible for overall project management and oversight required to develop a sustainable, integrated, and efficient design for a bicycle trail within the community consistent with the City's year-round recreational programs. The $2.85 million, 1.2-mile project improvements were designed to meet the City's general plan objectives and incorporate landscaping and decorative/commemorative points of interest along the trail. The Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
32 ultimate bicycle path provides safe connectivity between parks, bus and light rail transit stops, city hall, and other City attractions and shopping areas.

Lakewood Boulevard and Del Amo Boulevard Hot Spot Intersection Improvements, City of Lakewood, California. Project Manager responsible for overall project management and oversight of all services required for the intersection improvements. Improvements encompassed widening the west side of Lakewood Boulevard north of Del Amo Boulevard, modifying/removing the median island on Lakewood Boulevard, widening the south side of Del Amo Boulevard, modifying the median island on Del Amo Boulevard, modifying the traffic signal, relocating street lights per street/median island modifications, box culvert/channel wall modifications, extending Del Amo Boulevard Class 2 bike lanes east of Lakewood Boulevard, and converting a bike path to a recreational path.

Centinela Avenue Median, ADA, and Traffic Signal Improvements, City of Inglewood, California.

Quality Assurance Manager responsible for ensuring services and deliverables required SB-1 and HSIPfunded improvements. The HSIP segment of the project involved installing raised median islands and protected left-turn phasing and upgrading traffic signals between La Cienega Boulevard and La Brea Avenue. The SB1-funded improvements entailed improvements between La Cienega Boulevard and Florence Avenue and involved reconstructing the curb and gutter, resurfacing with asphalt-rubber hotmix; reconstructing damaged and uplifted concrete sidewalk; installing access curb ramps in compliance with ADA requirements; installing landscaping along the parkway; signing and striping; street lighting; and fiber optic interconnects. Both project segments were designed simultaneously and bid as one construction package with two separate bid schedules.

Firestone Boulevard Capacity Enhancement, City of South Gate, California. Project Manager responsible for overall project management and oversight required for the corridor improvements from Alameda Street to Hunt Avenue. The improvements involved roadway widening from four to six lanes; pavement rehabilitation; landscape and hardscape medians; median lighting; sidewalk, curb and gutter, and driveway approach reconstruction; ADA-compliant ramps; parkway trees; artistic elements and corridor entrance monument; bus shelter and bus turnouts; and traffic signal modifications. Services provided included civil, traffic, pavement, and drainage engineering; landscape architecture, survey and right-of-way engineering; and utility relocation.

Alpine Pedal Path, City of Big Bear Lake, California. Project Manager responsible for overall project management and oversight of all services required for the bike path improvements. Providing the separated multi-use trail resulted in safer and more user-inviting travel options. The addition of this path affected the existing Sandalwood Creek. To minimize the impacts to the creek, Willdan designed extended storm drain culverts with head, end, and wing walls added. Additional design elements entailed final alignment grade, drainage, utility relocation coordination, retaining and sound walls, landscape and irrigation, right-of-way acquisition and easement, and legal descriptions and exhibits. The work required coordination with local bus transit and Caltrans District 8.

South Laguna Streetscape, City of Laguna Beach, California. Design Engineer responsible for the preparation of the plans, specifications, and estimate design documents Willdan prepared both the CEQA and NEPA documentation for various aesthetic streetscape and pedestrian safety improvements along Coast Highway in the South Laguna Business District. The work involves the installation of new sidewalks, pedestrian lighting, ADA ramp improvements, landscaping, and bus stop shelters. The preparation of both environmental documents was coordinated with Caltrans District 12 as the project is partially being federally funded through Caltrans’ Local Assistance Program.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
33 Gary Gordon, PE
Structural Engineer
Profile Summary
Education:  BS, Civil Engineering, California State University, Chico Registration:  Civil Engineer, California No. 42176
Experience: 37 Years
Mr. Gary Gordon possesses comprehensive public works experience that encompasses project management; design and construction management of roadway, bridge, traffic signal, waterline, sewer line, drainage system, and airport projects. He has extensive experience administering federal-aid projects and is intimately familiar with the various program requirements from both project management and construction management standpoints. He helped the County of Glenn successfully apply for over $36 million in federal HBP funds for 12 different off-system, structurally deficient, or functionally-obsolete bridges since 2010 – also applying Toll Credits as a match to the HBP funds with no local matching funds required from the County. Mr. Gordon successfully lobbied Caltrans for additional approach funding beyond the typical limits. He has written project study reports to qualify projects for STIP funding, time extension requests to Caltrans and the California Transportation Commission, and specifications utilizing various formats such as Caltrans and the American Public Works Association Green Book. Mr. Gordon’s career includes serving as a staff member of the Shasta County Department of Public Works, Caltrans Division of Structures, and City of Redding’s Department of Public Works Relevant Project Experience
Urban Greening Bicycle Trail, City of Lynwood, California. Structural Engineering Task Manager responsible for all structural design and studies required to develop a sustainable, integrated, and efficient design for a bicycle trail within the community consistent with the City's year-round recreational programs. The $2.85 million, 1.2-mile project improvements were designed to meet the City's general plan objectives and incorporate landscaping and decorative/commemorative points-ofinterest along the trail. The ultimate bicycle path provides safe connectivity between parks, bus and light rail transit stops, city hall, and other City attractions and shopping areas.

Willows Memorial Park and Orland Memorial Park Clean California Grant Estimates, County of Glenn, California. Project Manager responsible for collaborating with Department of General Services staff to develop park improvement exhibits and cost estimates. The quick-turnaround project required a specific Caltrans format to qualify the park projects for Clean California Grant funding. The project was completed in less than a week with Willdan and County staff working collaboratively via phone calls and video meetings to ensure exhibits reflected the County's vision and were within the budgetary limits of the grant. The County was awarded $4.4 million in March 2022.

Lakewood Boulevard and Del Amo Boulevard Hot Spot Intersection Improvements, City of Lakewood, California. Structural Engineering Task Manager responsible for all structural design and studies required for the intersection improvements. Improvements encompassed widening the west side of Lakewood Boulevard north of Del Amo Boulevard, modifying/removing the median island on Lakewood Boulevard, widening the south side of Del Amo Boulevard, modifying the median island on Del Amo Boulevard, modifying the traffic signal, relocating street lights per street/median is-land modifications, box culvert/channel wall modifications, extending Del Amo Boulevard Class 2 bike lanes east of Lakewood Boulevard, and converting a bike path to a recreational path. Willdan provided assistance by Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
34 obtaining a County of Los Angeles construction permit and license agreement for work within the channel.

Hamilton City Community Hall and Chester Walker Memorial Library ADA Improvements Upgrades, County of Glenn, California. Project Manager/Specification Writer responsible for coordinating the architectural design and delivering the plans, specifications, and cost estimate to remodel the Community Hall and the Library in Hamilton City to meet ADA standards. Services extended into construction to provide submittal reviews and RFI responses.

Departmental Office Floor Space Re-Allocation, County of Glenn, California. Project Manager responsible for collaborating with Department of General Services staff to update floor area allocations among various County departments to establish appropriate General Service maintenance and custodial cost allocations for each department's occupied space. Willdan maintains and updates the CAD files reflecting office layouts by County building and floor level. As usage changes, CAD files along with each department's allocated square footage are updated in a master spreadsheet. Adobe Acrobat files of each floor with allocated area for each department are prepared for the County's use.

Various Bridge Replacements and Roadway Improvements, County of Glenn, California. Project Manager responsible for overall project management and services provided for projects throughout the County, including 11 HBP-funded bridge replacement projects. Common elements of all projects include project management, surveying, right-of-way engineering, utility coordination, geotechnical investigation, hydrologic/hydraulic analysis, preliminary engineering studies, environmental documentation, roadway approach design, bridge design, right-of-way clearance and certification, PS&E preparation, bid assistance, and construction support.

Five Bridge Replacements and Bridge Preventive Maintenance, County of Mariposa, California. Project Manager responsible for overall project management and oversight of design services for five bridge replacements and two Bridge Preventive Maintenance Program projects consisting of over 20 bridges.

Services encompass project management, surveying/right-of-way engineering, hydrology/hydraulics, geotechnical, environmental permitting, bridge and road design, appraisal and acquisition, utility coordination, and Caltrans Local Programs assistance.

Mattole River Bridge on Briceland Road, County of Mendocino, California. Project Engineer responsible for the design of this bridge replacement project located on a rural county road that provides access to Sinkyone Wilderness State Park within Mendocino County’s costal wilderness area. Briceland Road over Mattole Creek Bridge’s approach roadway alignment is a series of curves and rolling hills. The existing bridge was constructed in 1967 and is a single-lane structure that consists of two railroad flat cars placed side by side. It has been rated functionally obsolete. In addition, the existing bridge is scour critical; field review indicates that extensive scour has occurred at the bridge foundations. Willdan's replacement option is a single-span precast prestressed box girders that eliminates the need for falsework in this environmentally sensitive area.

County Engineering Services, County of Glenn, California. Project Manager responsible for over-all project management and services provided for various bridge replacement projects throughout the county, including 10 HBP-funded bridge replacement projects. Common elements of all projects include project management, surveying, right-of-way engineering, utility coordination, geotechnical investigation, hydrologic/hydraulic analysis, preliminary engineering studies, environmental documentation, roadway approach and bridge design, right-of-way clearance and certification, PS&E preparation, bid assistance, and construction support.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
35 Ross Khiabani, PE, GE
Geotechnical Engineer
Profile Summary
Education:  MS, Geotechnical Engineering, California State University, Long Beach  Geology, Pahlavi University, Iran
Registration:  Civil Engineer, California No. 37156
 Geotechnical Engineer, California No. 2202
Experience: 47 Years
Mr. Ross Khiabani has more than 47 years of professional experience in performing diversified geotechnical assignments involving soil mechanics and foundation engineering, soil stabilization, landslide analysis and stabilization, settlement evaluations, liquefaction studies, slope stability analyses, laboratory testing, and inspection services during construction operations. His vast experience includes providing engineering services for commercial, industrial, institutional, ports and harbors, public works, transportation (including major bridges, local roads, freeways and toll roads) and water and wastewater facilities projects. This broad base of experience has given him a unique insight into local geotechnical and seismic conditions, and construction processes. Mr. Khiabani has kept in close communication with local, city, county, and state reviewers and is familiar with governing codes and requirements.

Relevant Project Experience
On-Call Geotechnical Services, City of Calabasas, California. Geotechnical Engineer. Willdan provides review of geotechnical and engineering geology reports and plans submitted by developer’s soils engineers and/or engineering geologist using City established policies and procedures and within City timeframes. Prepare review comments and conditions of approval. Review responses to review comments provided by the developer’s geotechnical consultant and work with the developer’s soils engineer to resolve issues generated by review comments. Attend meetings with developers, builders, engineers, and consultants in a timely manner to resolve issues generated during the report review process or during construction. Review soils reports submitted by the developer’s geotechnical consultant for proposed changes during grading. Provide technical support to the City for geotechnical engineering and geologic-related issues on an as-needed basis.

On-Call Geotechnical Services, City of Diamond Bar, California. Geotechnical Engineer. Willdan provides review of geotechnical and engineering geology reports and plans submitted by the developer’s soils engineers and/or engineering geologist using City established policies and procedures and within City timeframes. Prepare review comments and conditions of approval. Review responses to review comments provided by the developer’s geotechnical consultant and work with the developer’s soils engineer to resolve issues generated by review comments. Attend meetings with developers, builders, engineers, and consultants in a timely manner to resolve issues generated during the report review process or during construction. Review the soils reports submitted by the developer’s geotechnical consultant for proposed changes during grading. Provide technical support to the City for geotechnical engineering and geologic-related issues on an as-needed basis.

Fitness Park, City of Paramount, California. Geotechnical Engineering Task Leader responsible for geotechnical engineering and testing services required for improvements to the park. The project includes synthetic turf play fields, 400-meter walking/running track, multi-use soft-footed trails, exercise stations, parking, security lighting, and enclosed decorative steel fencing for the entire park. The park is Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
36 located within Southern California Edison's right-of-way – requiring a lengthy review and adherence to all SCE conditions of approval requirements.

Golden West College Student Services Site Underground HVAC Piping-Huntington Beach, California.

Coast Community College District. Project Manager. Geotechnical material testing and inspection services, Golden West College Student Services site underground HVAC piping.

Kanan Road and Highway 101 Interchange, City of Agoura Hills, California. Project Manager closely working with Caltrans oversight staff performed a geotechnical investigation for the City of Agoura Hills.

This project included the development of drilling work plans, permit acquisition, traffic control, soil and rock logging, sampling, laboratory tests, and foundation recommendations for highway improvements consisting of removal of existing off-ramps, relocation, and widening of streets, construction of bridges and relocation and construction of new on- and off-ramps.

Fedde Middle School Sports Field Master Plan/The Irving Moskowitz Stadium, City of Hawaiian Gardens, California. Geotechnical Engineering Task Leader responsible for geotechnical engineering and testing services required for the sports park master plan for the school site. The master plan consisted of soccer/football fields, baseball diamonds, 400-meter running track and handball courts. Site amenities included concession/restroom buildings, grandstands, stage and playground area. In addition, the City has requested a conceptual design/study for a parking lot over the adjacent Los Angeles County flood control channel.

La Mirada Aquatics Center, La Mirada Unified School District, La Mirada, California. Geotechnical Engineer. Responsible for site investigation and services during construction. Willdan performed the civil design in conjunction with the architectural design team for this unique City-owned project.

Additionally, Willdan served as the construction manager, on-site building official, and construction inspector for this project that has four distinct components: a 20,000-square-foot aquatics building - accommodating locker rooms, bathrooms, offices, multi-purpose areas; construction of three pools - a 50-meter competitive pool, a 25-meter practice pool and a smaller indoor pool and lazy river pool; expansion and interior tenant improvements of the public safety building - a one-story masonry addition with lighting; and parking and site improvements to the surrounding park areas - approximately 180 additional stalls.

Orange Coast Community College, Newport Learning Center, Newport Beach, California. Providing geotechnical engineering, materials testing and inspection services for the construction of the Newport Learning Center, a 3-story type II-B building with 112,795 ASF, associated site development including a large bio-filtering facility, and parking/driveway areas. Services consist of geotechnical observation and testing during remedial grading, over-excavation, mass grading, foundation excavations and utility trench backfill. Testing and Inspection services also include Special Inspection for poured-in-place caissons and 138 soil anchors/tiebacks necessitated by the load demand imposed by a special design element – outward leaning external walls.

Walmart Construction Management & Inspection Services, City of Ridgecrest, California. Materials Testing Manager. Was responsible for quality assurance materials testing during construction of offsite and onsite improvements. Willdan performed complete Construction Management, Geotechnical and Inspection services. In addition, we performed technical inspection services for onsite and offsite grading, street construction, drainage channel construction, drainage culvert construction, asphalt placement, concrete construction and earthwork activities. Provided geotechnical consultation, testing and verification services to meet City of Ridgecrest design standards and per Walmart-approved plans.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
37 David Woolley
Survey
Profile Summary
Education:  Survey & Mapping Coursework at Santiago Canyon College  Courses: Ethics, Business & Professions Code, ALTA/NSPS Courses, Copyright Law and Land Surveying
Registration:  Professional Land Surveyor, California PLS 7304 Experience: 31 Years
Mr. David Woolley is an expert in land surveying; standard of care; construction surveying; boundary line determination and analysis; boundary disputes; deed interpretation; boundary reconstruction; easement analysis and construction; map preparation; and construction and constructability. He has expertise in the Professional Land Surveyor’s Act and the Subdivision Map Act; ALTA surveys; documentation of construction defects; settlement/displacement surveys. land surveying; standard of care; construction surveying; boundary line determination and analysis; boundary disputes; deed interpretation; boundary reconstruction; easement analysis and construction; map preparation; construction and constructability, Mr. Woolley is a recognized land title expert with a proven ability to resolve complex boundary and title review issues and to provide surveys for cases involved in complex litigation throughout the state.

Relevant Project Experience
Survey and Mapping Services, City of Inglewood, California. Survey/Mapping Review. Willdan provided map checking and legal description checking for the City of Inglewood’s engineering department.

Through the on-call services contract, Willdan provided technical reviews of parcel maps, tract maps, lot line adjustment, certificates of compliance, and lot mergers. Willdan was heavily involved in checking various items for the Stadium project.

Survey Services, City of Lakewood, California. Survey/Mapping Review. Willdan performed a topographic survey and partial boundary survey at Lakewood Equestrian Park.

Long Beach Blvd ADA Curb Ramps, City of Lynwood, California. Survey Lead. Willdan provided the design of 21 ADA curb ramps within the Long Beach/Freeway 105 interchange. The scope also included the installation of five ramps for the park and ride and one ramp on the westbound onramp. Willdan surveyed 21 curb ramps for the City of Lynwood within Caltrans ROW at Long Beach Blvd and Freeway 105 interchange so that the redesign would be in compliance with ADA. The scope also included acquiring the Caltrans encroachment permit and engineering support during construction.

Plan Check Services, City of Rialto, California. Survey/Mapping Review. Willdan is providing the City of Rialto with on-call plan-checking services. Plan checking services are provided on engineering plans and studies that are submitted for review by the development community. Plan check services may include but are not limited to grading plans, street improvement plans, sewer and water plans, storm drain plans, traffic plans, landscape plans and all associated studies and reports. Willdan is working with the City to develop an electronic plan check process to allow for all electronic submittals.

Orange County Surveyor’s Office, Reviewed Over 1000 Tract Maps, 500 Parcel Maps and 300 Record of Surveys, California. Former supervisor of the Lot Line Adjustment, Certificate of Compliance, Records of Survey, Parcel Map and Tract Map compliance checking section of the Orange County Surveyor's office.

Was responsible for compliance with state laws, local ordinances and boundary determination. In Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
38 addition to the preparation of Records of Survey, reviewed over 1000 Tract Maps, 500 Parcel Maps and 300 Records of Survey prepared by Professional Land Surveyors.

Long Beach City Surveyor, California. Interim City Surveyor for the City of Long Beach. Was responsible for the land surveying functions of preparing right-of-way documents (i.e. vacations, dedications, acquisitions, etc. or checking the same when prepared by consultants, private property developers, or other agencies). Additionally, as the Contract City Surveyor, reviewed all right-of-way and land surveying work for compliance with state laws (i.e. Government Code (Subdivision Map Act), Civil Code, Civil Procedures, Streets and Highways Code, Public Resource Code, Professional Land Surveyors Act and the agency's local ordinances). This required familiarity with the laws but the ability to work with the private engineers, surveyors, owners, developers, other agencies and protect the interest of the Department.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
39 Diane Rukavina, PE
Grant Funding
Profile Summary
Education:  BS, Civil Engineering, Loyola Marymount University Registration:  Civil Engineer, California No. 36380
Experience: 36 Years
Ms. Diane Rukavina has 36 years of experience in municipal engineering. Presently, she administers federal/state funding administration projects in the Cities of Hawaiian Gardens, La Cañada Flintridge, Lakewood, La Puente, Maywood, Norwalk, Paramount, Pico Rivera, Rancho Palos Verdes, South Gate, and South Pasadena. Ms. Rukavina has processed over 60 federal and state-funded projects (STPL, TEA21, SAFETEA-LU, ARRA, HSIP, TCSP, ER, CMAQ, SRTS, and SR2S) from requests for authorization to final invoicing for 22 cities. Currently, she is coordinating 28 federal and state-funded projects at various stages in the funding process. Ms. Rukavina also serves as Project Manager for six capital improvement projects for the City of Paramount, performs various city engineering-related tasks, and has organized GASB 34 infrastructure inventories for the Cities of Seal Beach, Rosemead, Monrovia, and Bell Gardens in preparation for value assessment.

Ms. Rukavina has over 15 years of experience preparing and submitting documentation to Metropolitan Transportation Agency and Caltrans for federal- and state-funded projects, including STPL, TEA-21, SAFETEA-LU, ARRA, HSIP, TCSP, ER, CMAQ, SRTS, and SR2S. Although each program encompasses different components and requirements, the general process remains the same – following the Caltrans Local Assistance Procedures Manual. Ms. Rukavina keeps abreast of revisions (LPPs) to procedures and forms in the manual.

Relevant Project Experience
Sunset Avenue/Francisquito Avenue Traffic Signal Modification HSIP Cycle 6, City of West Covina, California. Funding Administration Task Leader responsible for all administrative filings and reporting to satisfy funding requirements for a traffic signal modification at the intersection. The City was awarded a $165,200 HSIP Cycle 6 grant to upgrade the traffic signal by installing protected left-turn phasing on West Francisquito Avenue at Sunset Avenue, modifying lighting, and installing a pedestrian countdown head.

Traffic Signal Improvements at Seven Intersections HSIPL Cycle 2, City of Lakewood, California. Grant Administration Task Leader responsible for all administrative filings and reporting to satisfy funding requirements for an E-76 for construction through the final reimbursement of federal funds.

Documentation included field review, preliminary environmental study, right-of-way certification, request for authorization to proceed with construction, construction contract award submittal, progress invoicing, and final report of expenditures for submittal to Caltrans.

Garfield Avenue Corridor Improvements, City of Paramount, California. Grant Administration Task Leader responsible for all administrative filings and reporting to satisfy funding requirements for street improvements between the north City and the south city limits. The design involved street widening to accommodate a third lane in each direction; street resurfacing; two concrete intersections; concrete sidewalk, curb and gutter, and driveway approach reconstruction; catch basin construction; streetscape improvements for raised landscaped medians and modifications to existing medians; two entry monument signs; and traffic signal modifications at nine locations along the Garfield Avenue corridor.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
40 Services included civil, traffic, and drainage engineering; survey and mapping; utility relocation; landscape architecture; and pavement management.

Firestone Boulevard and California Avenue Traffic Signal Modifications HSIP Cycle 4, City of South Gate, California. Grant Administration Task Leader responsible for all administrative filings and reporting to satisfy funding requirements for federally funded Cycle 4 HSIP installation of protected leftturn phasing on Firestone Boulevard at State Street and on California Avenue at Tweedy Boulevard. The City received $531,000 in federal funds and anticipates the total project cost being $590,000. The intersection of Firestone Boulevard at State Street will require vehicle detection upgrades and countdown pedestrian head installation beside the protected/permissive left turn phasing. The intersection of California Avenue and Tweedy Boulevard will require research for the modification of existing decorative poles to accommodate the fully protected left turn phasing. Other services provided by Willdan included grant administration and utility coordination.

Crenshaw Boulevard and Crestridge Road Traffic Signal Improvements HSIPL Cycle 1, City of Rancho Palos Verdes, California. Funding Administration Task Leader responsible for all administrative filings and reporting to satisfy funding requirements for an E-76 for preliminary engineering and construction through final reimbursement of federal funds. Documentation included the request for authorization to proceed with preliminary engineering, field review, preliminary environmental study, right-of-way certification, request for authorization to proceed with construction, construction contract award submittal, progress invoicing, and final report of expenditures for submittal to Caltrans.

Garfield Avenue and Petterson Lane Traffic Signal Improvements HSIPL Cycle 2, City of Paramount, California. Funding Administration Task Leader responsible for all administrative filings and reporting to satisfy funding requirements for an E-76 for construction through the final reimbursement of federal funds. Documentation included the field review, preliminary environmental study, right-of-way certification, request for authorization to proceed with construction, construction contract award submittal, progress invoicing, and final report of expenditures for submittal to Caltrans.

Roadside Avenue Bridge Widening, City of Agoura Hills, California. Funding Administration Task Leader responsible for all administrative filings and reporting to satisfy funding requirements for widening the bridge. The project involved widening the bridge and approaches to accommodate a sidewalk and increasing the traveled way to meet current geometric standards. Willdan's services entailed preliminary engineering; environmental compliance and permits; final design, including construction drawings, special provisions, and cost estimating; environmental mitigation program; right-of-way; local, state, and federal agency permit coordination; grant funding administration and compliance; Local Assistance reports and document preparation; stormwater pollution prevention plan preparation; and bidding and construction support services.

La Brea Avenue Intersection Realignment and Reconstruction, City of Inglewood, California. Funding Administration Task Leader responsible for all administrative filings and reporting to satisfy funding requirements for the two-phased $8.5 million, federally-funded improvements to reconfigure street intersections; construct street improvements; install traffic signals at Brea Avenue, Market Street, Spruce Avenue, and La Palma Avenue; and reconstruct pavement on La Brea Avenue between 104th Street and Hawthorne Boulevard. The street improvements project scope entailed PCC bus pads, minor concrete with utility frame cover adjustments, a new traffic signal and modification of two existing traffic signals, sidewalks, driveways, median curbs, automatic irrigation system, tree planting, striping, and signage.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
41 Jeffrey Lau, PE, TE, ENV SP
Traffic Engineering Lead
Profile Summary
Education:  BS, Civil Engineering Polytechnic State University, Pomona Registration:  Civil Engineer, California No. 83887
 Traffic Engineer, California No. 2835
 Doppler Radar Operator
Experience: 19 Years
Mr. Jeffrey Lau possesses expertise in various facets of traffic engineering, including field investigations, traffic data collection and analysis, traffic design, and project management. Mr. Lau has been involved in fieldwork, design, and drafting on a variety of traffic engineering projects, including traffic signals, signing and striping, street lighting, and construction traffic control. He has assisted with the preparation of traffic impact studies and analyses, plan reviews, engineering and traffic survey studies, and recertifications/updates. Mr. Lau is highly proficient in numerous traffic software programs such as AutoCAD, MicroStation, Synchro, HCS+, PC-Warrants, AGi32, and Crossroads Collision Database.

Relevant Project Experience
Paramount Boulevard Urban Renovation and Complete Street Improvements, City of Paramount, California. Traffic Engineering Designer responsible for providing traffic engineering design for improvements required for street improvements necessary to transform Paramount Boulevard from a four-lane arterial roadway into a scenic, multi-modal complete street corridor lined with shade trees and LED lighting to foster a more walkable and vibrant downtown atmosphere. The improvements involved traffic-calmed vehicle lanes with bulb-outs, two mid-block pedestrian crossings enhanced with rectangular rapid flashing beacons, a new traffic signal, LED street and pedestrian lighting, parklet, bus shelters, new sidewalks, monument signs, and drought-tolerant streetscaping.

Coyote Creek Bicycle Trail and Park, City of Los Alamitos, California. Traffic Engineering Task Leader responsible for oversight of traffic engineering services provided for the bicycle trail and park improvements. The improvements encompassed new sculptural/artistic gates, landscaping, and wayfinding and interpretive graphics/features at trailheads at Katella Avenue and Willow Street, Oak Academy Park and Oak Street, Cerritos Avenue, and Los Alamitos Boulevard and Nor-walk Boulevard.

The project involved removing and reconstructing deteriorated pavement sections and adjusting water valve covers to grade. Permits for environmental clearance and construction were obtained through a collaborative effort with the U.S. Army Corps of Engineers along with a negotiated cooperative maintenance agreement with the Los Angeles County Department of Public Works.

West Santa Ana Branch Bicycle Trail STP Application, City of Paramount, California. Traffic Engineering Task Leader responsible for oversight of traffic engineering services required to prepare an ATP Cycle 3 application for the City's bicycle trail improvement project. The necessary application documents were completed and narrative questions were researched and answered. Services encompassed attending meetings; gathering collision data; researching grant application projects by reviewing City master plans, general plans, and regional plans; performing field investigations; preparing cross sections and alignment concepts; assessing conflicts; identifying right-of-way takes; assessing environmental impacts; and preparing an engineering estimate.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
42 Garfield Avenue Class II Bicycle Lanes ATP Application, City of South Gate, California. Project Manager responsible for overall project management and oversight for preparing ATP Cycle 3 applications for the City's bicycle trail improvement project. The necessary application documents were completed and narrative questions were researched and answered. Services encompassed attending meetings; gathering collision data; researching grant application projects by reviewing City master plans, general plans, and regional plans; performing field investigations; preparing cross sections and alignment concepts; assessing conflicts; identifying right-of-way takes; assessing environmental impacts; and preparing an engineering estimate.

Long Valley Road/Valley Circle Boulevard/U.S. 101 On-Ramp Improvements. City of Hidden Hills, California. Traffic Engineering Task Leader responsible for traffic engineering design and studies required to improve traffic congestion and pedestrian access at the Long Valley Road on-ramp intersection. The improvements encompass sidewalks, right turn-out lane, a paved public parking lot and staging area for City entry, an on-ramp sidewalk, shoulder paving, and other improvements at the heavily congested intersection of Long Valley Road and U.S. 101 on-ramp. Willdan is providing civil, drainage, landscape architectural, and traffic design; environmental compliance documentation; survey; geotechnical engineering and materials testing; grant funding administration; utility coordination; NPDES, SWPPP, and erosion control; right-of-way engineering; and construction support for this Measure R improvement project.

Firestone Boulevard Capacity Enhancement, City of South Gate, California. California. Traffic Engineering Task Leader responsible for traffic engineering design and studies required for the corridor improvements from Alameda Street to Hunt Avenue. The improvements involved roadway widening from four to six lanes; pavement rehabilitation; landscape and hardscape medians; median lighting; sidewalk, curb and gutter, and driveway approach reconstruction; ADA-compliant ramps; parkway trees; artistic elements and corridor entrance monument; bus shelter and bus turnouts; and traffic signal modifications. Services provided included civil, traffic, pavement, and drainage engineering; landscape architecture, survey and right-of-way engineering; and utility relocation.

Lakewood Boulevard Regional Corridor Capacity Enhancement, City of Lakewood, California. Traffic Engineering Task Leader responsible for oversight of traffic engineering services provided for 1½-mile complete street/green street improvements between the north City limit and Del Amo Boulevard to provide for a regional bicycle path in compliance with the Gate-way Council of Governments Active Transportation Plan and improve pedestrian access to retail/commercial establishments. The design entailed coordination of pedestrian and bicycle movements into the current County Traffic Signal Synchronization Program, undergrounding utility distribution and transmission, Green Streets stormwater quality treatment, and drought-tolerant landscaping. Other improvements involved upgraded traffic signal equipment to improve safety, bicycle parking and lockers, improved transit stops, sidewalk additions within the corridor to meet ADA requirements, street resurfacing, and irrigation.

Willdan provided preliminary and final design, NEPA/CEQA documentation and permitting, transit partnering outreach, Corridor Committee meeting participation, and construction funding application preparation.

Palos Verdes Drive North Bicycle Lane RPSTPLE/SR2S Improvements, City of Rolling Hills Estates, California. Traffic Engineering Designer responsible for providing traffic engineering design provided for a $4 million improvement project adding bicycle lanes between Crenshaw Boulevard and the west city limits. Willdan provided preliminary and final design and construction management for the 1.26-mile roadway widening. The improvements were necessary to accommodate a second through lane at major intersections to increase capacity and add 5-foot bicycle lanes within a 200-foot right-of-way.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
43 Kevin Custado, EIT, ENV SP
Electrical (Site Lighting)
Profile Summary
Education:  BS, Civil Engineering, California Polytechnic State University, Pomona Registration:  Engineer-in-Training, California No. 153964; Envision Sustainability Professional Experience: 8 Years
Mr. Kevin N. Custado specializes in traffic engineering investigations and planning and is knowledgeable in highway engineering processes and their application to operating systems. He is experienced in park lighting, traffic signalization and the geometric design of transportation projects, including alignment reconfiguration, quantity estimates, plan and profile generation using AASHTO and Caltrans design manuals, and coordinating with other disciplines. Mr. Custado clearly conveys design intent in engineering drawings and specifications and has developed a thorough understanding of construction methods and issues that arise as engineering drawings and specifications are translated into the constructed product.

Relevant Project Experience
Norwalk 12 Park Lighting Analysis, City of Norwalk, California. Design Engineer. Willdan provided energy and engineering services for the lighting analysis and audit of 12 parks in the City of Norwalk.

The City is interested in retrofitting the existing parks’ lighting fixtures in order to reduce the energy consumption throughout the parks, as well as supplementing the existing lighting with additional lighting to improve safety in and around the parks and reduce crime. Furthermore, three parks have ballfields that are not currently lit and the City is requesting a lighting analysis be performed to assess how much it would cost to install energy-efficient ballfield lighting.

Traffic Signal Design, City of La Mirada, California. Design Engineer. Willdan is responsible for the preparation of plans, specifications and estimates (PS&E) for the design of three (3) traffic signal modifications at the intersections of La Mirada Boulevard and Rosecrans Avenue, Imperial Highway and Santa Gertrudes Avenue, and Imperial Highway and Ocaso Avenue. The objective is to upgrade the existing traffic signals to meet current design standards, including but not limited to the replacement of pedestrian heads, 8-inch vehicle heads, pedestrian push buttons, as well as add additional vehicle heads for thru lanes, upgrade safety lighting to LED, and replace IISNS with RSNS on a cantilever arm Firestone/Atlantic Design, City of South Gate, California. Design Engineer. Willdan provided surveying, civil engineering, geotechnical engineering, and utility coordination services for street improvements on Firestone Boulevard from Dorothy Avenue to Lotta Avenue and on Atlantic Avenue from Patata Street to Branyon Avenue. As part of our design services, Willdan provided final civil plans, including street design, storm drain, sewer and water relocation, traffic signal modification and installation, signing and striping, street lighting, contract specifications, and engineer's estimate for widening both Firestone Boulevard and Atlantic Avenue. In addition, Willdan prepared a project report and cost estimates, including aerial topography and street centerlines; roadway geometrics; hydrology study; sewer study; water study; utility relocation concepts; geotechnical recommendations; turn pocket lengths; landscaping.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
44 Traffic Signal at Palos Verdes Drive North and Rolling Hills Road, City of Rolling Hills Estates, California.

Design Engineer. Willdan provided engineering services for design and utility coordination for the traffic signal modification project at the intersection of Palos Verdes Drive North and Rolling Hills Road in the City of Rolling Hills Estates. Presently, the traffic signal poles have a decorative wood cover. In order to retain a similar look, the traffic signal modification will include new decorative poles designed by South Coast Lighting, including the modified foundations. The primary purpose of the traffic signal modification is to provide protected/permissive left-turn phasing for both directions on Palos Verdes Drive North and the replacement of all the traffic signal poles with new decorative poles and the City has a budget of $240,000. Preparation of plans, specifications and estimate will be completed within a one-month period to expedite the process and get the project to construction within a six-month period. Willdan will assist the City with the procurement of long-lead time equipment such as the traffic signal controller cabinet and traffic signal poles to minimize delays on the project.

Foothill Blvd-Dalton Avenue Traffic Signal Installation Design, City of Azusa, California. Design Engineer. Willdan Engineering provided professional traffic engineering design services for the City of Azusa. The project required professional engineering design services for the preparation of plans, specifications and estimates (PS&E) for the traffic signal installation at the intersection of Foothill Boulevard at Dalton Avenue. Minor signing and striping modifications were required and were shown on the traffic signal plan. Due to the close proximity of the proposed traffic signal to the adjacent traffic signal at Foothill Boulevard and Alameda Avenue, a signal interconnect plan was also prepared. A field investigation, utility coordination and turning movement counts were also conducted during this design service.

Imperial Highway Project (P610) Traffic Improvement Plans, City of Inglewood, California. Traffic Designer responsible for assisting with the design to prepare traffic signal modification plans for Simms Avenue, Ardath Avenue, Yukon Avenue, and Doty Avenue and signing and striping plans for the project limits. Services encompassed utility coordination, engineering during construction, and coordination with the County of Los Angeles to incorporate their resurfacing plans and bid items into Willdan's plans, specifications, and estimate package. Coordination with the County was required for future implementation of the Imperial TSSP project at its intersections with Prairie Avenue, Crenshaw Boulevard, and Van Ness Avenue.

Foothill Blvd-Dalton Ave Traffic Signal Installation Design, City of Azusa, California. Design Engineer.

Willdan Engineering provided professional traffic engineering design services for the City of Azusa. The project required professional engineering design services for the preparation of plans, specifications and estimates (PS&E) for the traffic signal installation at the intersection of Foothill Boulevard at Dalton Avenue. Minor signing and striping modifications were required and were shown on the traffic signal plan. Due to the proximity of the proposed traffic signal to the adjacent traffic signal at Foothill Boulevard and Alameda Avenue, a signal interconnect plan was also prepared. A field investigation, utility coordination and turning movement counts were also conducted during this design service.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
45 4. Similar Projects and References
Willdan designs and develops quality parks and recreation facilities with a strong sense of place through a thoughtful planning, design, and implementation process that saves costs and optimizes long-term maintenance. We have completed dozens of parks and recreation facilities that combine functional, visually pleasing environments and build strong community connections. Below is a list of our similar park projects.

Project/Client Improvements Scope of Services Building Grading Park Landscaping Design Resident Engineering Construction Management Construction Inspection Scheduling Survey Constructability Review Utility Coordination Materials TestingCommunity OutreachEnvironmental DocumentationLabor Compliance Salud Fitness Park, City of
Paramount              
La Puente Park Beautification
Project, City of Paramount             
Recreation Center Master
Plan Expansion, City of
Fountain Valley
             
Riverfront Park, City of
Maywood                
Police Department Remodel,
City of Palm Springs            
Rails-to-Trails Walking,
Running, and Bicycle Route
Improvements, City of Rialto
          
Bud Bender Park
Rehabilitation, City of Rialto              Anderson Park, Rialto City
Park, and Frisbie Park
Concession and Restroom
Facilities, City of Rialto
          
Chittick Field Renovation, City
of Long Beach              
Discovery Sports Complex,
City of Downey        
Whittier Dog Park, City of
Whittier   
Paramount Park Expansion,
City of Paramount    x x        
Cesar Chavez Park, City of
South Gate           
Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
46 Project/Client Improvements Scope of Services Building Grading Park Landscaping Design Resident Engineering Construction Management Construction Inspection Scheduling Survey Constructability Review Utility Coordination Materials TestingCommunity OutreachEnvironmental DocumentationLabor Compliance Heritage Valley Parks Tract
No. 5520 Offsite and Onsite
Improvements, City of
Fillmore
           
Caruthers Park Storm Water
and Urban Runoff Capture,
City of Bellflower
            
Lindero Linear Park Phases 1
and 2, City of Westlake Village    
Heritage Park Aquatics
Complex, City of Irvine             
Community Park and YMCA
Building, City of Westlake
Village
            
Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
47 Willdan is pleased to provide the following reference projects performed during the past five years.

These projects were completed within the agency’s timeframe and the construction costs were within the allocated budgets. Reference contact information is provided with each project description.

Salud Park, Paramount, California
Client Project Manager:

David Johnson, Director of
Community Services and Recreation,
City of Paramount, 14522 Garfield
Ave, Paramount, CA 90723
Phone: (562) 220-2138
Services :

Project Management, Design,
Landscape Architecture, Construction
Management
Start-End Dates:
2009 – 2015
Proposed Staff Involvement: John Hidalgo, RLA, Project Manager Total Project Cost:
$4,600,000
Funding for this 8-acre park development was available through a park grant from Proposition 84. Willdan was involved with this project from the very beginning of planning, through the grant application submittal and the preparation of construction documents. Willdan also handled the construction management services. The project includes synthetic turf play fields, a 400-meter walking/running track, multi-use soft-footed trails, exercise stations, parking, security lighting, and enclosed decorative steel fencing for the entire park. The park development is located within Southern California Edison right-of-way, therefore went through a lengthy review process and adhered to all requirements set forth in the SCE conditions of approval.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
48 La Puente Park Beautification Project, La Puente, California Client Project Manager:

City of La Puente
Contact: John Di Mario, Development
Services Director, 15900 E. Main
Street, La Puente, CA 91744
Phone: (626) 855-1517
[email protected]
Services: Project Management,
Design, Landscape Architecture,
Construction Management
Start-End Dates:
2019 - 2021
Proposed Staff Involvement: John Hidalgo, RLA, Project Manager Total Project Cost:
$2,300,000
Willdan provided landscape architecture design services involving the enhancement of an existing community park. The park is estimated at 20 acres and encompasses a variety of activities such as baseball, softball and football fields, playgrounds, open lawn areas, a community center, picnic shelters, restrooms, and City maintenance yard. The new additions include an expanded decorative concrete promenade area for the softball and little league fields, parking lot reconfiguration, ballfield lighting, shade trees, benches, pedestrian lighting and new landscape and state of the art irrigation system. Willdan is currently providing construction management and inspections.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
49 Recreation Center Master Plan Expansion, Fountain Valley, California Client Project Manager:

Hyejin Lee, Director of Public Works,
City of Fountain Valley, 10200 Slater
Ave, Fountain Valley, CA 92708
Phone: (714) 593-4434;
[email protected]
Services :

Project Management, Design,
Landscape Architecture,
Construction Management
Start-End Dates:
2009-2012
Proposed Staff
Involvement:

John Hidalgo, RLA, Project
Manager
Total Project Cost:
$17,100,000
Willdan was responsible for the rehabilitation of an existing 55-acre sports complex and an addition of 23 acres to produce a new 78-acre regional sports facility. The project provides the community with six new softball fields, six Little and Pony League fields, four soccer fields, a utility field, a large concert-in-the park and assembly area, two new concession/restroom buildings, a new maintenance building and over one mile of natural hiking trails that connect to the existing County hiking trail system in Mile Square Park. The new improvements add to the existing tennis courts, indoor and outdoor basketball courts, handball and racquetball courts and recreation building.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
50 Riverfront Park, Maywood, California
Client Project Manager:

City of Maywood, 4319 E Slauson
Avenue, Maywood, CA 90270
Phone: (626) 643-6996;
[email protected]
Services: Project Management,
Design, Landscape Architecture,
Construction Management
Start-End Dates:
2008-2015
Proposed Staff
Involvement:

John Hidalgo, RLA, Project
Manager
Total Project Cost:
$3,400,000
Willdan was retained to develop a 7-acre park site that was considered a “brownfield” by the EPA. Portions of the site tested positive for contaminants and were thus declared a Superfund site. This site was occupied previously by a railroad track spur, a metal plating company, a battery manufacturer, and residential properties. A thorough remediation program administered by the Environmental Protection Agency has allowed the reclamation of the land for public use. Willdan assisted in securing various grant funding along with working closely with the EPA in developing and ensuring mandated mitigation measures were met for site reclamation. Over ten governing agencies were involved in developing/overseeing this park site.

The park consists of 7.3 acres adjacent and overlooking the Los Angeles River. Development of the park includes street vacation, extensive network of monitoring wells relocation and adjustments, parking lot, restroom facilities, retaining walls, large gathering spaces, landscaping, sidewalks, bicycle paths, a staging/resting area for those using the Los Angeles river trail, a bridge, walking trails, lawn and picnic areas, a basketball court, a passive playfield, a California native demonstration gardens reflecting the river’s natural plant community habitat, the incorporation of a swale to add to a natural habitat setting and aid in the control of runoff, community art sculptures and plenty of shade trees to sit under. Field and security lighting is provided for evening use of the park. Willdan prepared plans, specifications, and estimates for Riverfront Park with funds made available through Trust for Public Land, Coastal Conservancy, and various park bond measures.

By meeting all the strict mitigations imposed on the site, Willdan successfully completed the construction of the park site which integrated character and personality to the local community along the LA River Corridor.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
51 5. City Standard Contract
Willdan has reviewed the City’s Agreement, has no exceptions or comments for the City to consider, and will comply with all aspects of the Agreement. Willdan will also provide the Insurance Coverage Limits and Requirements indicated in the City’s RFP, as provided in Attachment D.

Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
52 6. Required Attachments
Attachment A – Affidavit of Non-Collusion
Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
53 Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
54 Attachment B - Claims History
Design Phase Engineering Services for the
Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
55 13191 Crossroads Parkway North, Suite 405
Industry, CA 91746-3443
562.908.6200 | 800.499.4484 | 562.695.2120
www.willdan.com
21 EXHIBIT “C”

COMPENSATION RATE
City of Cudahy
Fee Proposal
Provide Design Phase Engineering
Services for the Preparation of PS&E for
the Cudahy Park Renovation Project
November 3, 2022
November 3, 2022
City of Cudahy
5220 Santa Ana Street
Cudahy, CA 90201
Attn: Victor Maria Santiago
Parks and Recreation Manager
Subject: Fee Proposal for Design Phase Engineering Services for the Preparation of PS&E (Plan, Specifications and Estimates) for the Cudahy Park Renovation Project Willdan Engineering (Willdan) is pleased to submit this Fee Proposal to provide Design Phase Engineering Services to the City of Cudahy.

If you have any questions or need additional information, you may contact me at 657-223-8557 and/or by email at [email protected].

Respectfully submitted,

WILLDAN ENGINEERING
Tyrone Peter, PE
Deputy Director of Engineering
Fee Proposal -- Design Phase Engineering Services for the Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
2 FEE ESTIMATE PROPOSAL
Willdan’s fee estimate is shown below, and our Schedule of Standard Hourly Fee Rates is presented on the following page.

Civil Engineering Plans $35,800
Topographic Survey $13,300
Geotechnical Investigations $28,600
Structural Engineering $ 8,400
Site Amenities Plans $11,300
Landscape and Irrigation Plans $44,500
Shade Shelter Plans $15,700
Playground and Fitness Stations Plans $12,200
Basketball Courts Renovations $14,900
Community Stage Plans $ 8,800
Multi-Purpose Fields Renovations $13,300
Splash Pad Plans $ 8,500
Specifications and Cost Estimates $ 9,500
Bidding Assistance $ 3,200
Construction Support Services $ 6,600
Project Management $17,200
Sub-Consultant
M Y Engineering, Inc. (Electrical and Lighting Design) $20,700 ELMT (Soils Management Plan) $ 6,000
Spohn Ranch (Skate Park Plans) $21,900
AWu Government Services (Community Stage Overhead) $18,500 Total Not to Exceed Fee $318,900
Fee Proposal -- Design Phase Engineering Services for the Preparation of PS&E for the Cudahy Park Renovation
City of Cudahy
2 13191 Crossroads Parkway North, Suite 405
Industry, CA 91746-3443
562.908.6200 | 800.499.4484 | 562.695.2120
www.willdan.com
1 2023

FIRST AMENDMENT TO CONTRACT SERVICES AGREEMENT
(Engagement: Design Engineering Services)
(Parties: City of Cudahy and Willdan Engineering)
THIS FIRST AMENDMENT (hereinafter, “First Amendment”) to that certain agreement entitled, “Contract Services Agreement” and dated December 6, 2022 (hereinafter, the “Master Agreement”), is hereby made and entered into this 18th day of July 2023 (hereinafter, “Effective Date”) by and between the City of Cudahy, a municipal corporation (hereinafter, “City”) and Willdan Engineering, (hereinafter, “Consultant”). For purposes of this First Amendment, the capitalized term “Parties” shall be a collective reference to both City and Consultant. The capitalized term “Party” may refer to either City or Consultant, interchangeably as appropriate.

RECITALS
This First Amendment is made and entered into with respect to the following facts:

WHEREAS, on December 6, 2022, the Parties executed and entered into the Master Agreement for Consultant to provide design engineering services for the Cudahy Park Renovation Project services for the City; and
WHEREAS, the Parties wish to amend the Scope of Work to provide additional design engineering services set forth in EXHIBIT A; and
NOW, THEREFORE, in consideration of the mutual agreements contained herein, and other good and valuable consideration, the receipt and sufficiency of which is hereby acknowledged, and intending to be legally bound hereby, the Parties agree as follows:

SECTION 1. Exhibit A-Scope of Work of the Master Agreement is amended to include the attached “Fee Proposal” dated June 14, 2023.

SECTION 2. Except as otherwise set forth in this First Amendment, the Master Agreement shall remain binding, controlling, and in full force and effect. The First Amendment and Master Agreement shall constitute the entire, complete, final, and exclusive expression of the Parties with respect to the matters addressed in both documents.

SECTION 3. The provisions of this First Amendment shall be deemed a part of the Master Agreement and except, as otherwise provided under this First Amendment, the Master Agreement and all provisions contained therein shall remain binding and enforceable. In the event of any conflict or inconsistency between the provisions of this First Amendment and the provisions of the Master Agreement, the provisions of this First Amendment shall control, but only in so far as such provisions conflict with the Master Agreement and no further. (SIGNATURES ON NEXT PAGE)

Page 276 of 439 ends

IN WITNESS WHEREOF, the Parties hereto have caused this First Amendment to be executed on the day and year first appearing above.

CITY: CONSULTANT:

CITY OF CUDAHY WILLDAN ENGINEERING
ian ,
By:
oyola,
City
Date, 7 I ?o
APPROVE,D AS TO FORM:

Stephanie
City Attorney
Date:

By
Date: 7t31 t2023
By:
2

Page 277 of 439 ends

a.Klo4tt z
5 EXHIBIT “A”

SCOPE OF WORK
June 14, 2023
Victor Maria Santiago
Parks and Recreation Manager
City of Cudahy
5220 Santa Ana Street
Subject: Fee Proposal for Additional Design Services for Cudahy Park Renovation Project - Design Phase Engineering Services for the Preparation of Plans, Specifications and Estimate
Amendment No. 1
Dear Mr. Santiago,
This proposal supplements our professional services agreement dated December 6, 2022, for the preparation of PS&E for the Cudahy Park Renovation Project. Please find below our project understanding and fee for the above-mentioned subject title.

PROJECT UNDERSTANDING
As per your email sent to me on June 8, 2023, the City of Cudahy would like to include additional park features for the Cudahy Park renovation project. Those items include:
1) Semi-permeable pavement, wherever possible.
2) A California native garden in the southwest portion of the park. 3) Perimeter fencing.
4) Pedestrian lighting.
5) Construction of bioswales.
6) Construction of an 8-foot-high freestanding wall to be used for art murals. 7) The planting of trees.

Note, Item Nos. 1, 2, 3 and 6 shown above are additional services not included in the original proposal. These additional services will be included in the updated concept and preliminary design phase as well as part of the final construction documents package consisting of plans, specifications and estimate suitable for public bidding.

Additional Fees for Design Services Include:
1) Semi-permeable Pavement $5,312
2) California Native Garden $14,128
3) Perimeter Fencing $7,492
4) Art Mural Wall $13,934
Total Not-to-Exceed Fee $40,866

EXHIBIT A
June 14, 2023
Cudahy Park Renovation

Page 2 ends

Respectfully Submitted,

WILLDAN ENGINEERING
John Hidalgo, RLA
Principal Project Manager
Landscape Architectural Services

1 2023

SECOND AMENDMENT TO CONTRACT SERVICES AGREEMENT
(Engagement: Design Engineering Services)
(Parties: City of Cudahy and Willdan Engineering)
THIS SECOND AMENDMENT (hereinafter, “Second Amendment”) to that certain agreement entitled, “Contract Services Agreement” and dated December 6, 2022 (hereinafter, the “Master Agreement”), is hereby made and entered into this 7th day of November 2023 (hereinafter, “Effective Date”) by and between the City of Cudahy, a municipal corporation (hereinafter, “City”) and Willdan Engineering, (hereinafter, “Consultant”). For purposes of this Second Amendment, the capitalized term “Parties” shall be a collective reference to both City and Consultant. The capitalized term “Party” may refer to either City or Consultant, interchangeably as appropriate.

RECITALS
This Second Amendment is made and entered into with respect to the following facts:

SECTION 1. Exhibit A-Scope of Work of the Master Agreement is amended to include the attached “Fee Proposal” dated October 16, 2023.

SECTION 2. Except as otherwise set forth in this Second Amendment, the Master Agreement shall remain binding, controlling, and in full force and effect. The Second Amendment and Master Agreement shall constitute the entire, complete, final, and exclusive expression of the Parties with respect to the matters addressed in both documents.

SECTION 3. The provisions of this Second Amendment shall be deemed a part of the Master Agreement and except, as otherwise provided under this Second Amendment, the Master Agreement and all provisions contained therein shall remain binding and enforceable. In the event of any conflict or inconsistency between the provisions of this Second Amendment and the provisions of the Master Agreement, the provisions of this Second Amendment shall control, but only in so far as such provisions conflict with the Master Agreement and no further.

2 (SIGNATURES ON NEXT PAGE)

5 EXHIBIT “A”

SCOPE OF WORK
2FWREHU
9LFWRU0DULD6DQWLDJR
3DUNVDQG5HFUHDWLRQ0DQDJHU
&LW\RI&XGDK\
6DQWD$QD6WUHHW
6XEMHFW
)HH3URSRVDOIRU$GGLWLRQDO'HVLJQ6HUYLFHVIRU&XGDK\3DUN5HQRYDWLRQ 3URMHFW'HVLJQ3KDVH(QJLQHHULQJ6HUYLFHVIRUWKH3UHSDUDWLRQRI3ODQV 6SHFLILFDWLRQVDQG(VWLPDWH
$PHQGPHQW1R
'HDU0U6DQWLDJR
7KLVSURSRVDOVXSSOHPHQWVRXUSURIHVVLRQDOVHUYLFHVDJUHHPHQWGDWHG'HFHPEHUIRU WKHSUHSDUDWLRQRI36 (IRUWKH&XGDK\3DUN5HQRYDWLRQ3URMHFW3OHDVHILQGEHORZRXUSURMHFW XQGHUVWDQGLQJVFRSHRIZRUNDQGIHHIRUWKHDERYHPHQWLRQHGVXEMHFWWLWOH 352-(&781'(567$1',1*
$VSHUWKHXSGDWHGFRQFHSWSODQGDWHG
WKH&LW\RI&XGDK\ZRXOGOLNHWRLQFOXGH
DGGLWLRQDOSDUNIHDWXUHVIRUWKH&XGDK\3DUNUHQRYDWLRQSURMHFW7KRVHLWHPVLQFOXGH

1LJKWWLPHOLJKWLQJIRUWKHSOD\JURXQGDQGILWQHVVVWDWLRQV
)ODJSROHV

6WRUDJHEXLOGLQJ

&RXUW\DUGZDWHUIHDWXUH
7KHDGGLWLRQDOVHUYLFHVVKRZQRQWKHXSGDWHGFRQFHSWSODQZLOOEHDSDUWRIWKHILQDO FRQVWUXFWLRQGRFXPHQWVSDFNDJHFRQVLVWLQJRISODQVVSHFLILFDWLRQVDQGHVWLPDWHVXLWDEOHIRU SXEOLFELGGLQJ
3OHDVHILQGEHORZWKHVFRSHRIVHUYLFHVIRUWKHWZRPDMRULWHPVRIWKLVDPHQGPHQWWKHVWRUDJH EXLOGLQJDQGFRXUW\DUGZDWHUIHDWXUH
6&23(2):25.)256725$*(%8,/',1*
'HVLJQ&ULWHULD
1HZ
[

VTXDUHIRRW
VWRUDJHEXLOGLQJ
,WHPVWREHVWRUHGLQWKHEXLOGLQJ
\RXWKVSRUWVHTXLSPHQW
LHEDVHEDOOHTXLSPHQWIODJ
IRRWEDOOVVRFFHUHTXLSPHQWHWF
7ZR

*(0HOHFWULFYHKLFOHV1RKD]DUGRXVPDWHULDOVRU
SURGXFWV
$FRQFUHWHEORFNEXLOGLQJZLWKEULFNYHQHHUILQLVKWRPDWFKWKHDGMDFHQWOLEUDU\EXLOGLQJ 1RWH
7KHVWRUDJHEXLOGLQJVKDOOEHGHVLJQHGDVVXPLQJQRLQWHUIHUHQFHRIRXWVLGHHOHPHQWV DGMDFHQWEXLOGLQJIRRWLQJVHDVHPHQWVXQGHUJURXQGXWLOLWLHVHWF,IDGGLWLRQDOFRRUGLQDWLRQRU GUDZLQJVUHYLVLRQVDUHQHHGHGGXHWRWKHVHHOHPHQWVWKRVHVKDOOEHSURYLGHGDWWKHKRXUO\ UDWHVIRUWKHDUFKLWHFWXUDOVHUYLFHV
6WDQGLQJVHDPPHWDOURRI
3URSRVHGPLQLPXPLQWHULRUFOHDUKHLJKW

2SHQZHEVWHHORUZRRGWUXVVMRLVWURRIIUDPLQJVWUXFWXUHIDFWRU\ILQLVKZLWKILQLVKFRORUFRDW 1RFHLOLQJ
H[SRVHGWRWKHURRIVWUXFWXUHDERYH
%DVLFLQWHULRUVKRSOLJKWLQJ

%DVLFH[WHULRUOLJKWLQJWRPDWFKH[LVWLQJOLEUDU\EXLOGLQJOLJKWLQJ 2FWREHU
&XGDK\3DUN5HQRYDWLRQ
3DJH
6RODUSRZHUHGDXWRPDWLFJUDYLW\YHQWVZLWKKDUGZLUHGRSHUDELOLW\ 9HQWLODWLRQORXYHUVWKURXJKRXWDVQHHGHG
2QH

[
UROOXSGRRUDQGRQH

¶[¶VWHHOSHUVRQGRRU
1RZLQGRZRSHQLQJV
2QH

DPSHOHFWULFDOSDQHODQGRXWOHWVHYHU\

WRRXWOHWVDQWLFLSDWHGLQFOXGLQJ
RQH

RUWZR

RXWOHWVWREHVWUDWHJLFDOO\ORFDWHGZLWKLQWKHVSDFH
7LWOHDVUHTXLUHG
&RGH&RPSOLDQFH $UFKLWHFWVKDOOSXWIRUWKUHDVRQDEOHSURIHVVLRQDOHIIRUWWRFRPSO\ZLWK DSSOLFDEOHODZVFRGHVDQGUHJXODWLRQVLQHIIHFWDVRIWKHGDWHRIWKHVXEPLVVLRQRIGRFXPHQWV WREXLOGLQJDXWKRULWLHV'HVLJQFKDQJHVPDGHQHFHVVDU\E\QHZODZVFRGHVDQGUHJXODWLRQV HQDFWHGDIWHUWKLVSURSRVDOGDWHZLOOEHELOOHGDWWKHKRXUO\UDWHVIRUWKHUHTXLUHGFKDQJHV 6LWH'RFXPHQWDWLRQ
$OORZKRXUVPD[LPXPIRUWKLVVFRSH

x :DONVLWHWRREVHUYHWKHSUHPLVHVEDVHGRQWKHSURSRVHGSURMHFWSURJUDPDQGSRLQWVRI LQWHUHVW
x 3HUIRUPFXUVRU\H[WHULRUILHOGPHDVXUHPHQWV
x 9HULI\SURSRVHGEXLOGLQJSODFHPHQW
x 2EVHUYHXWLOLWLHVSRLQWRIFRQQHFWLRQV
ZDWHUHOHFWULFDOSDQHOVVHZHUODWHUDOHWF

x 3KRWRJUDSKWKHSUHPLVHV
$JHQFLHV&RRUGLQDWLRQ &LW\0HHWLQJV
$OORZKRXUVPD[LPXPIRUWKLVVFRSH

x 6FKHGXOH D SUHOLPLQDU\ SODQ FKHFNPHHWLQJ ZLWKWKH &LW\¶V SODQQLQJ DQG EXLOGLQJ VDIHW\ GHSDUWPHQWV WR UHYLHZ WKH SURSRVHG SURMHFW DQG FRGH UHYLHZ 5HYLHZ SURSRVHG VWRUDJH EXLOGLQJ SODFHPHQW LQ UHODWLRQ WR WKH H[LVWLQJ OLEUDU\ EXLOGLQJ DQG GHWHUPLQH PLQLPXP GLVWDQFHDOORZDQFHEHWZHHQWKHEXLOGLQJV
x &RRUGLQDWHZLWK&LW\DQG/RV$QJHOHV&RXQW\JRYHUQLQJDJHQFLHVDVQHHGHG x &LW\VXEPLWWDOVDQGSURFHVVLQJRISODQFKHFNVDQGDGGUHVVLQJDJHQFLHVFRPPHQWV 'HVLJQDQG3URJUDPPLQJ
x &ROOHFWLRQRIIDFWVDQGGDWD
x 5HFHLYHDQGUHYLHZOLVWRIVSDFHDQGHTXLSPHQWQHHGV x 3URYLGHILHOGPHDVXUHPHQWVDQGDSSUR[LPDWHVTXDUHIRRWDJHRIWKHSUHPLVHV x 3UHSDUHIORRUSODQURRISODQDQGH[WHULRUHOHYDWLRQV x $VVLVWWKH&LW\LQPDNLQJSUHOLPLQDU\ILQLVKVHOHFWLRQVIRUUHYLHZDQGDSSURYDO &RQVWUXFWLRQ'RFXPHQWV
x 3UHSDUHGRFXPHQWVLQGHWDLOIRUWKHFRQVWUXFWLRQDQGREWDLQDSSURYDOIURPJRYHUQLQJ DJHQFLHVWRVHFXUHEXLOGLQJSHUPLWV
x &RRUGLQDWH&LW\FRPPHQWVIRULQFOXVLRQLQWRFRQVWUXFWLRQGRFXPHQWV x 6XEPLWD
DQGFRPSOHWLRQVHWRISODQVIRUUHYLHZ
x 5HVSRQGWRDQGFRRUGLQDWHUHVSRQVHVWRJRYHUQLQJDJHQFLHVFRPPHQWVWZRSODQFKHFN VXEPLWWDOVPD[LPXP
x 'HOLYHUDEOHV±3ULQWWKUHHVLJQHGVHWVRIWKHFRQVWUXFWLRQGRFXPHQWVWREHLVVXHGIRU SHUPLWWLQJ
&RQVWUXFWLRQ6XSSRUW
$OORZKRXUVPD[LPXPLQFOXGLQJVLWHYLVLWVIRUWKLVVFRSH
x $WWHQGDSUHFRQVWUXFWLRQPHHWLQJ
x 5HVSRQGWRWKHFRQWUDFWRU¶VUHTXHVWVIRULQIRUPDWLRQ 5),V
DQGFRRUGLQDWHZLWKWKHSURMHFW
FRQVXOWDQWV
x $WWHQGILHOGYLVLWVWRREVHUYHWKHFRQVWUXFWLRQ1RWHD &RQWUDFWRUVKDOOPDQDJHFRRUGLQDWH
DQGGLVWULEXWHDOOFRQVWUXFWLRQILHOGYLVLWVPHHWLQJVQRWHVDQGIROORZXSV DQGE
&RQWUDFWRU
VKDOOSURYLGHZHHNO\FRQVWUXFWLRQSURJUHVVSKRWRJUDSKVLQFOXGLQJRYHUDOOYLHZVDQGGHWDLOHG FORVHXSYLHZV
2FWREHU
&XGDK\3DUN5HQRYDWLRQ
3DJH
x $WWHQGRQHSXQFKOLVWVLWHYLVLWDWWKHHQGRIFRQVWUXFWLRQDQGIROORZXSZLWKDOLVWRILWHPVWR EHDGGUHVVHGIRUFRPSOHWLRQRIWKHSURMHFW
x 3URFHVVDQGUHYLHZVKRSGUDZLQJVDQGPDWHULDOVVDPSOHV x 1RWH
&KDQJHRUGHUVDUHWREHEURXJKWWRWKH$UFKLWHFW¶VDWWHQWLRQLPPHGLDWHO\7KH FRQWUDFWRUVKDOOSURYLGHUHFRPPHQGDWLRQVUHJDUGLQJFRVWVWLPHDQGPDWHULDOVIRU $UFKLWHFW¶VUHYLHZDQGDSSURYDO
6&23(2):25.)25&2857<$5':$7(5)($785(
'HVLJQ&ULWHULD
:DWHUIHDWXUHZLOOEHEXLOWDFFRUGLQJWRLWVHQYLURQPHQWDOFULWHULDDQGEXGJHWDU\JRDOV LQFOXGLQJLVVXHVRIHQYLURQPHQWDOVXVWDLQDELOLW\VDIHW\DQGUHDVRQDEOHPDLQWHQDQFH %HORZJUDGHHTXLSPHQWYDXOWLVLQFOXGHGDQGZLOOEHZLWKLQIHHWRIWKHZDWHUIHDWXUH :DWHUFDVFDGLQJZLWKPLQLPDOWR]HURSRQGLQJDWJURXQGOHYHO 5HFLUFXODWLQJZDWHU
&RQFHSW'HVLJQ
x 5HYLHZSURMHFW¶VORFDWLRQIRUWKHSXUSRVHRIHYDOXDWLQJ VFDOHIRUP VSDFH FLUFXODWLRQDQG RWKHULPSRUWDQWGHVLJQLVVXHVDQGLQIOXHQFHV
x $VVHVVWKHWHFKQLFDOLPSOLFDWLRQVIRUZDWHUIHDWXUHVRSSRUWXQLWLHVDQGFRQVWUDLQWV x 3DUWLFLSDWHLQDGHVLJQWHOHFRQIHUHQFHWRHVWDEOLVKDQGDJUHHWRWKHGHVLJQGLUHFWLRQ x 3UHSDUHVL[WRWHQFRQFHSWXDOZDWHUIHDWXUHLGHDVIRUUHYLHZ x $GGUHVVDQGSUHVHQWWKHZDWHUIHDWXUHGHVLJQPDWHULDOUHFRPPHQGDWLRQV x )ROORZ XS ZLWK RQH &LW\ DFFHSWHG ILQDO FRQFHSW GHVLJQ IRU WKH SUHSDUDWLRQ RI FRQVWUXFWLRQ GUDZLQJV7KHILQDOFRQFHSWZLOOEHUHQGHUHGLQFRORUDQGVHQWLQD3'))RUPDW7KHFRQFHSW ZLOOGLVSOD\WKHZDWHUFKDUDFWHUDQGILQLVKPDWHULDOVUHIHUHQFHSKRWRJUDSK\ &RQVWUXFWLRQ'RFXPHQWV
x 3UHSDUH FRQVWUXFWLRQ GUDZLQJV RI WKH ZDWHU IHDWXUH¶V GHVLJQ FKDUDFWHU ZLWK DUWLFXODWH FRQVWUXFWLRQ GUDZLQJV DQQRWDWHG ZLWK GLPHQVLRQV DQG QRWHV ,QFOXGHV OD\RXW SODQV HOHYDWLRQV VHFWLRQV GHWDLOV SLSLQJ DQG LQVWUXPHQWDWLRQ GLDJUDPV DQG VSHFLILFDWLRQV 0DWHULDOVDQGILQLVKHVDUHLGHQWLILHGDQGGLPHQVLRQVQRWHGLQVFDOH x 3UHSDUHZDWHUIHDWXUHK\GUDXOLFGHVLJQ
x 3UHSDUHHTXLSPHQWYDXOWGHVLJQLQFOXVLYHRIILOWUDWLRQV\VWHP x &RRUGLQDWHRWKHUWUDGHV
SOXPELQJHOHFWULFDOFLYLO
UHJDUGLQJWHFKQLFDOLQWHJUDWLRQLVVXHV
x 3UHSDUHDQGVXEPLW
DQGFRPSOHWLRQFRQVWUXFWLRQGUDZLQJV
x $GGUHVV&LW\FRPPHQWVIURPWKHFRQVWUXFWLRQGUDZLQJVVXEPLWWDOVDQGSURYLGHUHVSRQVHVWR DQ\TXHVWLRQVWKDWDULVHIURPWKHVXEPLWWDOV
x 3UHSDUHFRVWHVWLPDWHIRUZDWHUIHDWXUHIDEULFDWLRQHTXLSPHQWDQGVSHFLDOW\FRPSRQHQWV &RQVWUXFWLRQ6XSSRUW
x 5HYLHZ FRQWUDFWRU VXEPLWWDOV FRPPHQW DQG DSSURYH VKRS GUDZLQJVIRU FRQIRUPDQFH ZLWK WKHGHVLJQDQGFRPSOLDQFHZLWKWKHFRQVWUXFWLRQGUDZLQJV x 0RQLWRUFRQVWUXFWLRQSURJUHVVDQGNHHSWKH&LW\DSSULVHG3URYLGHDYDLODELOLW\WRUHYLHZDQG UHVROYHRXWVWDQGLQJLVVXHVZLWKWKH&LW\DQGFRQWUDFWRU x 5HYLHZDQGUHVSRQGWRUHTXHVWIRULQIRUPDWLRQ
5),¶V
DVQHHGHG
2FWREHU
&XGDK\3DUN5HQRYDWLRQ
3DJH
6800$5<2))((6
7KHIROORZLQJOLVWRIIHHVUHIOHFWVWKHVHUYLFHVQRWHGKHUHLQDQGDGGLWLRQDOGHVLJQVHUYLFHVWKDW DUHDVVRFLDWHGZLWKWKLV$PHQGPHQW1RIRUWKHFRPSOHWLRQRIWKHFRQVWUXFWLRQGRFXPHQWV 6WRUDJH%XLOGLQJ'HVLJQ

6LWH'RFXPHQWDWLRQ

$JHQFLHV&RRUGLQDWLRQ

'HVLJQDQG3URJUDPPLQJ

&RQVWUXFWLRQ'RFXPHQWV

&RQVWUXFWLRQ6XSSRUW

&RXUW\DUG:DWHU)HDWXUH'HVLJQ
6XUYH\IRU6WRUDJH%XLOGLQJDQG:DWHU)HDWXUH /LJKWLQJ'HVLJQIRU3OD\JURXQG )LWQHVV6WDWLRQV &LYLO(QJLQHHULQJ
)ODJ3ROHV
7RWDO1RWWR([FHHG)HH

6HUYLFHVQRW,QFOXGHG
(QWLWOHPHQWVHUYLFHVDQGRUFRQGLWLRQDOXVHSHUPLWDSSOLFDWLRQVDQGFLW\SODQQLQJGHSDUWPHQW GHVLJQDSSURYDO
SUHSDUDWLRQDQGSUHVHQWDWLRQRIGUDZLQJVFRORUERDUGVSODQVFRORU SHUVSHFWLYHSUHVHQWDWLRQGUDZLQJVDQGUHYLVLRQVWKHUHRIDQGSUHVHQWDWLRQWRWKH&LW\
$Q\&LW\SODQQLQJ ]RQLQJUHTXLUHPHQWVDQGUHYLVLRQV 3URFHVVLQJOHJDOGRFXPHQWVLHORWWLHVYDULDQFHVHWF 3DUNLQJUHTXLUHPHQWVVWXGLHVLQYHVWLJDWLRQVDQGRUVKDUHGSDUNLQJDJUHHPHQWV $Q\DGGLWLRQDOZRUNRUFKDQJHVWRGUDZLQJVDVUHTXLUHGE\WKHEXLOGLQJGHSDUWPHQWKHDOWK GHSDUWPHQWRULQGXVWULDOZDVWHGHSDUWPHQW
%XGJHWLQJLQIRUPDWLRQFRVWVDYLQJVWXGLHVRUYDOXHHQJLQHHULQJ 6HOHFWLRQRIQRQIL[HGHTXLSPHQWDQGIXUQLWXUH
%XLOGLQJFRPPLVVLRQLQJVHUYLFHV

/(('FHUWLILFDWLRQRUVLPLODUGHVLJQDOWHUQDWLYHV
)HHVUHTXLUHGE\JRYHUQLQJDJHQFLHV
,GHQWLI\LQJRUDEDWLQJDVEHVWRVPROGOHDGSDLQWDQGRURWKHUKD]DUGRXVPDWHULDOV ,OOXVWUDWRUSHUVSHFWLYHSUHVHQWDWLRQGUDZLQJ
V
IRU&LW\UHYLHZ
3UHSDUDWLRQIRUDQGDWWHQGDQFHRISXEOLFKHDULQJVRU&LW\SUHVHQWDWLRQPHHWLQJV 3UHSDUDWLRQRIDVEXLOWGRFXPHQWVRIDUFKLWHFWXUDOVWUXFWXUDOHOHFWULFDODQGPHFKDQLFDO FRQGLWLRQV
)LUHSURWHFWLRQV\VWHPV
ILUHDODUPGHVLJQILUHVSULQNOHUVGHVLJQDQGRUILUHVXSSUHVVLRQ GHVLJQLQFOXGLQJVPRNHHYDFXDWLRQFDOFXODWLRQVDQGGHVLJQ
6HFXULW\WHOHFRPPXQLFDWLRQGDWDFDPHUDVRUDXGLRV\VWHPVGHVLJQ 3URYLGLQJSHUPLWWLQJFULWHULD
EXLOGLQJFRGHVDQGSHUPLWVKHDOWKGHSDUWPHQWHWF

&RQVWUXFWLRQFRQWUDFWDGPLQLVWUDWLRQ

7HVWLQJRIPDWHULDOVZLWKLQWKHEXLOGLQJIRRWSULQWOLPLWV $Q\WKLQJQRWGHVFULEHGLQWKLVSURSRVDO
2FWREHU
&XGDK\3DUN5HQRYDWLRQ
3DJH
5HTXHVWHG,QIRUPDWLRQIURP&LW\
/LEUDU\EXLOGLQJUHFRUGGUDZLQJVRUFRQVWUXFWLRQGUDZLQJV $Q\DYDLODEOHUHFRUGGUDZLQJVQRWOLPLWHGWRH[LVWLQJVLWHSODQH[LVWLQJOLEUDU\EXLOGLQJIORRU SODQVEXLOGLQJHOHYDWLRQVPHFKDQLFDOHOHFWULFDODQGSOXPELQJGUDZLQJVHWF ,QIRUPDWLRQUHJDUGLQJSUHVHQWVWUXFWXUHVSUHVHQW]RQLQJUHTXLUHPHQWVEXLOGLQJUHVWULFWLRQV LQGHHGSURSHUW\UHVWULFWLRQVDQGHDVHPHQWV
1HFHVVDU\LQIRUPDWLRQUHJDUGLQJVHZHUZDWHUJDVDQGRUHOHFWULFDOVHUYLFHV 6FRSHRI:RUN$VVXPSWLRQV
8QOHVVQRWHGRWKHUZLVHWKHVFRSHRIZRUNDVVXPHVDVLQJOHGHVLJQLWHUDWLRQRIHDFK HOHPHQWDQGDVLQJOHVHWRIFRQVWUXFWLRQGRFXPHQWVWREHSHUPLWWHGLQDVLQJOHSKDVHDQG RQDQRUPDOGHVLJQELGEXLOGVFKHGXOH
$Q\UHYLVLRQVDIWHUSHUPLWVXEPLWWDOZLOOEHFRQVLGHUHGDGGLWLRQDOVHUYLFHV ([LVWLQJVRLOLVQRWFRQWDPLQDWHG
5HVSHFWIXOO\6XEPLWWHG
:,//'$1(1*,1((5,1*

-RKQ+LGDOJR5/$
3ULQFLSDO3URMHFW0DQDJHU
/DQGVFDSH$UFKLWHFWXUDO6HUYLFHV
5057°
jORfJ°D^L_I\K_j°jc°GcajfDGj°iKfqRGKi°DNfLK]Kaj°

Kx}}¢@°I}¡°K}}°i}©z}¡°
ex ¤}¡<°G¢®°°G§{x®°x{°r{x°K}}°
jQRi° jOVgI° D\K_I\Kaj°
}}x}° j{° D}{}¢° ¢° ¢x¢° z}¢x° x}}}¢° }¢¢}{°d¡¡x°i} ªz}¡°D}}}¢°x{°{x¢}{°I}z}y}°8°5055° }}x¢}°¢}°\x¡¢}°
D}}}¢° ¡° }}y®° x{}° x{° }¢}}{° ¢° ¢¡° 6{° {x®° ° i}¢}y}° 5057° }}x¢}°
K}z¢©}° Ix¢}° y®° x{° y}¢«}}° ¢}° G¢®° ° G¨{x®° x° §zx° z x¢° }}x}
°
G¤®°x{°r{x°K}}°
}}x}° G¡¨¢x¢&° M°§¡}¡°°¢¡°D}{}¢° ¢}° zx¢x¯}{°¢}° ex¢}¡°¡x° y}° x° z}z¢©}°}}z}°¢° y¢°G¢®° x{°G¡¨¢x¢(° j}° zx¢x¯}{°¢}1°ex¢®°x®°}°¢°}¢}°G¦®°°G¡§¢x¢°¢}zx}xy®°x¡°xx¢}'° fLHRjD[i°
j¡°j{°E~{}¢°¡°x{~°x{°}¢}}{°¢°«¢°}¡~z¢°¢°¢}°«°z¢¡=° rOKhKDi° ° I}z}y}° 8° 5055° ¢}° dx4}¡° }}z¨¢}{° x{° }¢}}{° ¢° ¢}° \x¡¢}° D}}}¢°°G¡§¢x¢°¢°©{}°{}¡°}}}°¡}©z}¡°°¢}°G¨{x®°dx°f}©x¢° e}z¢°¡}©z}¡°°¢}°G¢®A°x{°
rOKfKDi°¢}°\x¡¢}°D}}}¢°«x¡°¡¨y¡}¨}¢®°x}{}{° °Y¨®°2:°5056°y®°«x®° °x° M¡¢° D}{}¢° ¢° ©{}° x{{¢x° {}¡° }}}°¡}ªz}¡° }}x¢}° ¢}° M¡¢° D}{}¢B°x{°
sOKfKDi°¢}°\x¡¢}°D}}}¢°«x¡°¡§y¡}¨}¢®°x}{}{°°_©}y}°9°5056 °y®°
«x®°°x°i}z{°E}|}¢°¢°©{}°x{{¢x°{}¡°¡}©z}¡>°x{° rOKgKDi°¢}°dx ¥}¡°«¡°¢°x}{°¢}°iz}°°r°¢°z¨{}°x|{¢x°¡°xx®¡¡° ¢}¡¢°x{°}«°x°}}z¢zx°¡®¡¢}¡°«}°¡§®°§x{}¡° C°x{° tOLgKDi
°¢}°¡}{°x}{}¢°°¢}°iz}°°r°«°x¡°}§}°x°z}x¡}° ° ¢}° a¢$¢
Lz}}{° i¨° ° ¢}° \x¡¢}° D}}}¢° ° ¢}° x§¢° ° jOTfjvMckf° jOcliD_I°aT_K°Ok_IfLI°
67;00(00°°x°}«°¢¢x°`¢$¢ Kz}}{°x¨¢°°Mcmf° PmaIfKI°aWaKjw$caK°jPcliDaI°iRujw!iSu°IcZZDfi°
7;2088)00*°

°z¡{}x¢°°¢}°§¢§x°x}}}¢¡°z¢x}{°}}°x{° ¢}° {° x{° ©x§xy}° z¡{}x¢° ¢}° }z}¢° x{° ¡§ z}z®° ° ¬z° ¡° }}y®°
xz«}{}{°x{°¢}{°¢°y}°}x®°y§{°}}y®°¢}°ex£}¡°x}}°x¡°«¡?° iKGjTc_°2+°j}°}°}z¢x¡°x}°¢¨}°x{°z }z¢°x{°x}°z x¢}{°y®°}}z},° iKGjTca° 5-° i}z¢° 3*5°
D° ° ¢}° \x¡¢}° D}}}¢° ¡° }}y®° x}{}{° ¢° z§{}° x|{¢x°¡¡°xx®¡¡°¢}¡¢°x|°}«°x°}}z¢zx°¡®¡¢}¡°«}°¡¨®°§x{}¡'° iKGjUca° 6.°j}°`¢"¢#Kz}}{°i§° x¡°¡}¢°¤°° i}z¢°2/7° G}¡x¢°°¢}°
\x¡¢}° D}}}¢° ¡° }}y®° z}x¡}{° y®° jPSfjw$Mcof° jOcniD_I° aRaL° OpaIfKI°

67;00.00°°x°}«°_¢$¢Kz}}{°i§°°Mckf°Qk_IfKI°bTbKjv%c_L°jOckiDaI° iTujv$iXu°Ic[[Fhi°
7;2088'00(°
#$
U
U S(*CHU &GU AH6*DR7G*U G*HU 4DL6U 8@U H68GU $68D)U =*@)=*@IU J6*U &GJ*DU 5D**=*@HU&GU&=*@)*)U&@)U&;;UCDAO8G8A@GU(A@H&8@*)UH6*D*8@UG6&;;UD*=&8@U'8@)8@5U&@)U*@-BD(*&';* U
@UH6*U*P*@HUA+U&@TU(A@18(JUADU8@(A@G8GH*@(TU'*MQ**@UH6*UCDAP8G8A@GUA+UH68GU$68D)U=*@)=*@JU&@)U H6*UCDAP8G8A@GUA+UH6*U&GH*DU5D**=*@HUH6*UCDAP8G8A@GUA+H68GU$68D)U5E**=*@HUG6&;;U(A@HDA;U'NHU A@<[email protected]&GUGN(6UCDAP8G8A@GU (A@28(KUQ8H6UI6*U&GH*DU5D**=*@HU&@)U@AU36*DU $6*U$68D)U >*@)?*@HUHA5*H6*DUQ9H6UH6*U
&GH*FU5E**=*@HU 8@(;N)9@5U *S69':HGUG6&;;U(A@GH9HNH*U H6*U *@H9D*U (A=C;*H*U/@&;U&@)U*S(;NG8P*U*SCE*GG8A@UA,UH6*U!&DH8*GUQ9H6U E*GC*(HUHAUH6*U=&HJ*DGU&))D*GG*)U9@U 'AK6U)A(N=*@KG
U
U %$
##U%" UJ6*U!&8*GU6*D*HAU6&O*U(&NG*)UL68GU$68D)U=*@)=*@HUHAU'*U*S*(NH*)UA@UH6*U )&TU&@)UT*&DU0DGHU&CC*&D8@5U&'AO*
U

0D\
9LFWRU0DULD6DQWLDJR
3DUNVDQG5HFUHDWLRQ0DQDJHU
&LW\RI&XGDK\
6DQWD$QD6WUHHW
6XEMHFW
)HH3URSRVDOIRU$GGLWLRQDO'HVLJQ6HUYLFHVIRU&XGDK\3DUN5HQRYDWLRQ 3URMHFW'HVLJQ3KDVH(QJLQHHULQJ6HUYLFHVIRUWKH3UHSDUDWLRQRI3ODQV 6SHFLILFDWLRQVDQG(VWLPDWH
$PHQGPHQW1R
3DUW$$GGLWLRQDO6RLOV$QDO\VLV7HVWLQJ
3DUW%1HZ3DUN(OHFWULFDO6\VWHPV3RZHU6XSSO\8SJUDGHV 'HDU0U6DQWLDJR
7KLV SURSRVDO VXSSOHPHQWVRXU SURIHVVLRQDO VHUYLFHV DJUHHPHQWGDWHG'HFHPEHU IRU WKHSUHSDUDWLRQRI36 (IRUWKH&XGDK\3DUN5HQRYDWLRQ3URMHFW 3OHDVH ILQG EHORZ RXU SURMHFW GHVFULSWLRQ DQG XQGHUVWDQGLQJ VFRSH RI ZRUN DQG IHH IRU WKH DERYHPHQWLRQHGVXEMHFWWLWOHV
3$57$$'',7,21$/62,/6$1$/<6,67(67,1*
3URMHFW'HVFULSWLRQDQG8QGHUVWDQGLQJ
'XULQJ D JHRWHFKQLFDO LQYHVWLJDWLRQ FRPSOHWHG DV SDUW RI WKH UHQRYDWLRQ SURMHFW WKUHH

JHRWHFKQLFDOERULQJV
%%DQG3
ZHUHSHUIRUPHGDWORFDWLRQVDFURVVWKHSDUNUHQRYDWLRQ DUHDV %RULQJV % DQG % ZHUH SHUIRUPHG WR GHSWKV RI IHHW ZKLOH ERULQJ 3 ZDV SHUIRUPHGWRDGHSWKRIIHHW
&RQYHUVH RXU HQYLURQPHQWDO FRQVXOWDQW KDV UHYLHZHGWKH DQDO\WLFDO UHVXOWV RIWKH FRPSRVLWH VRLO VDPSOHV FROOHFWHG IURP WKH VRLO FXWWLQJV JHQHUDWHG GXULQJ WKH JHRWHFKQLFDO LQYHVWLJDWLRQ 7KH GDWD LQGLFDWHVWKDWWKH UHSRUWHG FRQFHQWUDWLRQ RIWRWDO OHDG LQ ZDVWH SURILOH VDPSOH 1R

DVVRFLDWHG ZLWK ERULQJ % ORFDWHG QHDU WKH EDVHEDOO ILHOGV H[FHHG VFUHHQLQJ OHYHOV IRU
UHVLGHQWLDO DQG FRPPHUFLDO XVHV DQGWKHUHIRUH VKRXOG EH UHPRYHGIURPWKLV SDUN VLWH ZKHUH SDUN XVHUV FRXOG EH H[SRVHGWRWKLVPDWHULDO7KH VROXEOH OHYHOV RI OHDG LQWKLV VDPSOHZRXOG UHVXOWLQWKHVRLOIURPWKDWORFDWLRQWREHFODVVLILHGDVQRQ5&5$ 5HVRXUFH&RQVHUYDWLRQDQG
5HFRYHU\$FW
&DOLIRUQLD+D]DUGRXV:DVWHIRUKDQGOLQJDQGGLVSRVDOSXUSRVHV 7KH UHVXOWVIRUWKH RWKHU VDPSOHV DQDO\]HG LQGLFDWHWKDW VRLOVIURPWKRVH DUHDV DUH OHVVWKDQ VFUHHQLQJ OHYHO FRQFHQWUDWLRQVDQGWKHUHIRUH EH DFFHSWDEOHIRUUHXVH RQVLWH$VWKH DQDO\WLFDO GDWD LV OLPLWHG WKH H[WHQWV RI OHDGLPSDFWHG VRLO LQ WKH YLFLQLW\ RI ERULQJ % IURP ZKLFK VRLO VDPSOH1RZDV FROOHFWHGDUHXQFOHDU&RQYHUVH KDV FRQFOXGHGWKDW FRQWLQXDWLRQRIZRUNLQ WKH YLFLQLW\ RI ERULQJ % ZDV QRW UHFRPPHQGHG GXH WR WKH SRWHQWLDO IRU WKH VSUHDG RI OHDG LPSDFWHGVRLOVWRRWKHUQRQLPSDFWHGSRUWLRQVRIWKHSURMHFWDUHDDVZHOODVSRWHQWLDOKHDOWKDQG VDIHW\LVVXHVIRUERWKRQVLWHZRUNHUVDQGDGMRLQLQJRIIVLWHUHVLGHQWLDODQGSDUNXVHUV&RQYHUVH LVUHFRPPHQGLQJDGGLWLRQDODVVHVVPHQWLQWKHIRUPRIVWHSRXWVDPSOLQJLQWKHYLFLQLW\RIERULQJ 0D\
&XGDK\3DUN5HQRYDWLRQ±$PHQGPHQW1R
$GGLWLRQDO6RLOV$QDO\VLV7HVWLQJ
1HZ3DUN(OHFWULFDO6\VWHPV8SJUDGHV
3DJH
%WR DVVLVW LQ GHWHUPLQLQJ ERWK ODWHUDO DQG YHUWLFDO H[WHQWVRI OHDGLPSDFWHG VRLO 'XULQJWKH 0DUFKPHHWLQJEHWZHHQWKH&LW\DQGSURMHFWWHDPDGGLWLRQDOVFUHHQLQJRIWKHEDVHEDOO ILHOGVZDVDOVR UHTXHVWHGLQDVVRFLDWLRQZLWKHYDOXDWLQJWKHH[WHQWVRISRWHQWLDOOHDGLPSDFWHG VRLOV
6FRSHRI:RUN
7KHUHSRUWVZLOOEHSUHSDUHGIRUUHYLHZDQGFRPPHQWIROORZHGE\PRGLILFDWLRQVDQGVXEPLWWDOWR WKH&LW\:LOOGDQDQWLFLSDWHVRQHGUDIWVXEPLWWDORIHDFKGRFXPHQWDQGRQHILQDOYHUVLRQRIHDFK GRFXPHQW
7DVN
&RQVXOWLQJ6HUYLFHV
D
5HYLHZVRLODQDO\WLFDOGDWDDQGSUHSDUHVXPPDU\OHWWHURIILQGLQJVDQGUHFRPPHQGDWLRQV E
'LVFXVVZLWK&LW\VWDIIILQGLQJVDQGUHFRPPHQGDWLRQV 7DVN
$GGLWLRQDO$VVHVVPHQW6RLO6DPSOLQJ
D
3ULRU WR WKH ILHOG DFWLYLWLHV &RQYHUVH ZLOO SUHSDUH D WHFKQLFDO PHPRUDQGXP ZRUN SODQ RXWOLQLQJWKHSURSRVHGVDPSOLQJSURFHGXUHVDQGORFDWLRQVDQGSUHSDUHDUHYLVHGVLWHVSHFLILF KHDOWKDQGVDIHW\SODQ7KHZRUNSODQZLOOEHVXEPLWWHGWR&LW\VWDIIIRUUHYLHZDQGDSSURYDO E
&RQYHUVH ZLOO REWDLQ VRLOERULQJ SHUPLWV IURP WKH &RXQW\ RI /RV $QJHOHV (QYLURQPHQWDO +HDOWK'LYLVLRQ
F
3URSRVHG ILHOG DFWLYLWLHV LQFOXGH WKH DGYDQFHPHQW RI XS WR HLJKW
ERULQJV 6HYHQ

ERULQJVDUHSURSRVHGWREHDGYDQFHGWRPD[LPXPGHSWKVRIIHHWEHQHDWKJURXQGVXUIDFH

EJV
2QH

ERULQJLQWKHYLFLQLW\RIJHRWHFKQLFDOERULQJ%LVSURSRVHGWREHDGYDQFHG WRDGHSWKRIIHHWEJV6RLOERULQJVDUHWREHDGYDQFHGXVLQJGLUHFWSXVKGULOOLQJPHWKRGV 6RLOVDPSOHVDUHSURSRVHGWREHFROOHFWHGIURPHDFKERUHDWGHSWKVRIDQGIHHW EJVZLWKDGGLWLRQDOVDPSOHVFROOHFWHGIURPWKHGHHSHUIRRWERUHDWGHSWKVRIDQG IHHWEJV
G
,QLWLDOO\VRLOVDPSOHVIURPGHSWKVRIDQGIHHWEJV VDPSOHV
IURPHDFKRIWKHHLJKW

ERULQJV ZLOO EH DQDO\]HG E\(QYLURQPHQWDO3URWHFWLRQ$JHQF\ (3$
7HVW0HWKRG IRU
7RWDO 7KUHVKROG /LPLW &RQFHQWUDWLRQ
77/&
OHDG 5HPDLQLQJ VDPSOHV ZLOO EH DUFKLYHG
SHQGLQJ WKH UHVXOWV RI WKH LQLWLDO VDPSOHV DQDO\VHV +RZHYHU IRU EXGJHWLQJ SXUSRVHV LW LV DVVXPHGWKDWXSWRWZHQW\IRXURIWKHDUFKLYHGVDPSOHVZLOOEHDQDO\]HGIRUDWRWDORIXSWR IRUW\VDPSOHVDQDO\]HG
H
$ VXPPDU\ UHSRUW ZLOO EH SUHSDUHG IROORZLQJ FRPSOHWLRQ RI ILHOG DFWLYLWLHV DQG UHFHLSW RI DQDO\WLFDO UHVXOWV ,QFOXGHG LQ WKH UHSRUW ZLOO EH D VXPPDU\ RI WKH ILHOGZRUN DQG PHWKRGRORJLHVDVZHOODVDGLVFXVVLRQDQGVXPPDU\RIWKHDQDO\WLFDOUHVXOWV&RQYHUVHZLOO DOVR SUHVHQW RXU FRQFOXVLRQV DQG UHFRPPHQGDWLRQV LI DQ\ &RSLHV RI VXPPDU\ WDEOHV RI VDPSOH DQDO\WLFDO UHVXOWV DQG ODERUDWRU\ DQDO\WLFDO UHSRUWV ZLWK FKDLQ RI FXVWRG\ GRFXPHQWDWLRQ ZLOO EH SURYLGHG LQ WKH UHSRUW $ &DOLIRUQLD 3URIHVVLRQDO *HRORJLVW 3*
ZLOO
VLJQWKHUHSRUW
6FKHGXOHDQG'HOLYHUDEOHV
2XU VHUYLFHV ZLOO EH LQLWLDWHG ZLWKLQ RQH ZHHN DIWHU QRWLFH WR SURFHHG LV UHFHLYHG 7KH ILHOG LQYHVWLJDWLRQ IRU WKH VWHSRXW VRLO VDPSOLQJ ZLOO EH LQLWLDWHG ZLWKLQ RQH ZHHN DIWHU QRWLFH WR SURFHHG 1RWH RQH GD\ LV DQWLFLSDWHG WR EH UHTXLUHG WR FRPSOHWH WKH VWHSRXW VDPSOLQJ ILHOG ZRUN
0D\
&XGDK\3DUN5HQRYDWLRQ±$PHQGPHQW1R
$GGLWLRQDO6RLOV$QDO\VLV7HVWLQJ
1HZ3DUN(OHFWULFDO6\VWHPV8SJUDGHV
3DJH
2QH3')HOHFWURQLFFRS\RIWKHGUDIWVRLOVDPSOLQJUHSRUWZLOOEHVXEPLWWHGWRWKH&LW\ZLWKLQ ZHHNV DIWHUWKHILHOGZRUN LV FRPSOHWHG$IWHU UHYLHZ FRPPHQWVDUH UHYLHZHG DQG DGGUHVVHG RQHHOHFWURQLFFRS\RIWKHILQDOUHSRUWZLOOEHVXEPLWWHGWRWKH&LW\ZLWKLQZHHNV $GGLWLRQDO,QIRUPDWLRQ
7KH ERULQJ ORFDWLRQV DQG DFWXDO VDPSOHVWR EH DQDO\]HGPD\ GLIIHUWKDQZKDW LV VWDWHG LQWKH VFRSHRIZRUNGHSHQGLQJRQILHOGFRQGLWLRQV,IFRQGLWLRQVDUHHQFRXQWHUHGWKDWDUHVLJQLILFDQWO\ GLIIHUHQW WKDQ WKRVH DQWLFLSDWHG VHUYLFHV QRW VSHFLILFDOO\ SURSRVHG KHUHLQ PD\ EH UHTXLUHG WR DFKLHYHWKH REMHFWLYH RIWKLV DVVHVVPHQW &RQYHUVH ZLOO QRW SURFHHG ZLWKWKHVH XQDQWLFLSDWHG VHUYLFHV ZLWKRXW UHFHLSW RI DZULWWHQ DXWKRUL]DWLRQ DQG DJUHHPHQWWRWKH DGGLWLRQDO VHUYLFHV,I WKHVFKHGXOHGVFRSHRIZRUNFDQQRWEHSHUIRUPHGGXHWRFLUFXPVWDQFHVEH\RQGRXUUHDVRQDEOH FRQWURO:LOOGDQZLOOVWRSWKHZRUNDQGFRQVXOWZLWKWKH&LW\WRDVVHVVWKHVLWXDWLRQDQGGLVFXVV WKHQH[WFRXUVHRIDFWLRQLQPRYLQJIRUZDUGZLWKWKHLQWHQGHGVFRSHRIZRUNKHUHLQ )XUWKHUPRUH WKH VRLO ERUHV ZLOO EH EDFNILOOHG ZLWK K\GUDWHG EHQWRQLWH FKLSV $V D UHVXOW WKH VXUIDFH PD\ VHWWOH RU EXOJH RYHU WLPH:H UHFRPPHQG WKH &LW\ PRQLWRU WKH ERULQJ VLWHV DQG DGGUHVV DQ\ PRXQGLQJ RU VHWWOHPHQW GHSUHVVLRQV WKDW PLJKW RFFXU WR SUHYHQW WULS DQG IDOO LQMXULHVIURPRFFXUULQJQHDUWKHEDFNILOOHGERULQJORFDWLRQV 3$57%1(:3$5.(/(&75,&$/6<67(0632:(56833/<83*5$'(6 3URMHFW'HVFULSWLRQDQG8QGHUVWDQGLQJ
'XULQJWKHVLWHYLVLWZLWKRXUVXEFRQVXOWDQWWKHHOHFWULFDOHQJLQHHUREVHUYHGFHUWDLQHOHPHQWVRI WKHFXUUHQWHOHFWULFDOV\VWHPDQGKDVGHWHUPLQHGWKDWDIXOOSRZHUVXSSO\VHUYLFHVHSDUDWHIURP WKHH[LVWLQJHOHFWULFDOV\VWHPZRXOGQHHGWREHSXWLQSODFH $WWKH VWDUW RIWKH HOHFWULFDO DQG OLJKWLQJ GHVLJQWKHUH ZHUH H[SHFWDWLRQVWKDWWKH H[LVWLQJ VLWH HOHFWULFDO V\VWHP FRXOG KDQGOH WKH QHZ HOHFWULFDO LPSURYHPHQWV +RZHYHU DIWHU RXU VLWH LQYHVWLJDWLRQWKDWLVQRWWKH FDVH:HEHFDPHDZDUHWKDWWKHSRZHUIRUWKHH[LVWLQJSDUNZDV VXSSOLHGIURPWKHH[LVWLQJ&LW\+DOO¶VPDLQVZLWFKERDUGDQGZHUHGHWHUPLQHGWKDWZHFDQQRWXVH WKLVSRZHUIHHGFRQQHFWLRQ
$V D UHVXOW RI RXU LQYHVWLJDWLRQWKH HQWLUH SDUN UHQRYDWLRQV SHUWDLQLQJWR HOHFWULFDO GHPDQGV

LQFOXGLQJWKHEDVHEDOOILHOGOLJKWLQJEDVNHWEDOOWHQQLVVNDWHERDUGSHGHVWULDQDQGVSODVKSDG PXVW EH DSSOLHG WR D QHZ HOHFWULFDO VHUYLFH IHHG ZLWK 6&( $QG DV GHWHUPLQHG WR SURSHUO\ LOOXPLQDWH WKH WZR EDVHEDOO ILHOGV ZLOO UHTXLUH ODUJH HOHFWULFDO ORDGV WKXV UHTXLUHV WKH QHZ HOHFWULFDO VHUYLFH IHHG WR EH ODUJHU LQ VL]H WKHUHIRUH FDQQRW EH FRQQHFWHG WR WKH H[LVWLQJ PHWHUHG SHGHVWDO PHWHU
ZKLFK FRXOG QRW KDQGOH E\ RQO\ XSJUDGLQJ WKH H[LVWLQJ PHWHU

SHGHVWDO
7KLV GHVLJQ ZRUN UHTXLUHV DGGLWLRQDO HIIRUW LQ HQJLQHHULQJ ZRUN ZLWK WKH HOHFWULFDO SXUYH\RU6RXWKHUQ&DOLIRUQLD(GLVRQ
6&(

6FRSHRI:RUN
D
3URYLGH QHZ HOHFWULFDO VHUYLFH SRZHU IHHG IRU WKH SDUN ZKLFK LQFOXGHV WKH EDVHEDOO ILHOG VWRUDJH EXLOGLQJ VWDJHDPSKLWKHDWHU DQG SRZHU SURYLVLRQ IRU WKH VSODVK SDG DQG ZDWHU IHDWXUH DW %HGZHOO +DOO $OO WKH HOHFWULFDO GLVWULEXWLRQ V\VWHPV ZLOO EH IURP WKH QHZ PDLQ VZLWFKERDUGVHUYLFH
E
&RRUGLQDWHWKHQHZHOHFWULFDOVHUYLFHZLWK6&(HQJLQHHUDQGSURYLGHRQHVLWHPHHWLQJZLWK 6&(
0D\
&XGDK\3DUN5HQRYDWLRQ±$PHQGPHQW1R
$GGLWLRQDO6RLOV$QDO\VLV7HVWLQJ
1HZ3DUN(OHFWULFDO6\VWHPV8SJUDGHV
3DJH
F
3URYLGHEDVHEDOOILHOGVQHZVSRUWOLJKWLQJFLUFXLWVDQGFRRUGLQDWHWKHOLJKWLQJVSHFLILFDWLRQ OLJKWLQJFRQWURODQGLQVWDOODWLRQZLWK086&2OLJKWLQJFRPSDQ\ G
3URYLGHSDQHOVFKHGXOHVLQJOHOLQHGLDJUDPDQGORDGFDOFXODWLRQVRIQHZSRZHUVHUYLFH H
3URYLGHFRQVWUXFWLRQDGPLQLVWUDWLRQVXSSRUWIRUWKHUHODWHGVHUYLFHVQRWHGDERYH 6FKHGXOHDQG'HOLYHUDEOHV
2XUVHUYLFHVIRUWKHDGGLWLRQDOHOHFWULFDOZRUNZLOOFRQWLQXHDVSDUWRIWKHRYHUDOOSUHSDUDWLRQRI WKH FRQVWUXFWLRQ GRFXPHQW SDFNDJH 7KH ILHOG LQYHVWLJDWLRQ ZLWK D 6&( UHSUHVHQWDWLYH LV VFKHGXOHGIRUWKHVHFRQGZHHNLQ-XQH
)((6
3DUW$$GGLWLRQDO6RLOV$QDO\VLV7HVWLQJ

3DUW%1HZ3DUN(OHFWULFDO6\VWHPV8SJUDGHV BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB
7RWDO1RWWR([FHHG)HH

5HVSHFWIXOO\6XEPLWWHG
:,//'$1(1*,1((5,1*

-RKQ+LGDOJR5/$
3ULQFLSDO3URMHFW0DQDJHU
/DQGVFDSH$UFKLWHFWXUDO6HUYLFHV
2025

FOURTH AMENDMENT TO PROFESSIONAL SERVICES AGREEMENT
(Engagement: DESIGN PHASE ENGINEERING SERVICES)
(Parties: Willdan Engineering Inc. and City of Cudahy)
THIS FOURTH AMENDMENT (hereinafter, "Fourth Amendment") to that certain agreement entitled "Professional Services Agreement", dated December 6, 2022 (hereinafter, the "Master Agreement"), is hereby made and entered into this 7th day of October 2025 (hereinafter, the "Effective Date") by and between the CITY OF CUDAHY, a municipal corporation (hereinafter, "CITY") and WILLDAN ENGINEERING INC. (hereinafter, "CONSUL TANT"). For purposes of this Fourth Amendment, the capitalized term "Parties" shall be a collective reference to both CITY and CONSUL TANT. The capitalized term "Party" may refer to either CITY or CONSUL TANT, interchangeably as appropriate.

RECITALS
This FOURTH AMENDMENT is made and entered into with respect to the following facts:

WHEREAS, on December 6, 2022, the Parties executed and entered into the Master Agreement for CONSUL TANT to provide design engineering services for the Cudahy Park Renovation Project; and
WHEREAS, the Master Agreement was subsequently amended on July 18, 2023, by way of a First Amendment to amend the Scope of Work to provide additional design engineering services in the amount of FORTY THOUSAND EIGHT HUNDRED SIXTYSIX ($40,866) for a new total not-to-exceed amount of THREE HUNDRED FIFTY-NINE THOUSAND SEVEN HUNDRED SIXTY-SIX ($359,766) (hereinafter the "First Amendment"); and
WHEREAS, the Master Agreement was subsequently amended on November 7 , 2023, by way of a Second Amendment to amend the Scope of Work to provide additional design engineering services in the amount of NINETY-SIX THOUSAND FOUR HUNDRED ($96,400) for a new total not-to-exceed amount of FOUR HUNDRED FIFTYSIX THOUSAND ONE HUNDRED SIXTY-SIX ($456,166) (hereinafter the "Second Amendment"); and
WHEREAS, the Master Agreement was subsequently amended on September 3, 2024, by way of a Third Amendment to amend the Scope of Work to include additional soil analysis testing and new park electrical systems power supply upgrades in the amount of THIRTY-FOUR THOUSAND NINE HUNDRED ($34,900) for a new total notto-exceed amount of FOUR HUNDRED NINETY-ONE THOUSAND SIXTY-SIX ($491,066) (hereinafter the "Third Amendment"); and
WHEREAS, the Master Agreement as amended by way of the First Amendment, Second Amendment, and Third Amendment is attached and incorporated hereto as Exhibit "A"; and
1 WHEREAS, the Parties now agree to amend the Scope of Work to provide additional design engineering services and increase the not-to-exceed sum; and WHEREAS, the execution of this Fourth Amendment was approved by the Cudahy City Council at its Regular Meeting of October 7, 2025 under Agenda Item No. 14B.

SECTION 1. The foregoing recitals are true and correct and are incorporated by reference.

SECTION 2. Section 1.2 "Scope of Services" of the Master Agreement is hereby amended to include additional design phase engineering services and incorporated hereto as Exhibit "B".

SECTION 3. The Not-To-Exceed Sum as set forth in Section 1.4 "Compensation" of the Master Agreement is hereby increased by an additional TWENTY THOUSAND SIX HUNDRED SIX ($20,606) for a new Not-to-Exceed Sum of FIVE HUNDRED ELEVEN THOUSAND SIX HUNDRED SEVENTY-TWO ($511,672).

SECTION 4. Except as otherwise set forth in this Fourth Amendment, the Master Agreement, as amended by the way of the Third Amendment and Second Amendment shall remain binding, controlling, and in full force and effect. The Amendments and Master Agreement including exhibits shall constitute the entire, complete, final, and exclusive expression of the Parties with respect to the matters addressed in all documents.

SECTION 5. In the event of any conflict or inconsistency between the provisions of this Fourth Amendment and the provisions of the Master Agreement, the provisions of this Fourth Amendment shall govern and control to the extent of the conflict or inconsistency and no further.
(SIGNATURES ON NEXT PAGE)
2 IN WITNESS WHEREOF, the Parties hereto have caused this Fourth Amendment to be executed on the day and year first appearing above.

CITY OF CUDAHY: WILLDAN ENGINEERING INC.:

By: JM \Wt
Name: John Hidalgo
Title: Principal Project Manager
Date: 10/8/2025
APPROVED AS TO FORM:

By: ____________ _
Stephanie Arechiga
City Attorney
Date: ----------
3 10/15/2025
5 EXHIBIT “B”

SCOPE OF WORK
August 7, 2025
Victor Maria Santiago
Parks and Recreation Manager
City of Cudahy
5220 Santa Ana Street
Subject: Fee Proposal for Additional Design Services for Cudahy Park Renovation Project - Design Phase Engineering Services for the Preparation of Plans, Specifications and Estimate
Amendment No. 4
Dear Mr. Santiago,
This proposal supplements our professional services agreement dated December 6, 2022, for the preparation of PS&E for the Cudahy Park Renovation Project. Please find below our project understanding and fee for the above-mentioned subject title.

PROJECT UNDERSTANDING
As per our teleconference meeting between City staff and Willdan on June 12, 2025, and an email from the City dated May 20, 2025 with a marked-up park site plan attachment illustrating the City’s request for recommending changes to the construction plans, the following revisions are noted below.

1. The primary revision to the current construction plans is to divide the park renovations into two phases. This involves preparing a separate construction plans package for Phase 1 and Phase 2, respectively. Both construction bid packages will consist of plans, specifications, and opinion of probable costs suitable for public bidding.

2. Relocate the bioswales/basins to the south property line of the park- located along the residential properties.

3. Illustrate on plans additional concrete walkways removals and replacement at designated areas.

Additional Fees for Design Services Include:
1) Preparing the Construction Documents
for a Phase 1 and Phase 2 Approach $13,092
2) Modification to the Irrigation and Plans
Resulting from the Bio-Swales Relocation $4,364
3) Modification to Grading and Drainage
Plans Resulting from the Bio-swales Relocation $3,150
Total Not-to-Exceed Fee $20,606
August 7, 2025
Cudahy Park Renovation – Amendment No. 4

Page 2 ends

Cudahy City CouncilOctober 20, 2026

Cudahy City Council
October 20, 2026