Agenda packet — Lake Forest City Council, March 7, 2023 (part 2 of 2)

Who we are
Who is providing this notice? LTG (identified below), which offers title insurance and settlement services and property and casualty insurance.

What we do
How does LTG protect my personal
information?
To protect your personal information from unauthorized access and use, we use security measures that comply with federal law. These measures include computer safeguards and secure files and buildings.

How does LTG collect my personal
information?
We collect your personal information, for example, when you  apply for insurance or apply for financing
 give us your contact information or provide your mortgage information  show your government-issued ID
We also collect your personal information from others, such as credit bureaus, affiliates, or other companies.

Why can’t I limit all sharing? Federal law gives you the right to limit only  sharing for affiliates’ everyday business purposes –
information about your creditworthiness
 affiliates from using your information to market to you  sharing for nonaffiliates to market to you
State laws and individual companies may give you additional rights to limit sharing.

Definitions
Affiliates Companies related by common ownership or control. They can be financial and nonfinancial companies.
 Our affiliates include companies with a Lennar name; financial companies such as Lennar Mortgage, LLC, CalAtlantic Mortgage, Inc., and Northwest Mortgage Alliance, North American Title Insurance Company, and Lennar Insurance Agency, LLC; and nonfinancial companies, such as Lennar Corporation, Lennar Multifamily Companies, Lennar Commercial, Lennar Homes USA, Lennar Family of Builders, CalAtlantic Homes, Lennar Sales Corp., SPH Title, Inc., Sunstreet Energy Group, and Five Point Communities.

Nonaffiliates Companies not related by common ownership or control. They can be financial and nonfinancial companies.
 Nonaffiliates we share with can include collection agencies, IT and telecommunication service providers, appraisers, companies that perform marketing services on our behalf, and consumer reporting agencies.

Joint marketing A formal agreement between nonaffiliated financial companies that together market financial products or services to you.
 LTG doesn’t jointly market.

LTG consists of the following entities:

Lennar Title, Inc. Lennar Title, LLC
Lennar Title, Inc. d/b/a Lennar Closing Services, Inc. CalAtlantic National Title Solutions, LLC CalAtlantic Title, LLC CalAtlantic Title, Inc.

Item: 9
260

Prelim (CA/NV) Page 15 192002-001219
CLTA Preliminary Report Form - Exhibit A (Rev. 05-06-16) CLTA STANDARD COVERAGE POLICY - 1990

EXCLUSIONS FROM COVERAGE
The following matters are expressly excluded from the coverage of this policy and the Company will not pay loss or damage, costs, attorneys' fees or expenses which arise by reason of:

36. (a) Any law, ordinance or governmental regulation (including but not limited to building or zoning laws, ordinances, or regulations) restricting, regulating, prohibiting or relating (i) the occupancy, use, or enjoyment of the land; (ii) the character, dimensions or location of any improvement now or hereafter erected on the land; (iii) a separation in ownership or a change in the dimensions or area of the land or any parcel of which the land is or was a part; or (iv) environmental protection, or the effect of any violation of these laws, ordinances or governmental regulations, except to the extent that a notice of the enforcement thereof or a notice of a defect, lien, or encumbrance resulting from a violation or alleged violation affecting the land has been recorded in the public records at Date of Policy.
(b) Any governmental police power not excluded by (a) above, except to the extent that a notice of the exercise thereof or notice of a defect, lien or encumbrance resulting from a violation or alleged violation affecting the land has been recorded in the public records at Date of Policy.

37. Rights of eminent domain unless notice of the exercise thereof has been recorded in the public records at Date of Policy, but not excluding from coverage any taking which has occurred prior to Date of Policy which would be binding on the rights of a purchaser for value without knowledge.

38. Defects, liens, encumbrances, adverse claims or other matters:
(a) whether or not recorded in the public records at Date of Policy, but created, suffered, assumed or agreed to by the insured claimant;
(b) not known to the Company, not recorded in the public records at Date of Policy, but known to the insured claimant and not disclosed in writing to the Company by the insured claimant prior to the date the insured claimant became an insured under this policy;
(c) resulting in no loss or damage to the insured claimant; (d) attaching or created subsequent to Date of Policy; or (e) resulting in loss or damage which would not have been sustained if the insured claimant had paid value for the insured mortgage or for the estate
or interest insured by this policy.

39. Unenforceability of the lien of the insured mortgage because of the inability or failure of the insured at Date of Policy, or the inability or failure of any subsequent owner of the indebtedness, to comply with the applicable doing business laws of the state in which the land is situated.

40. Invalidity or unenforceability of the lien of the insured mortgage, or claim thereof, which arises out of the transaction evidenced by the insured mortgage and is based upon usury or any consumer credit protection or truth in lending law.

41. Any claim, which arises out of the transaction vesting in the insured the estate of interest insured by this policy or the transaction creating the interest of the insured lender, by reason of the operation of federal bankruptcy, state insolvency or similar creditors' rights laws.

EXCEPTIONS FROM COVERAGE - SCHEDULE B, PART I
This policy does not insure against loss or damage (and the Company will not pay costs, attorneys' fees or expenses) which arise by reason of:

1. Taxes or assessments which are not shown as existing liens by the records of any taxing authority that levies taxes or assessments on real property or by the public records.

Proceedings by a public agency which may result in taxes or assessments, or notices of such proceedings, whether or not shown by the records of such agency or by the public records.

2. Any facts, rights, interests, or claims which are not shown by the public records but which could be ascertained by an inspection of the land or which may be asserted by persons in possession thereof.

3. Easements, liens or encumbrances, or claims thereof, not shown by the public records.

4. Discrepancies, conflicts in boundary lines, shortage in area, encroachments, or any other facts which a correct survey would disclose, and which are not shown by the public records.

5. (a) Unpatented mining claims; (b) reservations or exceptions in patents or in Acts authorizing the issuance thereof; (c) water rights, claims or title to water, whether or not the matters excepted under (a), (b) or (c) are shown by the public records.

6. Any lien or right to a lien for services, labor or material not shown by the public records.

CLTA/ALTA HOMEOWNER'S POLICY OF TITLE INSURANCE (12-02-13)

EXCLUSIONS
In addition to the Exceptions in Schedule B, You are not insured against loss, costs, attorneys' fees, and expenses resulting from:

1. Governmental police power, and the existence or violation of those portions of any law or government regulation concerning:
a. building;
b. zoning;
c. land use;
d. improvements on the Land;
e. land division; and
f. environmental protection.

This Exclusion does not limit the coverage described in Covered Risk 8.a., 14, 15, 16, 18, 19, 20, 23 or 27.

2. The failure of Your existing structures, or any part of them, to be constructed in accordance with applicable building codes. This Exclusion does not limit the coverage described in Covered Risk 14 or 15.

3. The right to take the Land by condemning it. This Exclusion does not limit the coverage described in Covered Risk 17.

4. Risks:

Item: 9
261

Prelim (CA/NV) Page 16 192002-001219
a. that are created, allowed, or agreed to by You, whether or not they are recorded in the Public Records; b. that are Known to You at the Policy Date, but not to Us, unless they are recorded in the Public Records at the Policy Date; c. that result in no loss to You; or
d. that first occur after the Policy Date - this does not limit the coverage described in Covered Risk 7, 8.e., 25, 26, 27 or 28.

5. Failure to pay value for Your Title.

6. Lack of a right:
a. to any land outside the area specifically described and referred to in paragraph 3 of Schedule A; and b. in streets, alleys, or waterways that touch the Land.

This Exclusion does not limit the coverage described in Covered Risk 11 or 21.

7. The transfer of the Title to You is invalid as a preferential transfer or as a fraudulent transfer or conveyance under federal bankruptcy, state insolvency, or similar creditors' rights laws.

8. Contamination, explosion, fire, flooding, vibration, fracturing, earthquake, or subsidence.

9. Negligence by a person or an Entity exercising a right to extract or develop minerals, water, or any other substances.

LIMITATIONS ON COVERED RISKS
Your insurance for the following Covered Risks is limited on the Owner's Coverage Statement as follows:
 For Covered Risk 16, 18, 19, and 21 Your Deductible Amount and Our Maximum Dollar Limit of Liability shown in Schedule A.

The deductible amounts and maximum dollar limits shown on Schedule A are as follows:

Your Deductible Amount Our Maximum Dollar
Limit of Liability
Covered Risk 16: 1% of Policy Amount Shown in Schedule A or $2,500 $10,000 (whichever is less)
Covered Risk 18: 1% of Policy Amount Shown in Schedule A or $5,000 $25,000 (whichever is less)
Covered Risk 19: 1% of Policy Amount Shown in Schedule A or $5,000 $25,000 (whichever is less)
Covered Risk 21: 1% of Policy Amount Shown in Schedule A or $2,500 $5,000 (whichever is less)
2006 ALTA LOAN POLICY (06-17-06)

EXCLUSIONS FROM COVERAGE
The following matters are expressly excluded from the coverage of this policy, and the Company will not pay loss or damage, costs, attorneys' fees, or expenses that arise by reason of:

1. (a) Any law, ordinance, permit, or governmental regulation (including those relating to building and zoning) restricting, regulating, prohibiting, or relating to
(i) the occupancy, use, or enjoyment of the Land;
(ii) the character, dimensions, or location of any improvement erected on the Land; (iii) the subdivision of land; or
(iv) environmental protection;
or the effect of any violation of these laws, ordinances, or governmental regulations. This Exclusion 1(a) does not modify or limit the coverage provided under Covered Risk 5.
(b) Any governmental police power. This Exclusion 1(b) does not modify or limit the coverage provided under Covered Risk 6.

2. Rights of eminent domain. This Exclusion does not modify or limit the coverage provided under Covered Risk 7 or 8.

3. Defects, liens, encumbrances, adverse claims, or other matters (a) created, suffered, assumed, or agreed to by the Insured Claimant; (b) not Known to the Company, not recorded in the Public Records at Date of Policy, but Known to the Insured Claimant and not disclosed in writing to the Company by the Insured Claimant prior to the date the Insured Claimant became an Insured under this policy;
(c) resulting in no loss or damage to the Insured Claimant; (d) attaching or created subsequent to Date of Policy (however, this does not modify or limit the coverage provided under Covered Risk 11, 13, or 14);
or
(e) resulting in loss or damage that would not have been sustained if the Insured Claimant had paid value for the Insured Mortgage.

4. Unenforceability of the lien of the Insured Mortgage because of the inability or failure of an Insured to comply with applicable doing-business laws of the state where the Land is situated.

5. Invalidity or unenforceability in whole or in part of the lien of the Insured Mortgage that arises out of the transaction evidenced by the Insured Mortgage and is based upon usury or any consumer credit protection or truth-in-lending law.

6. Any claim, by reason of the operation of federal bankruptcy, state insolvency, or similar creditors' rights laws, that the transaction creating the lien of the Insured Mortgage, is
(a) a fraudulent conveyance or fraudulent transfer, or
(b) a preferential transfer for any reason not stated in Covered Risk 13(b) of this policy.

7. Any lien on the Title for real estate taxes or assessments imposed by governmental authority and created or attaching between Date of Policy and the date of recording of the Insured Mortgage in the Public Records. This Exclusion does not modify or limit the coverage provided under Covered Risk 11(b).

The above policy form may be issued to afford either Standard Coverage or Extended Coverage. In addition to the above Exclusions from Coverage, the Exceptions from Coverage in a Standard Coverage policy will also include the following Exceptions from Coverage:

Item: 9
262

Prelim (CA/NV) Page 17 192002-001219

EXCEPTIONS FROM COVERAGE
[Except as provided in Schedule B - Part II,[ t[or T]his policy does not insure against loss or damage, and the Company will not pay costs, attorneys' fees or expenses, that arise by reason of:
[PART I
[The above policy form may be issued to afford either Standard Coverage or Extended Coverage. In addition to the above Exclusions from Coverage, the Exceptions from Coverage in a Standard Coverage policy will also include the following Exceptions from Coverage:

1. (a) Taxes or assessments that are not shown as existing liens by the records of any taxing authority that levies taxes or assessments on real property or by the Public Records; (b) proceedings by a public agency that may result in taxes or assessments, or notices of such proceedings, whether or not shown by the records of such agency or by the Public Records.

2. Any facts, rights, interests, or claims that are not shown by the Public Records but that could be ascertained by an inspection of the Land or that may be asserted by persons in possession of the Land.

3. Easements, liens or encumbrances, or claims thereof, not shown by the Public Records.

4. Any encroachment, encumbrance, violation, variation, or adverse circumstance affecting the Title that would be disclosed by an accurate and complete land survey of the Land and not shown by the Public Records.

6. Any lien or right to a lien for services, labor or material not shown by the Public Records. ]

PART II
In addition to the matters set forth in Part I of this Schedule, the Title is subject to the following matters, and the Company insures against loss or damage sustained in the event that they are not subordinate to the lien of the Insured Mortgage:] 2006 ALTA OWNER'S POLICY (06-17-06)

1. (a) Any law, ordinance, permit, or governmental regulation (including those relating to building and zoning) restricting, regulating, prohibiting, or relating to
(i) the occupancy, use, or enjoyment of the Land;
(ii) the character, dimensions, or location of any improvement erected on the Land; (iii) the subdivision of land; or
(iv) environmental protection;
or the effect of any violation of these laws, ordinances, or governmental regulations. This exclusion 1(a) does not modify or limit the coverage provided under Covered Risk 5.
(b) Any governmental police power. This Exclusion 1(b) does not modify or limit the coverage provided under Covered Risk 6.

1. Rights of eminent domain. This Exclusion does not modify or limit the coverage provided under Covered Risk 7 or 8.

2. Defects, liens, encumbrances, adverse claims, or other matters (a) created, suffered, assumed, or agreed to by the Insured Claimant; (b) not Known to the Company, not recorded in the Public Records at Date of Policy, but Known to the Insured Claimant and not disclosed in writing to the Company by the Insured Claimant prior to the date the Insured Claimant became an Insured under this policy;
(c) resulting in no loss or damage to the Insured Claimant; (d) attaching or created subsequent to Date of Policy (however, this does not modify or limit the coverage provided under Covered Risk 9 and 10); or
(e) resulting in loss or damage that would not have been sustained if the Insured Claimant had paid value for the Title.

3. Any claim, by reason of the operation of federal bankruptcy, state insolvency, or similar creditors' rights laws, that the transaction vesting the Title as shown in Schedule A, is
(a) a fraudulent conveyance or fraudulent transfer; or
(b) a preferential transfer for any reason not stated in Covered Risk 9 of this policy.

4. Any lien on the Title for real estate taxes or assessments imposed by governmental authority and created or attaching between Date of Policy and the date of recording of the deed or other instrument of transfer in the Public Records that vests Title as shown in Schedule A.

EXCEPTIONS FROM COVERAGE
This policy does not insure against loss or damage, and the Company will not pay costs, attorneys' fees or expenses, that arise by reason of:
[The above policy form may be issued to afford either Standard Coverage or Extended Coverage. In addition to the above Exclusions from Coverage, the Exceptions from Coverage in a Standard Coverage policy will also include the following Exceptions from Coverage:

2. Any facts, rights, interests, or claims that are not shown in the Public Records but that could be ascertained by an inspection of the Land or that may be asserted by persons in possession of the Land.

3. Easements, liens or encumbrances, or claims thereof, not shown by the Public Records.

6. Any lien or right to a lien for services, labor or material not shown by the Public Records.

7. [Variable exceptions such as taxes, easements, CC&R's, etc. shown here.] Item: 9
263

Prelim (CA/NV) Page 18 192002-001219
ALTA EXPANDED COVERAGE RESIDENTIAL LOAN POLICY - ASSESSMENTS PRIORITY (04-02-15)

1. (a) Any law, ordinance, permit, or governmental regulation (including those relating to building and zoning) restricting, regulating, prohibiting, or relating to (i) the occupancy, use, or enjoyment of the Land; (ii) the character, dimensions, or location of any improvement erected on the Land; (iii) the subdivision of land; or
(iv) environmental protection;
or the effect of any violation of these laws, ordinances, or governmental regulations. This Exclusion 1(a) does not modify or limit the coverage provided under Covered Risk 5, 6, 13(c), 13(d), 14 or 16. (b) Any governmental police power. This Exclusion 1(b) does not modify or limit the coverage provided under Covered Risk 5, 6, 13(c), 13(d), 14 or 16.

2. Rights of eminent domain. This Exclusion does not modify or limit the coverage provided under Covered Risk 7 or 8.

3. Defects, liens, encumbrances, adverse claims, or other matters (a) created, suffered, assumed, or agreed to by the Insured Claimant; (b) not Known to the Company, not recorded in the Public Records at Date of Policy, but Known to the Insured Claimant and not disclosed in writing to the Company by the Insured Claimant prior to the date the Insured Claimant became an Insured under this policy;
(c) resulting in no loss or damage to the Insured Claimant; (d) attaching or created subsequent to Date of Policy (however, this does not modify or limit the coverage provided under Covered Risk 11, 16, 17, 18, 19, 20, 21, 22, 23, 24, 27 or 28); or
(e) resulting in loss or damage that would not have been sustained if the Insured Claimant had paid value for the Insured Mortgage.

4. Unenforceability of the lien of the Insured Mortgage because of the inability or failure of an Insured to comply with applicable doing-business laws of the state where the Land is situated.

5. Invalidity or unenforceability in whole or in part of the lien of the Insured Mortgage that arises out of the transaction evidenced by the Insured Mortgage and is based upon usury, or any consumer credit protection or truth-in-lending law. This Exclusion does not modify or limit the coverage provided in Covered Risk 26.

6. Any claim of invalidity, unenforceability or lack of priority of the lien of the Insured Mortgage as to Advances or modifications made after the Insured has Knowledge that the vestee shown in Schedule A is no longer the owner of the estate or interest covered by this policy.

This Exclusion does not modify or limit the coverage provided in Covered Risk 11.

7. Any lien on the Title for real estate taxes or assessments imposed by governmental authority and created or attaching subsequent to Date of Policy. This Exclusion does not modify or limit the coverage provided in Covered Risk 11(b) or 25.

8. The failure of the residential structure, or any portion of it, to have been constructed before, on or after Date of Policy in accordance with applicable building codes. This Exclusion does not modify or limit the coverage provided in Covered Risk 5 or 6.

9. Any claim, by reason of the operation of federal bankruptcy, state insolvency, or similar creditors' rights laws, that the transaction creating the lien of the Insured Mortgage, is
(a) a fraudulent conveyance or fraudulent transfer, or
(b) a preferential transfer for any reason not stated in Covered Risk 27(b) of this policy.

10. Contamination, explosion, fire, flooding, vibration, fracturing, earthquake, or subsidence.

11. Negligence by a person or an Entity exercising a right to extract or develop minerals, water, or any other substances.

Item: 9
264

_ Michael J. Francis, MAI
41 Demographic Information
Item: 9
265

Item: 9
266

Item: 9
267

Item: 9
268

_ Michael J. Francis, MAI
42 Qualifications of the Appraiser

Item: 9
269

QUALIFICATIONS
OF
MICHAEL J. FRANCIS, MAI
Real Estate Appraiser and Consultant

PROFESSIONAL EXPERIENCE

Michael J. Francis, MAI, has been actively engaged in the real estate profession since 1984, providing full service real estate appraisal and consulting services on undeveloped acreage and a wide variety of commercial, industrial and residential properties located in southern California.

Before operating independently, Michael J. Francis, MAI, was employed as an Associate Appraiser with Joseph J. B lake and Associates, in San Francisco, California. Prior to that Michael J. Francis was a salesperson in Commercial Real Estate with Grubb & Ellis.

PROFESSIONAL ASSOCIATIONS

Member of the Appraisal Institute, with MAI designation

LICENSES

State of California - "Certified General Real Estate Appraiser" California State Certification No. AG002243
Expiration Date: January 22, 2024
State of California - “Real Estate Broker License”
California Department of Real Estate
Expiration Date: July 20, 2024

EDUCATIONAL ACTIVITIES

B.A., Business, Economics and Law, University of California, Berkeley, California 1980.

Special courses in Real Estate:

Introduction to Real Property Appraisal
Legal Aspects of Real Estate
Introduction to Real Estate and Urban Land Economics
Real Estate Finance
Monetary Theory and Banking Systems
Graduate Course Work, Real Estate Masters Program, Golden State University, San Francisco, California.

Courses sponsored by American Institute of Real Estate Appraisers:

Course 1A-1 Real Estate Appraisal Principals
Course 1A-2 Basic Valuation Procedures
Course 1B-A Capitalization Theory and Techniques, Part A Course 1B-b Capitalization Theory and Techniques, Part B Course 2-1 Case Studies in Real Estate Valuation
Course 2-2 Valuation Analysis and Report Writing
Course S-PP Standards of Professional Practice
Course 2-2 Valuation Analysis and Report Writing

P. O. Box 11808, Newport Beach, CA 92658
Tel: (949) 306-3388 * Fax: (949) 528-1300 * Email: [email protected] Item: 9
270

Page 2 ends

Michael J. Francis, MAI

EDUCATIONAL ACTIVITIES (continued)

Course S-PP Standards of Professional Practice
Seminar Non-Residential Demonstration Appraisal Report Writing Seminar Appraisal Regulations of the Federal Banking Agencies Seminar Non-Residential Demonstration Appraisal Report Writing Seminar Appraisal Regulations of the Federal Banking Agencies Seminar Standards of Appraisal Practice
Seminar Residential Subdivisions
Seminar Litigation Seminar
Course 746 Uniform Appraisal Standards for Federal Land Acquisitions Course 797 Valuation of Conservation Easements
Course 401 Appraisal of Partial Acquisitions (sponsored by the International Right of Way Association)

Numerous other courses, seminars and clinics on real estate appraisal and other related topics on a continuing basis.

SCOPE OF EXPERIENCE

I have performed appraisal and consulting work for a wide variety of client s including lenders, pension funds, corporations, public and governmental agencies, law firms, and private parties.

Public agency appraisal services include Yellow Book appraisals, full and partial acquisition appraisals, appraisals for eminent domain, appraisal reviews, conservation easement appraisals and so forth. I have also served as a legal expert witness.

 Vacant Land
Single-family and multi-family residential sites, commercial and industrial sites, a wide variety of undeveloped acreage (large and small, ocean front/coastal and inland), contaminated land, natural habitat land, flood plain land, land locked parcels and planned communities.

 Residential
Residential subdivisions, single -family residences, apartments, condomini ums, section 8 housing projects and planned unit developments.

 Commercial
Shopping centers, retail stores, general office buildings, medical office buildings and office and retail condominiums.

 Industrial
Single tenant and multi -tenant warehouses and manufacturing buildings, truck terminals, business parks, R & D buildings, automotive repair facilities and garages.

 Special Purpose
Agricultural land, c onservation easements, mixed -use developments, airports, wetland properties, landfill sites, forest land, master planned communities, s killed nursing care facilities (convalescent hospitals), senior residential care facilities (assisted living/board and care), senior apartment projects, hotels, mobile and manufactured home parks, RV parks, golf courses, timeshare projects, boat marinas, restaurants, theaters, bowling alleys, churches, schools, gas stations, car washes, railroad properties and various market studies.

Item: 9
271

CITY COUNCIL AGENDA REPORT
MEETING DATE: 3/7/2023
DEPARTMENT: City Manager
SUBJECT:

APPOINTMENT OF CITY REPRESENTATIVE TO ORANGE COUNTY VECTOR

CONTROL DISTRICT BOARD OF TRUSTEES
RECOMMENDED ACTION(S):

Exercise City Council discretion to either:

1. Appoint a representative to the Orange County Vector Control District Board of Trustees to serve until January 1, 2024.

2. Approve FPPC Form 806 and authorize the City Clerk to post the form on the City’s website
Or

3. Direct the City Clerk to advertise notice of the appointment opportunity pursuant to the Local Appointments Act to fill the Orange County Vector Control District Board of Trustee vacancy.

EXECUTIVE SUMMARY:

The Orange County Vector Control District (“District”) is an independent special district that has been serving the residents of Orange County since 1947. The District is dedicated to controlling rats, mosquitoes, fire ants, and flies. Other activities include surveillance of vectors and vector-borne diseases, public education services, and identification of public health pests submitted by county residents.

The Board of Trustees is the policy-making body of the District made up of an appointee from each Orange County city and the County of Orange. Typical duties include attending monthly meetings, attending occasional committee meetings, and attending educational conferences. The Board of Trustees meets at 3:00pm on the third Thursday of every month at the Orange County Mosquito and Vector Control District headquarters in Garden Grove. Trustees are provided $100 per month in-lieu of travel expenses.

Item: 10
272

In 2019, the City Council selected Mr. Vladimir A. Anderson to serve as the City’s appointed Trustee for a term expiring on January 1, 2024. Mr. Anderson recently notified the City that his employment prevents him from completing the remainder of his term on the Board of Trustees. To fill this vacancy, the City Council may appoint a member of the City Council to serve the remainder of the term or direct staff to advertise a notice of the appointment to the community.

Qualifications for the City’s representative to the Board of Trustees include: each Trustee appointed by the city council shall be a voter in that city in accordance with Health & Safety Code section 2022; and, persons appointed shall have experience, training and education in fields that will assist in the governance of the District as provided in Health & Safety Code section 2022. City Council Members act as Trustees for 24 of the 34 cities in the District.

Pursuant to Fair Political Practices Commission (“FPPC”) Regulation 18705.5 (Materiality Standard: Economic Interest in Personal Finances), public officials may participate in a City Council vote that would result in him or her serving in a position that provides compensation in the form of stipends, reimbursement, or direct payment of $250 or more in any 12-month period. Following the appointment, the City is required to post on its website FPPC Form 806, identifying: each appointed position receiving compensation in excess of $250 per 12-month period; the salary or stipend for each appointed position; the name of the public official appointed to the position; the name of any public official appointed as an alternate; and, the term of the appointment. In the same manner as the City Council Appointments list, Form 806 will be finalized, formatted, and posted with the name of the City’s appointee to the Vector Control District.

Staff recommends the City Council either appoint a current City Council Member to the Board of Trustees for the District and approve the attached FPPC Form 806 or direct the City Clerk to advertise a notice of the appointment opportunity to the public.

FISCAL IMPACT:

There is minimal fiscal impact associated with the recommended action.

ATTACHMENTS:

Draft Form 806
Initiated By: Sean McGovern, Assistant to the City Manager Item: 10
273

Submitted By: Debra Rose, City Manager
Approved By: Debra Rose, City Manager
Item: 10
274

ATTACHMENT
Item: 10
275

FPPC Form 806 (1/18)
FPPC Toll-Free Helpline: 866/ASK-FPPC (866/275-3772)
Comment:

A Public Document
Appt Date and
Length of Term
Agency Report of:
3XEOLF2ႈFLDO$SSRLQWPHQWV
$SSRLQWPHQWV
9HUL¿FDWLRQ
,KDYHUHDGDQGXQGHUVWDQG)33&5HJXODWLRQ,KDYHYHUL¿HGWKDWWKHDSSRLQWPHQWDQGLQIRUPDWLRQLGHQWL¿HGDERYHLVWUXHWRWKHEHVWRIP\LQIRUPDWLRQDQGEHOLHI 6LJQDWXUHRI$JHQF\+HDGRU'HVLJQHH 3ULQW1DPH Title
0RQWK'D\<HDU

$JHQF\%RDUGVDQG
&RPPLVVLRQV 1DPHRI$SSRLQWHG3HUVRQ Per Meeting/Annual Salary/Stipend

/DVW)LUVW

Alternate, if any
Alternate, if any
Alternate, if any
Alternate, if any

/DVW)LUVW

`Name
`Name
`Name
`Name
$0-$1,000
$0-$1,000
$0-$1,000
$0-$1,000
$1,001-$2,000
$1,001-$2,000
$1,001-$2,000
$1,001-$2,000
$2,001-$3,000
$2,001-$3,000
$2,001-$3,000
$2,001-$3,000
Other
Other
Other
Other
California
Form

1. Agency Name
'HVLJQDWHG$JHQF\&RQWDFW
1DPH7LWOH

E-mail
'LYLVLRQ'HSDUWPHQWRU5HJLRQ
,I$SSOLFDEOH

806
)RU2ႈFLDO8VH2QO\
Area Code/Phone Number

0RQWK'D\<HDU

` ____/____/____
$SSW'DWH
` ____/____/____
$SSW'DWH
` ____/____/____
$SSW'DWH
` ____/____/____
$SSW'DWH
`
/HQJWKRI7HUP
`
/HQJWKRI7HUP
`
/HQJWKRI7HUP
`
/HQJWKRI7HUP
` (VWLPDWHG$QQXDO

` (VWLPDWHG$QQXDO

$ ` 3HU0HHWLQJ

Page _____ of _____
'DWH3RVWHG

City of Lake Forest
Lisa Berglund, City Clerk
(949) 461-3422 [email protected]
11 Orange County Fire
Authority Tettemer, Mark
N/A
01 7 20
1 year
100.00
■
Foothill/Eastern
Transportation Corridor
Agency
Voigts, Scott
Pequeño, Robert
01 7 20
1y e a r
120.00
■
Orange County Mosquito
and Vector Control Board 100.00
■
Print Clear
Item: 10
276

FPPC Form 806 (1/18)
FPPC Toll-Free Helpline: 866/ASK-FPPC (866/275-3772)
Background
7KLVIRUPLVXVHGWRUHSRUWDGGLWLRQDOFRPSHQVDWLRQWKDWRႈFLDOV UHFHLYHZKHQDSSRLQWLQJWKHPVHOYHVWRSRVLWLRQVRQFRPPLWWHHV ERDUGVRUFRPPLVVLRQVRIDQRWKHUSXEOLFDJHQF\RUWRD FRPPLWWHHRUSRVLWLRQRIWKHDJHQF\RIZKLFKWKHSXEOLFRႈFLDOLV a member.

7KLVIRUPLVUHTXLUHGSXUVXDQWWR)33&5HJXODWLRQ (DFKDJHQF\PXVWSRVWRQLWVZHEVLWHDVLQJOH)RUPZKLFK OLVWVDOOWKHSDLGDSSRLQWHGSRVLWLRQVWRZKLFKDQRႈFLDOZLOOYRWH WRDSSRLQWWKHPVHOYHV:KHQWKHUHLVDFKDQJHLQFRPSHQVDWLRQ RUDQHZDSSRLQWPHQWWKH)RUPLVXSGDWHGWRUHÀHFWWKH FKDQJH7KHIRUPPXVWEHXSGDWHGSURPSWO\DVFKDQJHVRFFXU ,QVWUXFWLRQV
7KLVIRUPPXVWEHSRVWHGSULRUWRDYRWH
RUFRQVHQWLWHP
WR
DSSRLQWDJRYHUQLQJERDUGPHPEHULIWKHDSSRLQWHHZLOOSDUWLFLSDWH LQWKHGHFLVLRQDQGWKHDSSRLQWPHQWUHVXOWVLQDGGLWLRQDO FRPSHQVDWLRQWRWKHDSSRLQWHH
)33&5HJXODWLRQSURYLGHVWKDWDVORQJDVWKHSXEOLF LVLQIRUPHGSULRUWRDYRWHDQRႈFLDOPD\YRWHWRKROGDQRWKHU SRVLWLRQHYHQZKHQWKHYRWHUHVXOWVLQDGGLWLRQDOFRPSHQVDWLRQ 3DUW$JHQF\,GHQWL¿FDWLRQ
,GHQWLI\WKHDJHQF\QDPHDQGLQIRUPDWLRQRQZKRVKRXOGEH FRQWDFWHGIRULQIRUPDWLRQ
3DUW$SSRLQWPHQWV
,GHQWLI\WKHQDPHRIWKHRWKHUDJHQF\ERDUGRUFRPPLVVLRQ/LVW WKHQDPHRIWKHRႈFLDODQGDQDOWHUQDWHLIDQ\
/LVWWKHDSSRLQWPHQWGDWHDQGWKHOHQJWKRIWHUPWKHDJHQF\ RႈFLDOZLOOVHUYH'LVFORVHWKHVWLSHQGSURYLGHGSHUPHHWLQJDQG WKHHVWLPDWHGDQQXDOSD\PHQW7KHDQQXDOVDODU\LVDQHVWLPDWH DVLWZLOOOLNHO\YDU\GHSHQGLQJXSRQWKHQXPEHURIPHHWLQJV,W LVQRWQHFHVVDU\WRUHYLVHWKHHVWLPDWHDWWKHHQGRIWKHFDOHQGDU year.
3DUW9HUL¿FDWLRQ
7KHDJHQF\KHDGRUKLVKHUGHVLJQHHPXVWVLJQWKHYHUL¿FDWLRQ )UHTXHQWO\$VNHG4XHVWLRQV
)$4V

1. :KHQGRHVDQDJHQF\QHHGWRFRPSOHWHWKH)RUP"
$)RUPLVUHTXLUHGZKHQDQDJHQF\¶VERDUGPHPEHUV YRWHWRDSSRLQWDERDUGPHPEHUWRVHUYHRQDQRWKHU
JRYHUQPHQWDODJHQF\RUSRVLWLRQRIWKHDJHQF\RIZKLFKWKH RႈFLDOLVDPHPEHUDQGZLOOUHFHLYHDGGLWLRQDOFRPSHQVDWLRQ

2. 7KHFLW\FRXQFLOYRWHVWRVHUYHDVWKHFLW\¶VKRXVLQJDXWKRULW\ DVHSDUDWHHQWLW\:LOOWKH)RUPEHUHTXLUHG"
,IWKHFRXQFLOPHPEHUVUHFHLYHDGGLWLRQDOFRPSHQVDWLRQIRU VHUYLQJRQWKHKRXVLQJDXWKRULW\WKH)RUPLVUHTXLUHG

3. $UHDSSRLQWPHQWVPDGHE\DJRYHUQLQJERDUGWRDSSRLQW RQHRILWVPHPEHUVWRVHUYHDVDQRႈFHURIWKDWERDUGIRU DGGLWLRQDOSD\
HJPD\RU
UHTXLUHGWREHGLVFORVHGRQ)RUP
"

1R)33&5HJXODWLRQ
E

H[HPSWVIURPWKLV
UHTXLUHPHQWGHFLVLRQVWR¿OODSRVLWLRQRQWKHERG\RIZKLFK WKHRႈFLDOLVDPHPEHU
VXFKDVDFRXQFLOPHPEHUEHLQJ
DSSRLQWHGDVPD\RU
GHVSLWHDQLQFUHDVHLQFRPSHQVDWLRQ

4. ,QGHWHUPLQLQJWKHLQFRPHPXVWWKHDJHQF\LQFOXGHPLOHDJH UHLPEXUVHPHQWVWUDYHOSD\PHQWVKHDOWKEHQH¿WVDQGRWKHU FRPSHQVDWLRQ"
1R)33&5HJXODWLRQUHTXLUHVRQO\WKHDPRXQWRI WKHVWLSHQGRUVDODU\WREHUHSRUWHG

:KLFKDJHQF\PXVWSRVWWKH)RUP"
7KHDJHQF\WKDWLVYRWLQJWRDSSRLQWDSXEOLFRႈFLDOPXVWSRVW WKH)RUPRQLWVZHEVLWH7KHDJHQF\WKDWWKHRႈFLDOZLOO VHUYHDVDPHPEHULVQRWUHTXLUHGWRSRVWWKH)RUP7KH IRUPLVQRWVHQWWRWKH)33&

:KHQPXVWWKH)RUPEHXSGDWHG"
7KH)RUPVKRXOGEHDPHQGHGSURPSWO\XSRQDQ\RI
WKHIROORZLQJFLUFXPVWDQFHV

WKHQXPEHURIVFKHGXOHG
PHHWLQJVLVFKDQJHG

WKHUHLVDFKDQJHLQWKH
FRPSHQVDWLRQSDLGWRWKHPHPEHUV

WKHUHLVDFKDQJHLQ
PHPEHUVKLSRQWKHERDUGRUFRPPLVVLRQRU

WKHUHLVD
QHZDSSRLQWPHQWWRDQHZDJHQF\

,IRႈFLDOVFKRRVHWRUHFXVHWKHPVHOYHVIURPWKHGHFLVLRQ DQGOHDYHWKHURRPZKHQDYRWHLVWDNHQWRPDNHDQ
DSSRLQWPHQWPXVWWKH)RUPEHFRPSOHWHG"
1R7KH)RUPLVRQO\UHTXLUHGWRLGHQWLI\WKRVHRႈFLDOV WKDWZLOOYRWHRQDQDSSRLQWPHQWLQZKLFKWKHRႈFLDOZLOODOVR UHFHLYHDGGLWLRQDOFRPSHQVDWLRQ

Privacy Information Notice
,QIRUPDWLRQUHTXHVWHGE\WKH)33&LVXVHGWRDGPLQLVWHUDQG HQIRUFHWKH3ROLWLFDO5HIRUP$FW)DLOXUHWRSURYLGHLQIRUPDWLRQ PD\EHDYLRODWLRQVXEMHFWWRSHQDOWLHV$OOUHSRUWVDUHSXEOLF UHFRUGVDYDLODEOHIRULQVSHFWLRQDQGUHSURGXFWLRQ'LUHFW TXHVWLRQVWR)33&¶V*HQHUDO&RXQVHO)DLU3ROLWLFDO3UDFWLFHV &RPPLVVLRQ46WUHHW6XLWH6DFUDPHQWR&$

California
Form 806
$3XEOLF'RFXPHQW
Agency Report of:
3XEOLF2ႈFLDO$SSRLQWPHQWV
Item: 10
277

Lake Forest City CouncilMarch 7, 2023

Lake Forest City Council
March 7, 2023