Councilmember Vacancy Application
Due January 18, 2023, by 5:00 p.m.
Submit application to:
Office of the City Clerk
500 Castro Street
Mountain View, CA 94041
[email protected]
Personal Information:
Name:________________________________________________________________________ Last First MI
Residence Address: _______________________________________ Street City State Zip
Home Telephone: _______ Work Telephone: ________
Email: _____________________________________________
Email and/or Telephone for Public Dissemination:______________________________________ Resident of the City of Mountain View:____________ years Are you thinking of/planning to run for City Council in 2024? Yes ▢ No ▢ Undecided ▢ General Information and Instructions:
Applicants must be 18 years of age, a resident of the City of Mountain View, and a registered voter of the City at the time of application submission. Please attach your résumé, letter of interest and completed Fair Political Practices Commission Statement of Economic Interests Form 700 to this completed vacancy application. Your letter of interest should not exceed one page. Topics to consider covering in your letter of interest are:
Why do you want to be appointed to the City Council?
Why do you believe you are the most qualified to serve on the City Council? What is the most serious social issue in Mountain View? If appointed, how will you develop and maintain a relationship with the business community? Answers to the following supplemental questions are mandatory in order to be considered for the vacancy.
Attachment 4
Councilmember Vacancy Applicant Name:____________________________________________
Please fill out all information completely. Attach additional pages if needed.
How many Council meetings have you attended or observed, and what was your level of involvement?
What does “Community For All” mean to you?
Councilmember Vacancy Applicant Name:____________________________________________
Please fill out all information completely. Attach additional pages if needed.
Discuss one City Council goal and what it means to you.
What are your thoughts/ideas for improving the housing supply to meet today’s requirements (including R3) as well as planning for the future? Councilmember Vacancy Applicant Name:____________________________________________
Please fill out all information completely. Attach additional pages if needed.
Please submit your entire packet of documents to the Office of the City Clerk via email or hand delivery by January 18, 2023, by 5:00 p.m. Applications submitted incomplete and without a résumé, letter of interest and Fair Political Practices Commission Statement of Economic Interests Form 700 will be disqualified from consideration.
Late applications will not be accepted.
During the application period, the City Clerk’s Office is open Monday through Friday from 8:00 a.m. to 5:00 p.m. City Hall is closed on Monday, January 16, 2023, in observance of Martin Luther King Jr. Day. Your application is a public document.
Please direct questions about the application process to the City Clerk’s Office at 650‐903‐6304.
READ CAREFULLY BEFORE SIGNING
I hereby certify that all statements made in this application are true, and I authorize investigation of all information contained in the application. I acknowledge that any false statements or misrepresentation on this application will be grounds for disqualification. ______ _____ __________________________
Signature
Date
Steven M. Goldstein
CISSP CompTIA Security+ MCSA MCSE MCSA/S MCSE/S
Email:
M
ountain View, CA 94041
Phone:
Objective My plan is to provide information security services and develop cohesive IT practices in the Santa Clara or San Francisco California area.
Professional
Certifications and
Privileges Acquired:
Active Secret U. S. Government Security Clearance, Interim Top Secret CISSP Certification: 311851
Microsoft Certified Systems Engineer With Security 3135295 Microsoft Certified Systems Administrator With Security 3135295 CompTIA Security+ COMP001002375879
Department of Defense DIACAP DAA
Department of Defense DIARMF DAO
Experience
Jan 2019 – Jan 2020 NCI. Inc Reston, VA
Contractor: IT Security, Windows Subject Matter Expert
Working for the U.S. Army Telecom headquarters at Fort Huachuca AZ. My work involved using Microsoft Server technologies to facilitate OS Hardening and Compliance record management. This involved the use of Microsoft System Center Configuration Manager, System Center Orchestrator, and System Cent er Operations Manager. At the same time my work was targeted to be in Information Assurance engineering and Security Analysis. My prerequisites was that I have good standing in U.S. Government Security and be able to provide both Systems Engineering/Administration and Information Security Practices. I acquired the latest accreditation for being a Designated Accrediting Officer for DOD systems. Tasks involved both rehearsing the process of developing a working environment from nothing as well as providing assistance with team members in deploying the systems in the actual networks. My work also involved making use of Microsoft Hyper-V for the first time in an employment assignment. My ability to use it was solid enough that I could develop a working environment on a laptop even though I built 13 Virtual Servers in it. I have been preparing Enterprise Level Server arrangements so that Microsoft SCCM CB 1902, SCOM 2016, and Scorch 2016 are fully functional and can be used as a Central Administrative Site and Primary and Secondary Sites
Feb 2018 – Aug 2018 Compucomm San Jose, CA
Contractor: IT Refresh and Infrastructure Project
Tasks involve the new construction on site regarding a new network environment. Providing network installation and revision where appropriate. At the same time I am working on the building and migration of Windows 10 systems, ensuring transference of user states so that clients are provided smooth transition with minimal loss of any work data. The most critical part of this work was the establishment of how to make most effective use of effort by determination of what systems were live, what services they operated, what potential problems with use of the selected tools if there are known problems, best method to remedy the compliance reported issues, and maintain a comprehensive record of the resolution of a particular system.
March 2017 –Nov 2017 Medical Leave
Assisting
May 2016 –Oct 2016 PayPal San Jose, CA
Contractor: IT Security Compliance Expert
Evaluation of IT fleet of equipment at in order to established the required security compliance of the PayPal Server Fleet. The most critical part of this work was the establishment of how to make most effective use of effort by determination of what systems were live, what services they operated, what potential problems with use of the selected tools if there are known problems, best method to remedy the compliance reported issues, and maintain a comprehensive record of the resolution of a particular system. This work required the investigation of systems failing to report to the proper security monitoring devices and either determining that the servers needed correction or were in compliance and was reporting falsely. This work resulted in the investigation of 5000+ individual systems ensuring that the proper selected security solutions were installed and properly operating. Even though this task involved such a large volume of systems, this task was achieved in a very time effective manner with a team of less than 5 persons due to my assistance. Critical understanding and use of firewalls, routers, switches and familiarity w ith SIEM centralized security
management was required. Critical understanding of the diversity of advanced persistent attacks, discovery and mitigating of vulnerabilities, proper approaches involving data spillage or penetration was vital in this task. Critical processes to establish the best methods to detect malware behaviors, abnormal activities from hosts or servers, understanding attack vectors and the process of pivoting attacks from sites or services, was vital. M y competence in using a variety of methods to collect and analyze and validate open source information issues was essential. This work was required because the divorce between eBay and PayPal resulted in a total systems reevaluation due to changes in the specific functions PayPal assets were using as a result. This was done on- site with a very competent and effective security compliance team. Excellent verbal and written communication skills provided ease for the teammates involved. My efforts created tools and resources that simplify the efforts in providing progress tracking, controls assessment, dealing with required exceptions to have successful information systems, and finally completing the reports required to achieve effective strategic management of IT designs and implementations.
April 2013- September 2015 Medical Treatment San Jose, CA Condition: due to auto accident that occurred in April, 2013 where and needed to be fixed.
May 2012 –March 2013 PG&E San Francisco, CA
Contractor: Windows Systems Analyst
Evaluation of IT fleet of equipment a t the same time my work has involved the forensic process of identifying significant issues that will need further research and refinement regarding vendor software systems. In fact discovery of serious problems that seem to be unanticipated has been tested and quantified and have been presented to the specific vendor for resolution. Excellent verbal and written communication skills provided ease for the teammates involved. My efforts created tools and resources that simplify the efforts in providing progress tracking, controls assessment, dealing with required exceptions to have successful information systems, and finally completing the reports required to achieve effective strategic management of IT designs and implementations. This environment consisted of a Microsoft network infrastructure using Cisco network backbones, and Cisco and Juniper firewall s, and McAfee Security technologies implementations.
October 2011 –Mar. 2012 U.S. Air Force Lompoc, CA
Contractor: Information Security Specialist and Windows Systems Administrator Working on location at Vandenberg AFB in California to perform services for the U.S. Dept. of Defense.
My responsibilities were involved with Information Assurance Engineering targeting the authorized use of information technologies in a Classified DoD environment for the Space Lift Range. I performed work in compliance with the Attorney General Information Assurance practices, and the current standards under the DIACAP acquiring a DoD certificate to perform as a Designated Accrediting Authority. I was assigned to test and authorize use of IT Assets. The role required special skills in I S hardening, inspection and compliance with DISA security policies, excellent verbal and written communication skills provided ease for the teammates involved. The assets were working on Microsoft windows network infrastructure primarily, Red Hat Linux, and the networking was Cisco using juniper and DOD certified firewall and traffic analysis systems, and McAfee security systems. Critical understanding and use of firewalls, routers, switches and familiarity with SIEM centralized security management was required. Critical understanding of the diversity of advanced persistent attacks, discovery and mitigating of vulnerabilities, proper approaches involving data spillage or penetration was vital in this task. Critical processes to establish the best methods to detect malware behaviors, abnormal activities from hosts or servers, understanding attack vectors and the process of pivoting attacks from sites or services, was vital. My competence in using a variety of methods to collect and analyze and validate open source information issues was essential. My efforts created tools and resources that simplify the efforts in providing progress tracking, controls assessment. This also required dealing with exceptions to have successful information systems, and finally completing the reports required to achieve authority to operate information systems that are used in classified data systems. This assignment required highly adaptive work efforts and rapid skills assimilation.
July 2011 – Sep. 2011 Lockheed Martin Various Locations Contractor: Information Security Specialist and Windows Systems Administrator Working on locations at Sunnyvale CA at the Lockheed Martin Space Systems Center. My assignment was to provide analysis regarding the current state of IT assets and the manner of their use. Provide updated information regarding the state of the information systems. The assets were working on Microsoft windows network infrastructure primarily, Red Hat Linux, and the networking was Cisco using Juniper Firewalls and McAfee security suite. And provide assistance in the windows administration of the network. Critical understanding and use of firewalls, routers, switches and familiarity with SIEM centralized security management was required. Critical understanding of the diversity of advanced persistent attacks, discovery and mitigating of vulnerabilities, proper approaches involving data spillage or penetration was vital in this task. Critical processes to establish the best methods to detect malware behaviors, abnormal activities from hosts or servers, understanding attack vectors and the process of pivoting attacks from sites or services, was
vital. My competence in using a variety of methods to collect and analyze and validate open source information issues was essential. The target was redefined information security standards that are required to be provided to the U.S. Government oversight office. New standards were established, and an asset inventory was needed to update the data reports. This work performance was so strong a letter of recommendation was written by a Lockheed Martin official and is available.
Oct. 2010 – Dec. 2010 Tanager Inc. Annapolis Junction, MD Contractor: Windows Deployment Specialist/Systems Administration Working on locations at for NASA dealing with performing systems analysis and providing advisory reports for Windows 7 migration project. This project utilized System Center Configuration Manager and Swimage Projects, and the networking was Cisco using Juniper Firewalls and McAfee security suite. This work involved solely working on server centers in 4 locations in the U.S. This work required trouble shooting and understanding of Windows 2008 and 2003 network systems environments so that clients systems would perform up to systems and security standards. This expertise included extensive knowledge in Active Directory, resource organization (OUs), DNS, DHCP , and group policy design, implementation, and troubleshooting. Critical understanding and use of firewalls, routers, switches and familiarity with SIEM centralized security management was required. Critical understanding of the diversity of advanced persistent attacks, discovery and mitigating of vulnerabilities, proper approaches involving data spillage or penetration was vital in this task. Critical processes to establish the best methods to detect malware behaviors, abnormal activities from hosts or servers, understanding attack vectors and the process of pivoting attacks from site or services, was vital. My competence in using a variety of methods to collect and analyze and validate open source information issues was essential. Whenever necessary, the documentation regarding security practices when performing systems transfers and installations was prepared and submitted to the team leader.
Required secret security clearance and proven compliance with standards of practice regarding data within NASA.
April 2010 –July 2010 Lockheed Martin Mountain View, CA Contractor: Desktop Specialist/Systems Administration
Demonstrated excellent customer service and technical skills when working to upgrade client systems. This work required trouble shooting and understanding of Windows 2008 and 2003 network systems environments, and the networking was Cisco using Juniper Firewalls and McAfee security suit so that clients systems would perform up to syste ms and security standards. Whenever necessary, the documentation regarding security practices when performing systems transfers and installations was prepared and submitted to the team leader. Required secret security clearance and proven compliance with standards of practice regarding data within Lockheed Martin. Performed as a face to face representative with employees of Lockheed Martin.
April 2009- Nov. 2009 Gadget Gangster San Jose, CA
Contractor: IT Security Consultant/Systems Administration/Audit For Gadget Gangster, demonstrated excellent systems administration, and e-commerce required security analysis, process planning, transaction security, and following PCI security policies. This work required providing VISA and MasterCard financial groups with documentation outlining the methods used to comply with PCI security protocols. The assets were working on Microsoft windows network infrastructure primarily, Red Hat Linux, and the networking was Cisco using Cisco Firewalls and Symantec security systems.
July 2008- Mar 2009 Medical Treatment San Jose, CA
Condition: : Complete recovery . In process
of recovery acquires Secret U.S. Government Security Clearance and has been working to become certified as a CCNA. Using CISCO device simulation to build network environments and troubleshooting existing problems with failing systems.
April 2008 –July 2008 TriNet San Leandro, CA
Contractor: IT Deployment Consultant/Systems Administration For TriNet Group, demonstrated excellent systems analysis, requirements identification, I.T. security analysis, and implementation planning and execution involved with the development of Windows automated systems deployment. This work involved the use of Microsoft System Center Configuration Manager to develop a Light Touch and Zero Touch deployment process. In order to comply with SOX and HIPPA, the project required writing security policies and establishing compliance procedures to be adopted by this firm.
This project was completed in two months.
Aug. 2007 – Nov. 2007 Xtiva Financial Group San Francisco, CA Contractor: Systems Engineer, Systems Administration
Provided engineering solution to comply with new Business Continuity Standards under SOX. This required a redesign of the Wi ndows infrastructure, and methods to transition for current operations. My work
successfully developed a solution for the lack of business continuity problems that existed due to growth of the sites workload, and physical environmental issues involving systems integrity and thermal risks on the server cluster. The site required a new design to maintain operability and orderly shutdown of the site in view of power failures, and any related circumstances.
Oct. 2006 – Aug. 2007 Relocation to Mountain View Mountain View, CA Situation:
home was to be sold, I was responsible for clearing
out the home, doing repairs, reconditioning, and other tasks to make the house saleable.
Time needed to arrange apartment, complete move of property, receiving vehicle from transport company, and arranging finances.
Sep. 2005 – Sep. 2006 Intel Corp. Hudson, MA
Contractor: IT Project Specialist/Systems Administrator/Engineer Project management tracking duties to maintain project status of 8200 Ramp. Decommissioned , prepped for transport, and installed Windows workstations designed to control fabrication equipment in Intel Corporation microchip manufacturing facility. This expertise included extensive knowledge in Active Directory, resource organization (OUs), DNS, DHCP, and group policy design, implementation, and troubleshooting. Prepared and maintained tool “station controllers” that use UNIX programs to control the multimillion-dollar fabrication tools. The operating systems specifically utilized and maintained are Sun Solaris, Red Hat and Centos Linux, and the family of Windows Server and Desktop systems, as well as Cisco Network Devices. Performed tasks to comply wi th existing security policies of information assets including securing data assets, implementation of business continuity policies, and securing data communications. Performed network -troubleshooting tasks to assist in identifying issues that needed addressing whenever needed. Possess certifications required by Intel to manage corporate IT resources within standards of compliance of Intel. Acquired a variety of certifications provided by training and skills assessment via Skillsoft in IT projects managemen t, organizational skills, and specific technical applications. The use of Ghosting, Image Development and Distribution, and Remote Installation Services under Windows networking was successfully implemented.
Trying to keep it brief 5 other positions in between these 2. 1992 – 1999 Moduspec Company Sudbury, MA
Systems Engineer and Hardware/Software Technical Specialist Provided systems analysis & design, and applications integration with analog systems to pc systems. Provided technical and project management planning and documentation that successfully achieved working on projects for NASA, the Department of Defense and the Environmental Protection Agency. Solely responsible for all security aspects of information assets including securing data assets, performing business continuity policies (planning, docum entation, and implementation). The use of Ghosting, Image Development and Distribution, and Remote Installation Services under Windows networking was successfully implemented. This work included operating s ystems hardening, applications vulnerability assessments, s ecuring data communications, configuring firewalls and antivirus configuration. This involved the use of Symantec and McAfee systems security products. This position required technical documenta tion for both in- line system processes and end -user operations. Managing Microsoft Windows 95, 95SE, 98, 98SE, NT, 2000 Professional, 2000 Advanced Server, 2000 Internet Secured and Accelerated Server. Network Administration of Microsoft Windows 2000 Networ ks & Active Directory Services. Microsoft Office Applications for 97, and 2000 including Access, Microsoft Visio, Microsoft Project, LABtec Notebook, C/C++ programming, Macro development, Galactic SpectralID software.
Education
2004 Clark University Framingham, MA
Masters Certificate in Information and Network Security Demonstrated expertise in network and information systems security via use of secured network topology & technology, intrusion detection systems, auditing procedures, firewall & router management, developing security policies, and performing security breach forensics. 2003 Clark University Framingham, MA
Masters Certificate in MS Windows 2000 Systems Engineering
Demonstrated expertise in Microsoft network workstations, servers, network administration, network engineering, active directory, domain management, and supplemental systems including skilled knowledge of TCP/IP.
1996 – 2002 San Jose State University San Jose, CA
Bachelors of Science: Business Admin.: Management Information Systems Demonstrated expertise and project leadership in specific areas of information systems, human resources management and work not connected with the major. Information systems degree required proficiency in computer programming, systems analysis, relational database design and operation (Oracle), network security expertise, impact of technology on business operations, and IT project management practices. 1996 – 2002 San Jose State University San Jose, CA
Bachelors of Science: Business Admin.: Human Resources Management Demonstrated expertise and project leadership in specific areas of human resources management and work not connected with the major. Human Resource Management degree required proficiency in Job Analysis, Performance Assessments, Recruitment & Staffing Strategies, Compensation Analysis & Planning, Legal Regulations in Human Resources, Human Resources Information Systems, Affirmative Action Rules, Regulations, & Compliance Analysis, and Strategic Implementation of Human Resources.
Skills
18 total years in Managing Microsoft Windows 95, 95SE, 98, 98SE, NT, 2000 Professional, XP Professional, Vista Ultimate, Windows 7, 2000 Advanced Server, 2000 Internet Secured and Accelerated Server, 2003 Standard and Enterprise Server, 2008 Server .
17 years experience with LAN, TCP/IP, OSI, and Wireless network technologies 13 total years in The use of Norton Ghosting, Microsoft Remote Installation Services, Windows Deployment Services, Microsoft Deployment Toolkit, Business Desktop Deployment, System Management Server, Platform Image Development and Distribution, and System Center Configuration Manager under Windows networking was successfully implemented. This required familiarity with Zero Touch Installation, Light Touch Installation and Microsoft Desktop Optimization. 12 years of use of information security tools including McAfee and Symantec Security Products, Ethereal, Tripwire, Snort, WireShark, Nessus, and other Network security tools 10 years working with Firewalls, Next Gen Firewalls, Traffic monitoring Tools, Data Sniffing and Traffic Analysis.
10 total years in Network Administration of Microsoft Windows 200X Networks & Active Directory Services, Applications and Device Driver Compatibility assessment and mitigation 9 total years in the utilization of IIS services to establish proper secured access and authentication for using services and resources in a Microsoft Network Infrastructure. 7 total years’ experience with Apple MAC OS and Apple IOS management. 6 years using Information Security tools like Splunk, Nessus, Symantec Network Security Suite, McAfee Network Security Suite, Symantec Data Encryption, McAfee Data Encryption, RSA Multi -Factor Authentication, VPN management.
2 years with f amiliarity with VMware virtualization tools. Familiarity with Citrix remote desktop/server technologies.
2 years ability to operate Cisco network technologies, especially in the areas of analyzing the configurations and operations of devices to ensure they are complying with the security plans of an organization. 17 years of Microsoft Office Applications for 97, and 2000 including Access, Microsoft Visio, Microsoft Project, Oracle Database Skills in SQL/PL. ABRA Suite HR systems and Ceridian HR Systems. GerstAAP:
JoBASE human resources analysis system.
4 years of familiar with Red Hat Linux Operating Systems, Sun Solaris Unix Systems operations. 3 years familiarity with RSA EnVision via an ISC2 CISSP Seminar, providing the ability to install, configure, create events either built in or user generated, developing database entries, and finally developing reports with the suite. Familiarity with the use of it to monitor Active Directory Group Policy Changes and recording and reporting events that are critical for enterprise integrity. 3 years familiarity with NetWitness Products: Investigator, Decoder, Informer and Concentrator via an ISC2 CISSP Seminar, providing the ability to install, configure, create events either built in or user generated, utilizing tools to perform forensic analysis of the event, and any related network activity that resulted in the event allowing one to be able to illustrate the sequence of events that lead up to the incident. 4 years ability to design, implement, operate and audit secured informational resources: This includes the use of status, traffic, device, troubleshooting, and security tools. The ability to understand and implement a variety of encryption processes like RSA and PKI. The understanding and ability to implement encryption of data in states of backup or inactivity and familiarity with tools like DataFort and CryptoStor. 2 years experience with VOIP technologies and systems
Steven Goldstein
Mountain view, CA 94041
01/18/2023
City Council
City of Mountain View
500 Castro Street
Mountain view CA 94041
Dear Ci ty Council,
Here is my letter of intent regarding the appointment to the City council. Given there is no template or guidance regarding the content of this letter.
In any event, my intent is to either get any projects started withing 90 days regarding any development or they will be expired. That I will expect to provide the city residents the greatest assistance given the current economic and public health crisis we are still in. In fact I will establish an extension of rental assistance as well as establish a longer eviction moratorium that is based on the date of en ding any Covid emergency order from the Federal Government.
I also will want to have a new Seismic analysis done using the proper scientific equipment to determine the vulnerable units of all buildings in the City. That the Certificates of Occupancy must be issued only where pro per inspections have been performed, not just by “visual” or “subjective” technologies. If a landlord does not provide such inspections withing 6 months that will expire any provisional one upon purchase, and this will be retroactive. If the City Inspector cannot do this, then we need a new one.
Sincerely ,
Steven Goldstein
Schedule C - Income, Loans, & Business Positions – schedule attached Schedule D - Income – Gifts – schedule attached
Schedule E - Income – Gifts – Travel Payments – schedule attached /HDYLQJ2IÀFH
Date Left / /
(Check one circle.)
The period covered is January 1, 20222022, through the date of OHDYLQJRI¿FH
The period covered is / / , through
WKHGDWHRIOHDYLQJRI¿FH
$QQXDO
The period covered is January 1, 2022,2022, through
December 31, 20222022
The period covered is / / , through
December 31, 20222022
STATEMENT OF ECONOMIC INTERESTS
COVER PAGE
A PUBLIC DOCUMENT
,KDYHXVHGDOOUHDVRQDEOHGLOLJHQFHLQSUHSDULQJWKLVVWDWHPHQW,KDYHUHYLHZHGWKLVVWDWHPHQWDQGWRWKHEHVWRIP\NQRZOHGJHWKHLQIRUPDWLRQFRQWDLQHG KHUHLQDQGLQDQ\DWWDFKHGVFKHGXOHVLVWUXHDQGFRPSOHWH,DFNQRZOHGJHWKLVLVDSXEOLFGRFXPHQW I certify under penalty of perjury under the laws of the State of California that the foregoing is true and correct.
Date Signed
(month, day, year)
3. Type of Statement (Check at least one box)
State Judge, Retired Judge, Pro Tem Judge, or Court Commissioner
6WDWHZLGH-XULVGLFWLRQ
6WDWHZLGH-XULVGLFWLRQ
Multi-County County of
City of Other
-XULVGLFWLRQRI2IÀFH (Check at least one box)
&DQGLGDWH
Date of Election DQGRI¿FHVRXJKWLIGLIIHUHQWWKDQ3DUW
$VVXPLQJ2IÀFH
Date assumed / /
'DWH ,QLWLDO )LOLQJ 5HFHLYHG
Filing 2FLDO 8VH 2QO\
Please type or print in ink.
700
FAIR POLITICAL PRACTICES COMMISSION
CALIFORNIA FORM
Agency Name (Do not use acronyms)
Division, Board, Department, District, if applicable Your Position 2IÀFH$JHQF\RU&RXUW
NAME OF FILER (LAST) (FIRST) (MIDDLE)
MAILING ADDRESS STREET CITY STATE ZIP CODE
DAYTIME TELEPHONE NUMBER EMAIL ADDRESS
(Business or Agency Address Recommended - Public Document) Signature
)LOHWKHRULJLQDOO\VLJQHGSDSHUVWDWHPHQWZLWK\RXU¿OLQJRI¿FLDO
9HULÀFDWLRQ
Ź,I¿OLQJIRUPXOWLSOHSRVLWLRQVOLVWEHORZRURQDQDWWDFKPHQW (Do not use acronyms) $JHQF\
3RVLWLRQ
-or-
-or-
None - No reportable interests on any schedule
4. Schedule Summary (required)
Schedules attached
Schedule A-1 - Investments – schedule attached
Schedule A-2 - Investments – schedule attached
Schedule B - Real Property – schedule attached
Ź Total number of pages including this cover page:
-or-
FPPC Form 700 - Cover Page (2022/2023)
[email protected] • 866-275-3772 • www.fppc.ca.gov
P
age - 5
Goldstein Steven Micheal
Applicant
■ Mountain View
■ City Council
■
Mountain view CA 94041
01/17/2023 Steven Goldstein
Digitally signed by Steven Goldstein
Date: 2023.01.18 16:58:44 -08'00'