Agenda packet — Oxnard City Council, March 19, 2024 (part 4 of 5)

Bond proceeds from Successor Agency - - - - 9,896,298 Total sp
ecial items - - - - 9,896,298
Net change in fund balances $7,392,453 $24,154,000 $7,393,098 $16,895,289 $1,049,611 Debt service as a percentage of noncapital expenditures 4.14% 6.50% 6.47% 6.44% 6.10% Source: Finance Department, City of Oxnard
656
City of Oxnard, California
SCHEDULE IV (Continued)
Changes in Fund Balances of Governmental Funds
Last Ten Fiscal Years
(modified accrual basis of accounting)
-203-
Fiscal Year
2019 2020 2021 2022 2023
Revenues
$135,051,078 $133,565,036 $164,801,682 213,904,450 $ 225,315,167$ Taxes 4,057,972 3,852,280 5,019,520 3,702,771 5,381,448 Licenses and permits 24,527,753 25,312,025 34,738,885 55,129,611 46,187,436 Intergovernmental 6,310,510 2,313,182 12,036,333 4,104,875 4,168,962 Growth and dev elopment fees 21,302,912 23,772,644 19,339,452 17,539,473 13,116,597 Charges for services 2,693,405 3,381,758 1,924,384 2,613,509 2,816,558 Fines and forfeitures 5,293,976 3,049,270 968,386 1,055,755 - Interest
9,142,871 8,223,416 7,461,211 6,932,860 6,503,861 Special assessments - - - - - Contributions from property owners - - - - - Rental income
- - - - 757,515 Investment income
10,982,388 5,615,546 6,580,337 (3,942,474) 6,014,880 Miscellaneous 219,362,865 209,085,157 252,870,190 301,040,830 310,262,424 Total rev enues Expenditures
17,566,664 21,597,780 16,558,258 21,533,767 21,926,995 General government 103,505,038 111,150,931 113,774,066 120,317,318 131,043,033 Public safety 10,808,214 11,198,258 11,093,922 12,787,453 - Transportation - - - - 39,132,067 Public works
19,402,262 17,755,657 23,840,597 20,096,478 12,802,525 Community development 32,696,129 31,859,562 28,871,680 35,483,009 16,779,191 Culture, leisure and libraries - - - - 10,170,206 Housing
16,277,911 8,992,813 23,579,052 28,092,448 44,919,399 Capital outlay Debt Service:
6,121,274 5,952,119 5,835,030 6,542,675 7,269,096 Principal 4,957,649 5,714,456 4,086,553 3,873,096 3,861,642 Interest 211,335,141 214,221,576 227,639,158 248,726,244 287,904,154 Total expenditures 8,027,724 (5,136,419) 25,231,032 52,314,586 22,358,270 Excess of revenues over (under) expenditures Other Financing Sources (Uses)
- - - 3,300,000.00 - Proceeds from financing sources - (39,695,000) - - - Payment to escrow agent
- 44,520,000 - - - Proceeds from sale of bonds
- (983,059) - - - Cost of issuance
- 2,875,507 - - - Bond discount/premuim
- - - - 5,320,000 Issuance of debt
- - - - 1,869,621 Inception of subscription-based IT arrangements - - - - 91,621 Transfer from fiduciary funds
- - - - (2,446,040) Transfer to fiduciary funds 12,370,626 13,668,887 9,801,455 36,942,178 56,404,284 Transfers in (12,096,584) (13,494,482) (47,288,541) (36,601,638) (66,220,948) Transfers out 274,042 6,891,853 (37,487,086) 3,640,540 (4,981,462) Total other financing sources (uses) Special items:
- 1,514,213 - - - Bond proceeds from Successor Agency - 1,514,213 - - - Total special items
$8,301,766 $3,269,647 ($12,256,054) $55,955,126 $17,376,808 Net change in fund balances

5.68% 5.52% 4.50% 4.53% 4.49% Debt service as a percentage of noncapital expenditures 657
City of Oxnard, California

SCHEDULE V
Governmental Activities Tax Revenues by Source
Last Ten Fiscal Years
(modified accrual basis of accounting)
-204-
Fiscal Property Sales Business Transient Franchise Deed Penalties Year Tax Tax License Occupancy Tax Tax Transfer Tax and Interest Total 2014 54,783,756 38,287,439 5,125,801 4,239,111 3,775,233 519,093 157,998 106,888,431 2015 58,633,590 40,624,737 5,104,859 4,649,292 4,093,435 758,502 142,127 114,006,542 2016 61,571,660 43,163,411 5,422,499 5,044,231 3,854,116 690,805 225,990 119,972,712 2017 60,802,119 44,092,707 5,348,086 5,174,427 3,703,971 729,609 228,899 120,079,818 2018 67,165,834 43,418,876 5,570,488 5,749,572 3,925,374 818,322 313,847 126,962,313 2019 70,227,546 48,518,650 6,167,475 5,557,470 3,887,252 692,685 361,488 135,412,566 2020 72,208,270 46,320,415 6,087,060 4,302,491 3,972,958 673,842 406,774 133,971,810 2021 81,447,932 67,923,383 5,964,716 4,267,463 4,287,254 910,934 201,657 165,003,339 2022 78,630,717 118,083,508 6,537,644 5,117,229 4,557,215 978,170 92,544 213,997,027 2023 78,849,939 128,533,831 6,677,266 5,271,128 5,303,433 679,570 294,969 225,610,136 658
City of Oxnard, California

SCHEDULE VI
Assessed Value and Estimated Value of Taxable Property
Last Ten Fiscal Years
-205-
Fiscal Personal Less: Tax Exempt Total Taxable Total Direct Estimated Actual as a Percentage Year Land Improvements Property Real Property Asse ssed Value Tax Rate Taxable Value of Actual Value 2014 6,551,413,092 9,120,556,468 638,670,637 694,237,291 15,616,402,906 1.25544% 15,616,402,906 100.00% 2015 7,084,272,773 9,694,262,028 631,218,103 708,835,243 16,700,917,661 1.25556% 16,700,917,661 100.00% 2016 7,653,508,229 10,068,135,286 652,518,246 753,110,464 17,621,051,297 1.24681% 17,621,051,297 100.00% 2017 8,130,791,365 10,403,624,296 664,679,543 784,759,788 18,414,335,416 1.22712% 18,414,335,416 100.00% 2018 8,649,933,708 10,789,755,377 656,241,587 840,285,136 19,255,645,536 1.24657% 19,255,645,536 100.00% 2019 9,158,364,520 11,207,158,483 695,095,800 896,108,612 20,164,510,191 1.24170% 20,164,510,191 100.00% 2020 9,521,436,348 11,777,652,006 754,828,010 971,603,310 21,082,313,054 1.23896% 21,082,313,054 100.00% 2021 10,007,398,417 12,192,935,872 784,723,628 1,041,411,917 21,943,646,000 1.24885% 21,943,646,000 100.00% 2022 10,517,196,744 12,768,851,940 840,576,868 1,138,267,594 22,988,357,958 1.22788% 22,988,357,958 100.00% 2023 11,253,772,579 13,475,931,442 991,305,490 1,123,639,089 24,597,370,422 1.20824% 24,597,370,422 100.00% NOTE: The County does not provide the breakdown of residential and commercial assessed values to the cities. The City also no longer has the information available for the residential and commercial assessed values. The personal property amounts include assessed values for boats and aircraft.

Source: County of Ventura, Office of the Auditor-Controller Finance Department, City of Oxnard; HDL Coren & Cone
659
City of Oxnard, California

SCHEDULE VII
Direct and Overlapping Property Tax Rates
Last Ten Fiscal Years
-206-
Fiscal Total Direct &
Year Basic (1) Debt Service (2) Total Direct (3) School Districts (4) Water Districts (5) Total Overlapping Overlapping Rates 2014 1.00000% 0.25544% * 1.25544% 0.14140% 0.00350% 0.14490% 1.40034% 2015 1.00000% 0.25556% * 1.25556% 0.12060% 0.00350% 0.12410% 1.37966% 2016 1.00000% 0.24681% * 1.24681% 0.12640% 0.00350% 0.12990% 1.37671% 2017 1.00000% 0.22712% * 1.22712% 0.13840% 0.00350% 0.14190% 1.36902% 2018 1.00000% 0.24657% 1.24657% 0.29110% 0.00350% 0.29460% 1.54117% 2019 1.00000% 0.24170% 1.24170% 0.33120% 0.00350% * 0.33470% 1.57640% 2020 1.00000% 0.23896% 1.23896% 0.36440% 0.00350% 0.36790% 1.60686% 2021 1.00000% 0.24885% 1.24885% 0.38390% 0.00350% 0.38740% 1.63625% 2022 1.00000% 0.22788% 1.22788% 0.34750% 0.00350% 0.35100% 1.57888% 2023 1.00000% 0.20824% 1.20824% 0.31080% 0.00350% 0.31430% 1.52254% NOTE:
* Correction of prior year data
Source: County of Ventura, Office of the Auditor-Controller HdL, Coren & Cone
(5) Overlapping rate for Metroploitan Water District and Calleguas Muni Water Annex#16. Reflects actual overlapping rate.

Not all overlapping rates apply to all city property owners.

City Direct Rates Overlapping Rates
(1) The passage of Proposition 13 on June 6, 1978 established a maximum countywide lev y of 1% of market v alue or $1.00 per $100 of assessed value. (2) Total Direct Rate is the weighted average of all individual direct rates applied by the Entity preparing the statistical section and excludes revenues derived from aircraft. Beginning in 2013/14 the Total Direct Rate no longer includes revenue generated from the former redevelopment tax rates.

Challenges to recognized enforceable obligations are assumed to hav e been resolv ed during 2012/13. For report purposes, residual revenue is assumed to have been distributed to the City in the same proportion as General Fund Revenue. (4) The school district rates are for applicable school districts (3) Total Direct rate as presented is the Basic Levy plus Direct Debt Service 660
City of Oxnard, California

SCHEDULE VIII
Principal Property Taxpayers
Current Year and Nine Years Ago
-207-
Taxable Percentage of T axable Percentage of
Taxpayer Assessed Total Taxable Assessed Total Taxable
Value Rank Assessed Value Value Rank Assessed Value
Amazon Com Services LLC 325,387,098 1 1.32% - 0.00%
Procter & Gamble Paper Products 320,092,851 2 1.29% 318,375,847 1 2.02% Essex Arbors LP 234,675,633 3 0.95% 202,081,727 2 1.28% SOCM I LLC 141,047,874 4 0.57% 116,023,164 3 0.74% Serenade Apts Properties Owners LLC 119,489,675 5 0.48% - 0.00% Arctic Cold Oxnard LLC 105,089,778 6 0.43% 0.00%
G-I IX Esplanade Property LP 99,840,587 7 0.40% - 0.00% HAAS Automation Inc 99,232,500 8 0.40% 78,059,700 7 0.50% 2060 Zocolo LLC 95,673,601 9 0.39% - 0.00%
New-Indy Oxnard LLC 87,249,117 10 0.35% 69,467,684 9 0.44% Genon Energy West LP - Ormond Beach - 112,900,000 4 0.72% Capri of KW Serenade LLC - 84,691,280 5 0.54%
Prime Penisula LP - 84,540,000 6 0.54%
BG Terminal California LLC - 74,726,336 8 0.47%
Duesenberg Investment Company - 68,471,332 10 0.43%
Other taxpayers 23,091,413,961 93.41% 14,545,411,612 92.32% Totals 24,719,192,675 100.00% 15,754,748,682 100.00%
Source: HdL Coren & Cone
^ Pending appeals on parcels.
2023 2014
661
City of Oxnard, California

SCHEDULE IX
Property Tax Levies and Collections
Last Ten Fiscal Years
-208-
Y ear Collections in
Ended Total Tax Levy Subsequent
June 30 for Fiscal Year (1 )* Amount (2) * Percentage of Levy Years (1) Amount Percentage of Levy 2014 55,460,847 54,486,910 98.24% 456,769 54,943,679 99.07% 2015 59,303,044 57,509,993 96.98% 910,819 58,420,812 98.51% 2016 62,235,867 61,750,178 99.22% 350,407 62,100,585 99.78% 2017 61,751,329 58,086,482 94.07% 1,523,414 59,609,896 96.53% 2018 68,260,701 65,473,266 95.92% 903,482 66,376,748 97.24% 2019 71,278,856 68,423,547 95.99% 1,290,711 69,714,258 97.80% 2020 73,286,724 71,206,672 97.16% 1,175,364 72,382,036 98.77% 2021 82,559,732 77,736,649 94.16% 1,714,499 79,451,148 96.23% 2022 79,699,659 75,775,563 95.08% 1,323,291 77,098,854 96.74% 2023 79,897,712 76,312,644 95.51% 1,932,252 78,244,896 97.93% Source: (1) Finance Department, City of Oxnard
(2) County of Ventura
Correction * Property tax levy and collection amounts include secured and unsecured property taxes, property tax in lieu of vehicle license fee (VLF), public safety property tax and distributions from the Redevelopment Property Tax Trust Fund (RPTTF), and exclude special assessments Fiscal Year of the Levy Total Collections to Date
Collected within the
662
City of Oxnard, California

SCHEDULE X
Ratios of Outstanding Debt by Type
Last Ten Fiscal Years
-209-

CEG I K MN O Q
(1)
Fiscal Revenue Certificates of Tax Allocation Capital Revenue Capital Notes Total Primary Percentage of Year Bonds Participation Bonds Leases Bonds Leases Payable Government Personal Incom e 2014 32,453,939 24,755,000 - 9,943,968 347,340,473 2,093,846 - 416,587,226 10.252% 2015 71,026,930 24,064,918 - 22,159,563 316,333,774 1,546,350 - 435,131,535 10.581% 2016 66,823,533 23,464,945 - 21,558,130 305,514,850 1,034,692 - 418,396,150 10.043% 2017 64,280,135 22,839,973 - 19,873,684 295,626,652 552,843 - 403,173,287 9.716% 2018 66,940,356 22,180,000 - 22,695,103 285,697,297 5,073,701 - 402,586,457 9.318% 2019 63,984,454 21,460,000 - 20,060,511 278,192,906 4,590,375 - 388,288,246 8.434% 2020 89,363,537 - - 17,827,064 267,148,736 4,117,507 - 378,456,844 7.957% 2021 85,260,598 - - 15,801,116 273,910,375 3,655,774 269,710 378,897,573 7.599% 2022 80,944,184 - - 16,655,461 264,335,753 11,872,159 269,710 374,077,267 7.295% 2023 76,357,669 - - 19,532,353 252,596,306 9,963,927 269,710 358,719,965 6.688% NOTE: (1) Details regarding the City's outstanding debt can be found in the notes to the financial statements. (2) Demographic and Economic Statistics for personal income and population data HDL Coren & Cone * Corrected to use 2018 Per Capita not 2017 per HDL Coren & Cone Source: Finance Department, City of Oxnard
HDL Coren & Cone
Governmental Activities Business-type Activities
663
City of Oxnard, California

SCHEDULE XI
Direct and Overlapping Governmental Activities Debt
As of June 30, 2022

-210-
Estimated Estimated
Debt Percentage Share of
Governmental Unit Outstanding A pplicable Overlapping Debt City of Oxnard Overlapping Tax Debt (1):

Metropolitan Water District 19,215,000 0.673% 129,317
Ventura County Community College District 244,336,692 15.167% 37,058,546 Oxnard Union High School District 436,477,016 46.449% 202,739,209 Oxnard School District 340,058,816 92.667% 315,122,303
Rio School District 99,552,895 86.163% 85,777,761
Rio School District Community Facilities District No 1 63,015,000 100.000% 63,015,000 Hueneme School District 59,045,506 42.393% 25,031,161
Ocean View School District 9,228,362 40.595% 3,746,254
City of Oxnard Community Facilities District 1 6,180,000 100.000% 6,180,000 City of Oxnard Community Facilities District 3 21,425,000 100.000% 21,425,000 City of Oxnard Boulevard Highway Communities Facilities District 4,340,000 100.000% 4,340,000 City of Oxnard - Rice Av enue/Hwy 101 Assessment District 2001-1 7,060,000 100.000% 7,060,000 City of Oxnard - Oxnard Blv d/Hwy 101 Assessment District 2000-1 1,315,000 100.000% 1,315,000 California Statewide Community Development Authority District No. 2018-1 15,625,000 100.000% 15,625,000 California Statewide Community Development Authority 1915 Act Bond 110,074 100.000% 110,074 Ventura County General Fund Obligations 289,520,000 15.163% 43,899,918 Ventura County Superintendent of Schools - Certificates of Participation 7,350,000 15.163% 1,114,481 Oxnard Union High School District - Certificates of Participation 58,308,222 46.449% 27,083,586 Ocean View School District - Certificates of Participation 4,545,000 40.595% 1,845,043 Oxnard School District - Certificates of Participation 7,820,000 92.667% 7,246,559 Rio School District - Certificates of Participation 970,000 86.163% 835,781 Successor Agency - Tax Increment Debt 25,370,000 99.831% 25,327,112 Subtotal - Ov erlapping Debt 1,720,867,583 896,027,104
City of Oxnard Direct Debt (2):

City of Oxnard Lease Revenue Bonds 58,773,055
City of Oxnard Gas Tax Revenue Bonds 17,584,614
City of Oxnard Lease Purchase Agreements 10,764,076
City of Oxnard Capital Lease Obligations 8,768,277
Subtotal - Direct Debt 95,890,022
Total Direct and Overlapping Debt 991,917,126
Notes:
(1) The percentage of overlapping debt appicable to the City is estimated using assessed property values. Applicable percentages were estimated by determining the portion of the overlapping District's assessed value that is within the boundaries of the City divided by the District's total taxable assessed value.
(2) Excludes debt for business-type activities
Source: California Municipal Statistics, Inc.
664
City of Oxnard, California

SCHEDULE XII
Legal Debt Margin Information
Last Ten Fiscal Years
(in thousands)
-211-
2014 2015 2016 2017 2018 2019 2020 2021 2022 2023
Debt limit 2,427,380$ 2,593,772$ 2,643,158$ 2,762,153$ 2,888,347$ 3,024,677$ 3,162,347$ 3,291,547$ 3,448,254$ 3,689,606$ Total net debt applicable to limit --------- -
Legal debt margin 2,427,380$ 2,593,772$ 2,643,158$ 2,762,153$ 2,888,347$ 3,024,677$ 3,162,347$ 3,291,547$ 3,448,254$ 3,689,606$ Total net debt applicable to the limit
as a percentage of debt limit 0.00% 0.00% 0.00% 0.00% 0.00% 0.00% 0.00% 0.00% 0.00% 0.00% Legal Debt Margin Calculation for Fiscal Year 2023
Assessed value 19,213,312,687$
Add back: exempt real property 5,384,057,735
Total assessed value 24,597,370,422$
Debt limit (15% of total assessed value) 3,689,605,563$ Debt applicable to limit:

General obligation bonds 328,953,975
Less: assets in debt service funds for principal payments Revenue bonds - governmental activities (76,357,669)
Revenue bonds - business-type activities (252,596,306)
Tax allocation bonds-community development commission - Certificates of participation -
Total net debt applicable limit -
Legal debt margin 3,689,605,563$
Source: County of Ventura
Finance Department, City of Oxnard
665
City of Oxnard, California

SCHEDULE XIII
Pledged Revenue Coverage
Last Ten Fiscal Years
-212-
Fiscal Gross Less: Operating Net Available Debt Service Year Revenues *** Expenses Revenues Principal Interest*** Coverage 2014 53,964,322 35,057,157 18,907,165 3,858,359 10,838,887 1.29 2015 48,512,000 35,981,736 12,530,264 4,017,916 8,602,946 0.99 2016 47,725,068 36,729,222 10,995,846 4,144,638 8,371,561 0.88 2017 50,683,078 37,479,875 13,203,203 4,290,245 8,253,814 1.05 2018 62,750,295 37,781,641 24,968,654 4,474,671 8,960,800 1.86 2019 61,615,626 37,586,305 24,029,321 3,457,368 7,318,141 2.23 2020 61,222,220 39,746,165 21,476,055 4,726,028 7,036,758 1.83 2021 60,368,949 42,772,873 17,596,076 3,393,227 7,120,495 1.67 2022 57,841,672 44,167,359 13,674,313 3,551,317 7,469,013 1.24 2023 58,021,091 43,813,695 14,207,396 5,362,121 7,186,097 1.13 Fiscal Gross Less: Operating Net Av ailable Debt Serv ice Interest Year Revenues Expenses Revenues Principal Expense Coverage 2014 44,670,034 36,624,969 8,045,065 2,681,421 752,146 2.34 2015 43,578,972 35,911,447 7,667,525 2,813,015 254,592 2.50 2016 41,677,411 36,427,580 5,249,831 1,930,153 250,937 2.41 2017* - - - - - -
2018* - - - - - -
2019* - - - - - -
2020* - - - - - -
2021* - - - - - -
2022* - - - - - -
2023* - - - - - -
Note:

The City's bond obligations are secured by the pledge of net system revenues * There were no pledged revenues during this year
** Correction of previously reported amounts
***
Source: Finance Department, City of Oxnard
For Water Revenue Bonds, BAB subsidy is excluded from gross revenues and net against interest expense starting 2015
The above operating expenses do not include depreciation, debt service and infrastructure use fee payments
The above gross revenues include operating revenues (excluding connection fees) and investment Environmental Resources Revenue Bonds
Water Revenue Bonds**
666
City of Oxnard, California
SCHEDULE XIII (Continued)
Pledged Revenue Coverage
Last Ten Fiscal Years
-213-
Gross Less: Operating Net Available Debt Service Interest Fiscal Revenues Expenses Revenues Principal Expense Coverage Year 30,274,729 17,888,757 12,385,972 4,316,967 6,738,688 1.12 2014 31,973,678 20,731,227 11,242,451 4,193,581 6,586,349 1.04 2015 30,204,121 19,472,569 10,731,552 4,302,474 4,731,254 1.19 2016 37,100,396 18,374,360 18,726,036 4,353,176 4,643,123 2.08 2017 40,284,050 19,768,048 20,516,002 4,481,192 4,963,668 2.17 2018 43,701,872 16,722,471 26,979,401 4,433,905 4,293,796 3.09 2019 44,268,629 21,522,952 22,745,677 4,661,097 4,119,088 2.59 2020 48,284,979 21,738,622 26,546,357 4,795,000 4,636,250 2.81 2021 46,356,596 23,918,496 22,438,100 5,035,000 4,396,500 2.38 2022 47,264,371 23,620,616 23,643,755 5,285,000 4,144,750 2.51 2023 Gross Less: Operating Net Available Debt Service Fiscal Revenues Expenses Revenues Principal Interest Coverage Year 26,172,885 24,332,827 1,840,058 270,000 168,169 4.20 2014 23,119,454 22,346,820 772,634 280,000 160,170 1.76 2015 23,119,454 22,587,321 532,133 295,000 149,436 1.20 2016 26,476,702 25,300,241 1,176,461 310,000 132,968 2.66 2017 27,712,683 27,085,179 627,504 320,000 130,683 1.39 2018 27,767,016 26,848,409 ** 918,607 335,000 114,345 2.04 2019 29,554,251 29,171,840 382,411 335,000 97,905 0.88 2020 31,100,628 29,995,087 1,105,541 370,000 77,345 2.47 2021 29,752,261 28,735,630 1,016,631 390,000 59,164 2.26 2022 34,790,336 33,573,245 1,217,091 410,000 41,375 2.70 2023 Oxnard Housin
g Authori ty Revenue Bonds
Wastewater Revenue Bonds**
667
City of Oxnard, California

SCHEDULE XIV
Demographic and Economic Statistics
Last Ten Fiscal Years
-214-
(1) (2) (2) (2) (3) (4)
Fiscal Personal Per Capita Median School Unemployment
Year Population Income (in thous) Income Age Enrollment Rate 2014 203,645 4,063,329 19,953 30.3 39,418 8.6%
2015 206,148 4,112,210 20,210 30.5 39,266 5.8%
2016 206,997 4,166,242 20,127 30.7 39,425 6.2%
2017 207,772 4,149,665 19,972 30.8 41,338 5.6%
2018 206,499 4,320,613 20,923 31.4 39,461 5.1%
2019 209,879 4,603,746 21,935 31.7 39,578 4.8%
2020 206,352 4,756,228 23,049 32.1 39,525 7.7%*
2021 204,675 4,986,380 24,362 32.3 37,761 9.3%
2022 200,050 5,128,178 25,634 32.8 35,227 4.70%
2023 197,477 5,363,539 27,160 33.1 34,105 4.50%
Sources: (1) California Department of Finance, Demographic Research Unit. - Provided by HdL Coren & Cone (3) Oxnard School Districts (Elementary) and Oxnard Union High School District, Oxnard College (4) California Employment Development Department - Provided by HdL Coren & Cone * Calculated based on monthly unemployment data from California EDD for the fiscal year. The rate at the end of the fiscal year was 11.8%.
(2) Demographic and Economic Statistics for personal income and population data provided by HdL Coren & 668
City of Oxnard, California

SCHEDULE XV
Principal Employers
Current Year and Nine Years Ago
-215-
Employer
Reiter 3,728 3.82% DATA NOT AVAILABLE DATA NOT AVAILABLE Amazon 2,000 2.05% DATA NOT AVAILABLE DATA NOT AVAILABLE City of Oxnard 1,683 1.72% DATA NOT AVAILABLE DATA NOT AVAILABLE Oxnard Union High School 1,614 1.65% DATA NOT AVAILABLE DATA NOT AVAILABLE HAAS Automation 1,501 1.54% DATA NOT AVAILABLE DATA NOT AVAILABLE St. John's Regional Medical Center 1,413 1.45% DATA NOT AVAILABLE DATA NOT AVAILABLE Oxnard School District 934 0.96% DATA NOT AVAILABLE DATA NOT AVAILABLE ColourPop 581 0.59% DATA NOT AVAILABLE DATA NOT AVAILABLE Rio School District 599 0.61% DATA NOT AVAILABLE DATA NOT AVAILABLE Oxnard College 572 0.59% DATA NOT AVAILABLE DATA NOT AVAILABLE Subtotal 14,625 14.97%
Rest of Oxnard 78,775 80.62% DATA NOT AVAILABLE DATA NOT AVAILABLE Total 93,400 95.58% DATA NOT AVAILABLE DATA NOT AVAILABLE Source: EDD & Oxnard Businesses
Number of
Employees
Percent of Total
Employment Number of Employees Percent of Total
Employment
2023 2014
669
City of Oxnard, California

SCHEDULE XVI
Operating Indicators by Function
Last Ten Fiscal Years
-216-
Function 2014 2015 2016 2017 2018
Police
Physical arrests 6,169 7,388 7,063 6,641 6,495
Parking violations 25,130 26,033 32,288 32,273 25,663
Traffic violations 17,775 18,596 15,845 16,935 18,745
Fire
Number of calls answered 14,770 15,560 17,678 17,974 25,005 Inspections 3,588 3,030 2,296 1,463 3,710
Highways and streets
Potholes repaired 13,500 13,000 12,500 12,500 12,500
Sanitation
Total number of customers 44,677 44,944 45,266 45,537 45,773 Refuse collected (tons/day) 582 605 608 626 645
Recyclables collected (tons/day) 101 98 101 104 125
Culture and recreation
Community center admissions 22,980 35,857 28,896 26,343 26,196 Water
Total number of customers 41,319 41,437 41,635 42,301 42,041 Average daily consumption (gallons/day) 24,041,322 21,014,055 21,701,750 22,130,222 22,444,527 Wastewater
Total number of customers 38,971 39,210 39,374 39,580 39,735 Average daily sewerage treatment (gallons/day) 19,700,000 19,700,000 19,700,000 18,800,000 19,080,000 Source: Various departments, City of Oxnard
^ Includes total admissions for Palm Vista Senior Center which opened in 2019. ** Decrease due to staffing decrease and Covid-19 limitations ^^Senior Center Admissions - 34,096; Youth Centers Admissions - 16,866 * Starting fiscal year 2019, the City began using a new method calculating the number of potholes repaired. The new method is based on the total quantity of materials used for the year and average quantity of materials used per pothole. 670
City of Oxnard, California
SCHEDULE XVI (Continued)
Operating Indicators by Function
Last Ten Fiscal Years
-217-
2019 2020 2021 2022 2023 Function
Police
6,997 6,018 3,298 3,337 3,602 Physical arrests
36,159 21,709 14,221 29,848 42,762 Parking violations 17,804 14,231 11,025 15,743 10,216 Traffic violations Fire
28,528 30,391 27,424 26,331 22,334 Number of calls answered 3,107 1,817 4,866 3,128 3,300 Inspections
Highways and streets
2,000* 1,300** 1,400 596 4,499 Potholes repaired
Sanitation
46,043 46,576 35,218 39,040 37,113 Total number of customers 706 733 741 716 682 Refuse collected (tons/day)
131 144 154 157 172 Recyclables collected (tons/day)
Culture and recreation
40,760^ 34,707^^ 0^^ 63,917^^ 50,962 Community center admissions Water
42,122 42,804 42,958 43,069 43,127 Total number of customers 20,691,499 20,099,230 21,773,583 21,494,262 18,540,946 Average daily consumption Wastewater
39,808 39,962 40,177 38,650 40,291 Total number of customers 19,700,000 17,300,000 18,000,000 16,410,000 16,290,000 Average daily sewerage treatment 671
City of Oxnard, California

SCHEDULE XVII
Capital Assets by Function
Last Ten Fiscal Years
-218-
Function 2014 2015 2016 2017 2018
Public safety
Police
Stations 1 1 1 1 1
Police vehicles 268 311 233 236 236
Fire
Stations 7 8 8 8 8
Fire Trucks 16 17 17 17 17
Hydrants ^ 5,500 5,500 5,500 5,551 5,551
Sanitation
Collection trucks 51 50 52 52 50
Highways and streets
Streets (miles) 400 400 432 432 451
City-owned streetlights 974 972 980 1,025 1,025
SCE-owned streetlights ^^ 10,192 10,225 10,225 10,240 10,242 Culture and recreation
Parks acreage 550 555 561 561 561
Parks 58 59 62 61 61
Ball diamonds 37 37 22 27 29
Basketball courts 47 48 25 30 30
Craft/Activity buildings 10 10 2 2 2
Gymnasium 2 2 2 2 2
Swimming pools 1 1 1 1 1
Tennis courts 30 30 25 33 32
Community centers 3 3 2 3 3
Library
Number of books 325,906 318,644 316,646 333,016 366,051 Number of microfilms 8,729 8,729 5,885 8,323 7,822
Number of audiotapes 20,423 19,618 18,902 10,922 13,003 Number of videotapes 15,025 14,167 14,259 - -
Number of DVD * - - - 19,249 17,947
Number of CD-ROMS (data disk) 447 16 3,072 - -
Water
Water mains (miles) 600 600 600 624 624
Maximum daily treatment capacity 18,600,000 18,600,000 18,600,000 18,600,000 # 18,600,000 Sewer
Miles of sewer lines 430 430 430 430 430
Source: Various departments, City of Oxnard
^ Total includes only City-owned fire hydrants
* Transitioned from video tapes to DVD's
^^ Totals provided by Southern California Edison with accompanying location map for each light ** Decrease in Acreage due to expired contract with County of Ventura to maintain beach front areas ^^^ Decrease due to update to GIS system adjusting for mains owned by water districts previously listed as City owned *** Decrease due to abandoned sewer lines
672
City of Oxnard, California
SCHEDULE XVII (Continued)
Capital Assets by Function
Last Ten Fiscal Years
-219-
2019 2020 2021 2022 2023 Function
Public safety
Police
11 1 1 1 Stations
240 242 224 211 205 Police vehicles
Fire
88 8 8 8 Stations
17 17 17 3 17 Fire Trucks
5,676 5,678 5,690 6,279 5,782 Hydrants
Sanitation
56 56 52 57 71 Collection trucks
Highways and streets
452 484.5 400 455 439 Streets (miles)
1,025 1,025 972 607 607 City-owned streetlights
10,242 9,950 10,225 9,800 9,800 SCE-owned streetlights Culture and recreation
539 438** 438 438 438 Parks acreage
56 53 53 53 53 Parks
30 30 30 30 30 Ball diamonds
30 30 30 30 30 Basketball courts
22 2 2 2 Craft/Activity buildings
22 2 2 2 Gymnasium
11 1 1 1 Swimming pools
32 32 32 32 32 Tennis courts
33 3 3 3 Community centers
Library
411,482 334,016 331,204 271,862 307,003 Number of books 8,377 8,377 21,700 41,947 41,947 Number of microfilms 20,528 8,996 8,634 8,271 7,886 Number of audiobooks
-- 1 345 0 50 Number of videotapes
21,162 17,522 17,009 16,358 16,337 Number of DVD
-- 1 11 1 11 200 Number of CD-ROMS (data disk)
Water
563^^^ 563 525 527 531 Water mains (miles)
18,600,000 18,600,000 18,600,000 18,600,000 18,600,000 Maximum daily treatment capacity Sewer
430 405*** 406 406 406 Miles of sewer lines
673
City of Oxnard, California

SCHEDULE XVIII
Full-Time Equivalent City Government Employees by Function Last Ten Fiscal Years
-220-
Function 2014 2015 2016 2017 2018 2019 2020 2021 2022 2023 General government 230 230 228 224 288 279 250.5 253.4 302 295 Public Safety
Police
Officers 249 252 243 252 268 258 258 274 271 240
Civilians 159 157 151 110 114 117 115 84 87 122
Fire
Firefighters & officers 110 125 125 125 150 123 124 123 121 144 Civilians 3 3 3 3 4 8 7 10 13 18
Transportation 44 43 25 16 27 39 39 23.5 10 32
Community development 58 59 50 52 57 58 62 62 63 66
Culture, Leisure, and Libraries 83 81 67 55 95 92.5 79 79.3 108 121 Utilities
Water 50 50 52 53 56 52 60 76.3 78 80
Wastewater 79 80 81 81 74 73 73.5 76.8 79 92
Environmental Resources 80 118 113 118 175 172 173 195 199 197 H o u s i n g 8 2 8 1 8 0 8 1 7 07 17 17 1 6 9 6 5
Total 1,226 1,278 1,218 1,171 1,378 1,342.5 1,312 1,328.3 1400 1472 Note: The numbers abov e represent authorized positions by the City Council.

Source: Per. Adopted Budget Budget Personnel Schedule for FY2022-23 Rev ised FTE Count 674
JUNE 30, 2023

AUDIT REPORT FOR FYE
City Council Meeting | March 19, 2024
675
City Council Meeting | March 19, 2024 | Page 1
AGENDA
Independent Auditor’s Opinion ……………..………………………………………. 2 Significant Audit Matters ………….………………………………………………... 3 ACFR Highlights ………………………………...……..……………....................... 7 Revenues – General Fund Group ……………..………………………………...... 13 Expenditures – General Fund Group ....…………..………………………………. 14 Budget vs Actual – General Fund Group ....………….…………………………... 15 1 676
INDEPENDENT AUDITOR’S OPINION
City Council Meeting | March 19, 2024 | Page 2
677
City Council Meeting | March 19, 2024 | Page 3
SIGNIFICANT AUDIT MATTERS*
▪ Significant Accounting Policies
▪ GASB 96, Subscription-based
Information Technology
Arrangements (SBITA)
▪ In FY 2022, GASB 87, Leases
▪ Significant Accounting Estimates
▪ Allowances for doubtful accounts
▪ Pension & OPEB
▪ Self-insurance claims payable
▪ Depreciation expense and
accumulated depreciation
* Refer to Eadie and Payne letter to City Council dated February 23, 2024 678
City Council Meeting | March 19, 2024 | Page 4
* Refer to Eadie and Payne letter to City Council dated February 23, 2024 SIGNIFICANT AUDIT MATTERS*
▪ Significant Disclosures
▪ Cash and investments (Note II.A.)
▪ Long-term debt (Note II.H.)
▪ Deficit fund balances (Note II.K.)
▪ Prior period adjustments (Note II.L.)
▪ Pension & OPEB related (Note III.)
▪ Commitments & contingencies (Note V.A.)
▪ Risks & uncertainties (Note V.B.)
679
City Council Meeting | March 19, 2024 | Page 5
* Refer to Eadie and Payne letter to City Council dated February 23, 2024 SIGNIFICANT AUDIT MATTERS*
▪ Audit Adjustments
▪ Ventura County Investment Pool: adjustment for accrued interest and fair value adjustment by $943,000 across all City funds.
▪ ISF Intangible assets, net of accumulated amortization, and related subscription liability:
increase by $1.0 million and $0.9 million respectively. ▪ Prior period adjustment for pension and OPEB: increase governmental activities net position by $14.5 million, decreased business-type activities net position by $3.5 million for water fund, $1.7 million for waste water fund, $9.3 million for environmental resources fund. ▪ OPEB and pension balances for FY 2023: net decrease by $5.5 million. ▪ Prior period adjustment for deferred revenue not posted in FY 2021 : decrease governmental activities net position by $6.9 million.
680
City Council Meeting | March 19, 2024 | Page 6
* Refer to Eadie and Payne letter to City Council dated February 23, 2024 SIGNIFICANT AUDIT MATTERS*
▪ Significant risks
▪ Challenges encountered during audit
▪ ERP implementation
▪ No disagreements with management
▪ Internal control report – tentative end of March 2024 681
City Council Meeting | March 19, 2024 | Page 7
ACFR HIGHLIGHTS Net Position ($ millions)
Assets and
Deferred Outflows,
$3,305 , 50%
Liabilities and
Deferred
Inflows,
$956 , 14%
Net Position,
$2,349 , 36%
Assets and
Deferred
Outflows, $3,202
, 50%
Liabilities and
Deferred Inflows,
$893 , 14%
Net Position,
$2,309 , 36%
2023 2022
682
City Council Meeting | March 19, 2024 | Page 8
ACFR HIGHLIGHTS Revenues ($ millions)
$-
$50
$100
$150
$200
$250
Charges for Services Operating Grants and
Contributions
Capital Grants Taxes Other
2023 2022
$194
$187
$75 $71
$3 $10
$226
$214
$4
$2
683
City Council Meeting | March 19, 2024 | Page 9
ACFR HIGHLIGHTS Expenses ($ millions)
$-
$20
$40
$60
$80
$100
$120
$140
$26
$133
$59
$10
$17
$10 $4
$64
$37
$50
$6
$34
$15
$121
$59
$13 $17
$7 $4
$67
$36
$47
$5
$28
2023 2022
684
City Council Meeting | March 19, 2024 | Page 10
Revenues and Expenses Business-Type Activities ($ millions) $-
$10.0
$20.0
$30.0
$40.0
$50.0
$60.0
Water Wastewater Environmental Resources Golf Course Oxnard Housing Authority
$52.9
$45.6 $45.7
$6.3
$33.8
$57.1
$33.8
$51.7
$5.7
$34.4
Program Revenue Expenses

ACFR HIGHLIGHTS
685
City Council Meeting | March 19, 2024 | Page 11
ACFR HIGHLIGHTS Governmental Funds Fund Balance ($ millions) 2023 – Total $206 2022 – Total $189
Restricted, $114 ,
55%
Committed, $45 ,
22%
Assigned, $28 ,
14%
Unassigned, $19 ,
9%
Nonspendable, $4 ,
2%
Restricted, $109 ,
58%
Committed, $50 ,
26%
Unassigned, $26 ,
14%
686
City Council Meeting | March 19, 2024 | Page 12
ACFR HIGHLIGHTS General Fund Group ($ millions)
Revenues & Expenditures/Other Financing Sources (Uses)
$-
$50
$100
$150
$200
$250
2023 2022
$241
$221
$207
$183
Revenues Expenditures/Other Financing Sources (Uses)
687
City Council Meeting | March 19, 2024 | Page 13
REVENUES General Fund Group ($ millions)
$68
$129
$18
$12 $14
$63
$118
$17 $16
$7
$-
$20
$40
$60
$80
$100
$120
$140
Property Taxes Sales Tax Other Taxes Charges for Services All Other Categories 2023 2022
Total Revenues
2023 - 241
2022 - 221
688
City Council Meeting | March 19, 2024 | Page 14
EXPENDITURES General Fund Group ($ millions)
Total Expenditures
2023 - $191
2022 - $171
$22
$111
$26
$12 $13
$4 $3
$18
$102
$25
$11 $11
$2 $2
$-
$20
$40
$60
$80
$100
$120
General Government Public Safety Public Works Community Development
Culture, Leisure and
Libraries
Housing Capital Outlay & Debt
Service
2023 2022
689
City Council Meeting | March 19, 2024 | Page 15
BUDGET VS ACTUAL General Fund Group ($ millions)
$67
$114
$17
$13 $16
$68
$129
$18
$12 $14
$-
$20
$40
$60
$80
$100
$120
$140
Property
Taxes
Sales Tax Other Taxes Charges for
Services
All Other
Categories
Budget Actual
Revenues
$24
$109
$31
$15 $15
$7 $5
$22
$111
$26
$12 $13
$4 $3
$-
$20
$40
$60
$80
$100
$120
General
Government
Public Safety Public Works Community
Development
Culture, Leisure
and Library
Services
Housing Capital Outlay
& Debt Service
Budget Actual
Expenditures
690

THANK YOU
Eden C. Casareno
[email protected]
909.809.7662
691

CITY COUNCIL AGENDA REPORT

REPORTS
AGENDA ITEM NO. N.2

DATE: March 19, 2024

TO: City Council

FROM: Michael Wolfe, Public Works Director, (805) 385-8055, [email protected]

SUBJECT: General Fund Reimbursement of Service Charges to Special Districts. (10 minutes)

RECOMMENDATION

That the City Council approve and authorize the City Manager to approve a transfer in the amount of $168,247.67 for reimbursement of sidewalk service charges, including interest, to 21 Landscape Maintenance Districts (Fund 120) from the General Fund (101), with the corresponding budget appropriation adjustments.

(Public Works and Transportation Committee approved 3-0 on February 27, 2024.)

Please click the following link to view the required Measure M pre-recorded presentation video: https://youtu.be/Ne_CcN3B1IU

BACKGROUND

The Special Districts Division (“Division”) of the Public Works Department is responsible for the maintenance, operation, and administration of the City’s 50 Special Districts, including bonded and non-bonded Community Facilities Districts (“CFDs”), Landscape Maintenance Districts (“LMDs”), Waterways Maintenance Assessment Districts (“WADs”), and a Maintenance Assessment District (“MAD-4”). Each of these Special Districts has specific individual authorized services and improvements, including, but not limited to: park landscapes, open spaces, parkways, medians, other public improvements, and recreation and park amenities such as picnic shelters, restrooms, arbors, and fountains.

Properties within each District are assessed an annual parcel charge for the purposes of maintaining the improvements and other authorized services within their District.

At the end of 2017, the Streets Division implemented a concrete grinding program to preserve and improve City infrastructure. On August 15, 2019, the City issued a Request for Proposal for a three-year on-call sidewalk, curb, gutter, and concrete grinding service. The City contracted with BPR, Inc. (“BPR”) for these services. The contract required BPR to provide a job report that identifies the street names and the locations where the work has been performed. City staff was responsible for inspecting the contractor's work and then processing the invoices for the completed work. There are several districts that contain both sidewalks that are identified as authorized improvements and sidewalks that are not identified as authorized improvements within the borders of the district, pursuant to the City Council-approved Consolidated Engineer’s Report. For example, LMD-28 is only responsible for the sidewalk maintenance along Bahia Dr between Gonzales Rd and Grande St, Entrada Dr between Gonzales Rd and Caliente Wy, and the southside of Caliente Wy between Bahia Dr and Corto. All other sidewalks within the boundaries of LMD-28, as identified in the Consolidated Engineer’s Report, are maintained by the Streets Division, using non-assessment funding.

In September 2023, a resident brought to the Division’s attention that there may have been charges for sidewalk displacement grinding services in LMD-28 that were charged to the LMD instead of charged to non-assessment funding.

After reviewing the completed sidewalk maintenance records for LMD-28, the inaccurate charges were confirmed by Special District staff. Thereafter, staff began reviewing the sidewalk maintenance records for all of the other districts.

This resulted in a confirmation of inaccurate maintenance charges to twenty additional LMDs for sidewalk maintenance 692
that should have been charged to non-assessment funds.

It should be noted that out of an abundance of caution, staff from the City Manager’s office, as an independent reviewer from the Special Districts staff, has been asked to do a review of all of the authorized services and improvements for any similar inaccuracies that may have occurred in each district during the past six fiscal years. A separate staff report of this review will be provided to the City Council with recommended adjustments, including earned interest calculated by the Finance Department.

DISCUSSION

Special Districts staff has completed the review of each LMDs authorized sidewalk services and improvements. The following Landscape Maintenance Districts have authorized sidewalk improvements:

LMD-27 (Rose Island) LMD-42 (Cantabria / Coronado)
LMD-28 (Harborside) LMD-43 (Greenbelt)
LMD-30 (Haas Automation) LMD-46 (Daily Ranch)
LMD-31 (Rancho De La Rosa) LMD-47 (Sycamore Place)
LMD-32 (Oak Park) LMD-49 (Cameron Ranch)
LMD-33 (El Paseo) LMD-50 (PV Senior Housing)
LMD-34 (Sunrise Point / Sunset Cove) LMD-51 (Pfeiler)
LMD-36 (Villa Santa Cruz / Villa Carmel) LMD-52 (Wingfield) LMD-37 (Pacific Breeze) LMD-53 (Huff Court)
LMD-38 (Aldea Del Mar) LMD-54 (Meadow Crest)
LMD-39 (El Sueno Promesa) LMD-55 (Wingfield West)
LMD-39 (DR Horton) LMD-58 (Westwind)
LMD-40 (Cantada) LMD-60 (Artisan)
LMD-41 (Pacific Cove)

Staff reviewed the invoices and job reports for sidewalk work that was performed from FY 2017-18 through FY 2021-22.

There were no contractor-provided sidewalk services before 2017 or after 2022 for the Special Districts Division. Staff then cross-referenced the LMDs' authorized service locations against the locations where these services were provided. A total of 17 invoices that identified 7,850 locations were reviewed. A large majority of these locations were outside of the LMDs authorized service locations, but were still within the LMD boundaries. In LMDs 30, 31, 41, 49, 50, and 55, there were no findings of unauthorized service charges that would necessitate reimbursement.

The Special Districts staff members who processed a majority of the invoices for the sidewalk services from FY 2019-20 through FY 2021-22, are no longer employed with the City. Therefore, the current staff are unable to verify the processes and quality control that were used during the time frame of the charges. Therefore, out of an abundance of caution, an additional review of past services is underway to identify any inaccurate service charges that are not consistent with the consolidated Engineer’s Report. Upon completion of the audit for all of these services that were provided for each district, the Special Districts Division will submit a separate staff report to the City Council that includes all findings and any recommended corrective actions.

693
The recommended corrective action for the sidewalk maintenance charges for the LMDs is a reimbursement, with earned interest, for 21 LMDs in the total amount of $168,247.67 for sidewalk service charges that were performed outside of the Districts’ responsibility.

STRATEGIC PRIORITIES

This agenda item is a routine operational item or does not relate to the five strategic priorities adopted by City Council on March 16, 2021.

FINANCIAL IMPACT

The total cost of this reimbursement is $168,247.67, which includes the reimbursement of the service charges, plus earned interest. The reimbursement will come from anticipated General Fund salary savings in the Public Works Department, to be transferred into each assessment District’s fund. Details of the reimbursement and interest are included in Attachment 3 and detailed below. Depending on FY 23/24 actual expenditures, the reimbursement may also come from any unspent operating budget in the Streets Division, which has Measure O assigned for sidewalk repairs (this option was added to the staff report after this item was discussed at the PWTC meeting on 2/27/24).

The interest reimbursement adjustment was calculated taking into consideration the date that the payment was posted to the general ledger and to adjust the average cash balance for each district. Using the updated average cash balance, the interest allocation was recalculated for each district. The difference between the revised interest allocation and the original interest allocation is the proposed interest reimbursement.

Each District will receive the reimbursement in their individual reserve accounts and these reimbursements will also be identified in the Consolidated Engineer’s Report as part of the FY 2024-25 budget process.

COMMITTEE OUTCOME

694
The Public Works and Transportation Committee approved 3-0 on February 27, 2024 to approve the staff recommendation and to forward the item for Council approval.

Prepared by: Steve Howlett, Assistant Public Works Director, Eric Storrie, Special Districts Manager, Javier Chagoyen- Lazaro, Chief Financial Officer

ATTACHMENTS

1. City of Oxnard Special Districts Map

2. City of Oxnard Special Districts List

3. Reimbursement Breakdown Per Special District

4. Presentation

695
4 9
5 34
7 8
1 2
3 & 4
1 &
2 03
30 14
12 36
43 28
38 31
46 39
13 25
51 52
10 16
47 37
34 42
24 58
41 23
33 11
40 60
27 55
50 4954
32 53
This map is compiled by the City of Oxnard GIS Division, which is developed and operated solely for the convenience of the City. The City does not make any representations or warranties regarding the use, accuracy, reliability, and/or completeness of this map and no decision involving a risk of economic loss or physical injury should be made in reliance thereon. µ Maintenance Assessment District (District No.)
Waterway Assessment District (Zone No.)
Community Facilities District (District No.)
Landscape Maintenance District (District No.)

CITY OF OXNARD SPECIAL DISTRICTS
3,000 0 3,000 6,000
Feet
Created by:

Geographic Information Systems Division
March 2023
Data Source:

City of Oxnard GIS Division
County of Ventura GIS Program
696
1 & 2 – Westport at Mandalay Bay 7 – Wagon Wheel
3 & 4 – Seabridge at Mandalay Bay 8 – Sakioka Farms
5 – Riverpark 9 – Northshore at Mandalay Bay
3 – Riverridge 37 – Pacific Cove
10 – Country Club 38 – Aldea Del Mar
11 – St Tropez 39 – El Sueno Promesa
12 – Standard Pacific 40 – Cantada
13 – Le Village 41 – Pacific Cove
14 – California Cove 42 – Cantabria/Coronado
16 – California Lighthouse 43 – Greenbelt
23 – Greystone 46 – Daily Ranch
24 – Vineyards 47 – Sycamore Place
25 – The Pointe 49 – Cameron Ranch
27 – Rose Island 50 – PV Senior Housing
28 – Harborside 51 – Pfeiler
30 – Haas Automation 52 – Wingfield
31 – Rancho De La Rosa 53 – Huff Court
32 – Oak Park 54 – Meadowcrest
33 – El Paseo 55 – Wingfield West
34 – Sunrise Pt/Sunset Cove 58 – Westwind
36 – Villa Santa Cruz 60 – Artisan
Zone 1 – Mandalay Bay Zone 2 – Harbour Island

MAINTENANCE ASSESSMENT DISTRICT

WATERWAYS ASSESSEMENT DISTRICTS
4 – Mandalay Beach/Colony

LANDSCAPE MAINTENANCE DISTRICTS
CITY OF OXNARD – SPECIAL DISTRICTS
LANDSCAPE MAINTENANCE DISTRICT * COMMUNITY FACILITIES DISTRICTS WATERWAYS ASSESSMENT DISTRICTS * MAINTENANCE ASSESSMENT DISTRICTS

COMMUNITY FACILITIES DISTRICTS
697
General Fund Reimbursement to LMDs for Sidewalk Charges, Plus Interest Fund District Service Charges Reimbursement Interest Reimbursement Total Reimbursement TOTAL $ 163,415.00 $ 4,832.67 $ 168,247.67
22703801 LMD 27 $ 2,499.00 $ 65.55 $ 2,564.55
22803801 LMD 28 $ 12,985.00 $ 411.84 $ 13,396.84
23203801 LMD 32 $ 3,846.50 $ 128.32 $ 3,974.82
23303801 LMD 33 $ 4,679.50 $ 153.16 $ 4,832.66
23403801 LMD 34 $ 10,020.50 $ 377.89 $ 10,398.39
23603801 LMD 36 $ 19,600.00 $ 624.53 $ 20,224.53
23703801 LMD 37 $ 2,499.00 $ 65.58 $ 2,564.58
23803801 LMD 38 $ 20,531.00 $ 651.54 $ 21,182.54
23903801 LMD 39 - ESP $ 3,315.71 $ 125.03 $ 3,440.74
23913801 LMD 39 - DR $ 1,143.29 $ 43.12 $ 1,186.41
24003801 LMD 40 $ 10,780.00 $ 366.63 $ 11,146.63
24203801 LMD 42 $ 17,983.00 $ 631.26 $ 18,614.26
24303801 LMD 43 $ 12,250.00 $ 457.39 $ 12,707.39
24603801 LMD 46 $ 6,002.50 $ 11.35 $ 6,013.85
24703801 LMD 47 $ 2,205.00 $ 16.24 $ 2,221.24
25103801 LMD 51 $ 14,945.00 $ 346.95 $ 15,291.95
25203801 LMD 52 $ 11,441.50 $ 214.06 $ 11,655.56
25303801 LMD 53 $ 980.00 $ 22.96 $ 1,002.96
25403801 LMD 54 $ 1,494.50 $ 33.91 $ 1,528.41
25803801 LMD 58 $ 2,499.00 $ 28.33 $ 2,527.33
26003801 LMD 60 $ 1,715.00 $ 57.03 $ 1,772.03
698
General Fund Reimbursement of Service
Charges to Special Districts
Public Works & Transportation Committee, February 27, 2024 City Council, March 19, 2024
Eric L. Storrie
Special Districts Manager
699
That the Public Works and Transportation Committee
recommend that the City Council approve and authorize the City Manager to approve a transfer in the amount of
$168,247.67 for reimbursement of sidewalk service charges, including interest, to 21 Landscape Maintenance Districts (Fund 120) from the General Fund (101), with the
corresponding budget appropriation adjustments.

RECOMMENDATION 2
700
That the City Council approve and authorize the City Manager to approve a transfer in the amount of $168,247.67 for
reimbursement of sidewalk service charges, including interest, to 21 Landscape Maintenance Districts (Fund 120) from the General Fund (101), with the corresponding budget
appropriation adjustments.

RECOMMENDATION 3
701
MAP OF SPECIAL DISTRICTS IN THE CITY OF OXNARD 4
More information can be
found at:
oxnard.org/specialdistricts
702
• The Special Districts Division of the Public Works
Department is responsible for the maintenance, operation, and administration of the City’s 50 Special Districts, including bonded and non-bonded Community Facilities Districts,
Landscape Maintenance Districts, Waterways Maintenance
Assessment Districts, and a Maintenance Assessment
District.
• Each of these Special Districts have specific individual authorized services and improvements, including but not limited to: park landscapes, open spaces, parkways,
medians, other public improvements, and recreation and
park amenities such as picnic shelters, restrooms, arbors, and fountains.

BACKGROUND 5
703
• Properties within each District are assessed an annual parcel charge for the purposes of maintaining the
improvements and other authorized services within their District.
• At the end of 2017, the Streets Division implemented a concrete grinding program to preserve and improve City
infrastructure.
• On August 15, 2019, the City issued a Request for Proposal for a three-year on-call sidewalk, curb, gutter, and concrete grinding service.
• The City contracted with BPR, Inc. for these services.

BACKGROUND 6
704
• The contract required BPR to provide a job report that identifies the street names and the locations where the work has been performed.
• City staff was responsible for inspecting the contractor's work and then processing the invoices for the completed work.
• There are several districts that contain both sidewalks that are identified as authorized improvements and sidewalks that are not identified as authorized improvements within the borders of the district, pursuant to the City Council-approved Consolidated Engineer’s Report.
7BACKGROUND
705
• For example, LMD-28 is only responsible for the sidewalk maintenance along Bahia Dr between Gonzales Rd and
Grande St, Entrada Dr between Gonzales Rd and Caliente
Wy, and the southside of Caliente Wy between Bahia Dr and Corto.
• All other sidewalks within the boundaries of LMD-28, as identified in the Consolidated Engineer’s Report, are
maintained by the Streets Division, using non-assessment funding.
8BACKGROUND
706
• In September 2023, a resident brought to the Division’s attention that there may have been charges for sidewalk displacement grinding services in LMD-28 that were charged to the LMD instead of charged to non-assessment funding. • After reviewing the completed sidewalk maintenance records for LMD-28, the inaccurate charges were confirmed by
Special District staff.
• Thereafter, staff began reviewing the sidewalk maintenance records for all of the other districts.
9BACKGROUND
707
• This resulted in a confirmation of inaccurate maintenance charges to twenty additional LMDs for sidewalk maintenance that should have been charged to non-assessment funds.
• It should be noted that out of an abundance of caution, staff from the City Manager’s office, as an independent reviewer from the Special Districts staff, has been asked to do a review of all of the authorized services and improvements for any similar inaccuracies that may have occurred in each district during the past six fiscal years.
• A separate staff report of this review will be provided to the City Council with recommended adjustments, including
earned interest calculated by the Finance Department.
10BACKGROUND
708
• Special Districts staff has completed the review of each LMDs authorized sidewalk services and improvements.

• The following Landscape Maintenance Districts have
authorized sidewalk improvements:

DISCUSSION 11
709
• Staff reviewed the invoices and job reports for sidewalk work that was performed from FY 2017-18 through FY 2021-22

• There were no contractor-provided sidewalk services before 2017 or after 2022 for the Special Districts Division.
• Staff then cross-referenced the LMDs' authorized service locations against the locations where these services were provided.
• A total of 17 invoices that identified 7,850 locations were reviewed.

DISCUSSION 12
710
• A large majority of these locations were outside of the LMDs authorized service locations, but were still within the LMD boundaries.
• In LMDs 30, 31, 41, 49, 50, and 55, there were no findings of unauthorized service charges that would necessitate
reimbursement.
• The Special Districts staff members, who processed a
majority of the invoices for the sidewalk services from FY 2019-20 through FY 2021-22, are no longer employed with the City.

DISCUSSION 13
711
• Therefore, the current staff are unable to verify the processes and quality control that were used during the time frame of the charges.
• Therefore, out of an abundance of caution, an additional review of past services is underway to identify any
inaccurate service charges that are not consistent with the consolidated Engineer’s Report.
• Upon completion of the audit for all of these services that were provided for each district, the Special Districts Division will submit a separate staff report to the City Council that includes all findings and any recommended corrective
actions.

DISCUSSION 14
712
• The recommended corrective action for the sidewalk
maintenance charges for the LMDs is a reimbursement, with earned interest, for 21 LMDs in the total amount of
$168,247.67 for sidewalk service charges that were
performed outside of the Districts’ responsibility.

DISCUSSION 15
713
• The total cost of this reimbursement is $168,247.67, which includes the reimbursement of the service charges, plus earned interest.
• The reimbursement will come from anticipated General Fund salary savings in the Public Works Department, to be
transferred into each assessment District’s fund.
• Depending on FY 23/24 actual expenditures, the
reimbursement may also come from any unspent operating
budget in the Streets Division, which has Measure O
assigned for sidewalk repairs (this option was added to the staff report after this item was discussed at the PWTC
meeting on 2/27/24).

FINANCIAL IMPACT 16
714
• The interest reimbursement adjustment was calculated
taking into consideration the date that the payment was posted to the general ledger to adjust the average cash balance for each district.
• Using the updated average cash balance, the interest
allocation was recalculated for each district.
• The difference between the revised interest allocation and the original interest allocation is the proposed interest reimbursement.

FINANCIAL IMPACT 17
715
• Each District will receive the reimbursement in their individual reserve accounts and these reimbursements will also be identified in the Consolidated Engineer’s Report as part of the FY 2024-25 budget process.

FINANCIAL IMPACT 18
716

QUESTIONS
19 717

CITY COUNCIL AGENDA REPORT

REPORTS
AGENDA ITEM NO. N.3

DATE: March 19, 2024

TO: City Council

FROM: Michael Wolfe, Public Works Director, (805) 385-8055, [email protected]

SUBJECT: Purchase Order to McLaughlin Waste Equipment, Inc. for Metal Refuse Containers for the Environmental Resources Division. (10 minutes)

RECOMMENDATION

That the City Council authorize the Mayor to execute a Purchase Order with McLaughlin Waste Equipment, Inc. for an amount not to exceed $2,500,000 for a three-year term ending June 30, 2027, for metal refuse containers.

(Public Works and Transportation Committee approved 3-0 on February 27, 2024)

Please click the following link to view the required Measure M pre-recorded presentation video: https://youtu.be/8vzd7gs0j7Y

BACKGROUND

The City of Oxnard Environmental Resources Division (ER) provides commercial refuse and recycling services to businesses and multi-family units throughout the City of Oxnard. The State of California Assembly Bill 341 (AB341), Assembly Bill 1826 (AB1826), and Senate Bill 1383 (SB1383) mandate that businesses and multi-family (units of five 5 or more) that generate more than four cubic yards of refuse per week must participate in recycling and organics services.

To provide weekly uninterrupted refuse and recycling collection to approximately 16,500 commercial and multi-family dwelling units serviced with approximately 10,500 metal containers, a sufficient inventory of containers must be maintained for container exchanges requested by the customer due for repair or replacement. Additionally, metal containers are needed to complete residential customer orders for special collections of bulky items, construction and demolition projects, and commercial and multi-family developments.

Each year the ER provides an annual operating budget for container repair parts and replacement. Containers that cannot be repaired are replaced and sold for scrap value. Planned replacement varies from year to year depending on the inventory of container types and sizes, customer usage and demand, commercial development, and economic growth.

DISCUSSION

The purchase of new metal refuse containers will allow for the replacement of aged refuse containers beyond repair, and maintain efficient customer service. ER plans to purchase various containers as follows:

CONTAINER
TYPE
QTY
1-cubic yard 80
718
2-cubic yard 30
3-cubic yard 40
4-cubic yard 30
10-cubic yard 5
10-cubic yard
w/radius bottom
5 13.4-cubic yard 5
20-cubic yard 5
30-cubic yard 5
40-cubic yard 5

On November 17, 2023, the City’s Purchasing Division issued a Request for Bid (RFB) ER 24-37 to solicit bids for metal refuse containers. The bid document was posted on the City’s website and PublicPurchase.com, a website where the City’s solicitations are publicly posted. A total of 19 vendors received the bid notification via the www.publicpurchase.com website.

Among the bids received, McLaughlin Waste Equipment (McLaughlin) provided the only qualified bid response before the deadline of December 14, 2023. City staff has confirmed that McLaughlin meets all required City contractual provisions, including possession of a City business tax certificate, insurance certificates and corporate filing with the California Secretary of State. Based upon the available information and research performed to date, staff believes that McLaughlin is capable of satisfactorily providing these goods. Thus, staff recommends that the City Council award this Purchase Order to McLaughlin.

McLaughlin will supply containers within 30 days after receipt of the order. The pricing offered by McLaughlin includes the cost of shipping.

STRATEGIC PRIORITIES

This agenda item supports the Infrastructure and Natural Resources strategy. The purpose of the Infrastructure and Natural Resources strategy is to preserve and improve our roads, utilities, parks, trees, water supply and natural resources through effective planning, prioritization, and an equitable and efficient use of available funding.

FINANCIAL IMPACT

The total cost of the purchase order with McLaughlin Waste Equipment will not exceed $2,500,000 for three years. The estimated spending plan for FY 2024-25 is $520,000 and will be requested in the Environmental Resources Enterprise Fund (631) Proposed Budget during the budget process. The funding for subsequent fiscal years will be requested during the annual budget process.

Estimated Spending Plan
Program – Fund Account
Number
FY
2024-25
FY
2025-26
FY
2026-27
TOTAL
719
Environmental Resources
Operating Fund – Commercial
Collection
6313633-
52400 $235,000 $255,000 $285,000 $766,298
Environmental Resources
Operating Fund – Industrial
Collection
6313634-
56040

$285,000 $315,000 $345,000 $939,825
SUBTOTAL $520,000 $570,000 $630,000 $1,720,000
As-needed Inventory Control
(Damaged, Fire, Useful life) Various $260,000 $260,000 $260,000 $780,000 TOTAL $780,000 $830,000 $890,000 $2,500,000

COMMITTEE OUTCOME

The Public Works and Transportation Committee approved 3-0 on February 27, 2024 to approve the staff recommendation and to forward the item for Council approval.

Prepared by: Brian Yanez, Assistant Public Works Director, Eric Zetz, Division Manager

ATTACHMENTS

1. Mclaughlin Rate Sheet

2. Presentation

720
McLaughlin Waste Equipment, Inc.

RATE SHEET
Metal Refuse 1.0 1.5-yard, 2-yard, 3-yard and 4-yard containers Item No. 1

1.0 Cubic Yard Front Loader Flat Top w/12 Gauge Bottom Single Wall with Dura Flex Plastic Lid. Refuse Gray Color, Recycle Blue Color, Green Waste Green Color or Organic Waste Brown Color or any other color as requested by the City.

Front Height Back Height Width Length
28” 24” 72”
Quantity 1 – 399 (1st Tier) 400 – 699 (2nd Tier) 700 – 1,000 (3rd Tier) Unit Cost without Polyurea
Coating $ 761 $ 761 $ 761
Item No. 1a
Same specification as Item No. 1 but includes polyurea coating on inside walls and bottom of container for organic and liquid waste containment
Unit Cost with Polyurea
Coating $ 1,111 $ 1,111 $ 1,111
Other Costs such as Delivery and Handling Fee (List):

All included above
Item No. 2

1.5 Cubic Yard Front Loader Pitch Top w/12 Gauge Bottom Single Wall with Dura Flex Plastic Lid. Refuse Gray Color, Recycle Blue Color, Green Waste Green Color or Organic Waste Brown Color or any other color as requested by the City.

Front Height Back Height Width Length

29.5” 34.5” 29.5” 72”
Quantity 1 – 399 (1st Tier) 400 – 699 (2nd Tier) 700 – 1,000 (3rd Tier) Unit Cost without Polyurea
Coating $ 781 $ 781 $ 781
Item No. 2a
Same specification as Item No. 2 but includes polyurea coating on inside walls and bottom of container for organic and liquid waste containment
Unit Cost with Polyurea
Coating $ 1,149 $ 1,149 $ 1,149
Other Costs such as Delivery and Handling Fee (List):

All included above
28”
28"
721
McLaughlin Waste Equipment, Inc.

RATE SHEET
Item No. 3
2 Cubic Yard Front Loader Pitch Top w/12 Gauge Bottom Single Wall with Dura Flex Plastic Lid. Refuse Gray Color, Recycle Blue Color, Green Waste Green Color or Organic Waste Brown Color or any other color as requested by the City.

Front Height Back Height Width Length
42” 54” 34.5” 81”
Quantity 1 – 399 (1st Tier) 400 – 699 (2nd Tier) 700 – 1,000 (3rd Tier) Unit Cost without
Polyurea Coating $ 864 $ 864 $ 864
Item No. 3a
I
tem No. 4
3 Cubic Yard Front Loader Pitch Top w/12 Gauge Bottom Single Wall with Dura Flex Plastic Lid. Refuse Gray Color, Recycle Blue Color, Green Waste Green Color or Organic Waste Brown Color or any other color as requested by the City.

Front Height Back Height Width Length

41.5” 50.5” 41.5” 72”
Quantity 1 – 399 (1st Tier) 400 – 699 (2nd Tier) 700 – 1,000 (3rd Tier) Unit Cost without
Polyurea Coating $ 972 $ 972 $ 972
Item No. 4a
Same specifications as Item No. 4 but includes polyurea coating on inside walls of container for organic and liquid waste containment
Unit Cost with Polyurea
Coating $ 1,399 $ 1,399 $ 1,399
Other Costs such as Delivery and Handling Fee (List):

All included above
Same specifications as Item No. 3 but includes polyurea coating on inside walls and bottom of container for organic and liquid waste containment
Unit Cost with Polyurea
Coating $ 1,269 $ 1,269 $ 1,269
Other Costs such as Delivery and Handling Fee (List):

All included above
722
McLaughlin Waste Equipment, Inc.

RATE SHEET

Item No. 5
4 Cubic Yard Front Loader Pitch Top w/12 Gauge Bottom Single Wall with Dura Flex Plastic Lid. Refuse Gray Color, Recycle Blue Color, Green Waste Green Color or Organic Waste Brown Color or any other color as requested by the City.

Front Height Back Height Width Length
54” 66” 50.5” 81”
Quantity 1 – 399 (1st Tier) 400 – 699 (2nd Tier) 700 – 1,000 (3rd Tier) Unit Cost without Polyurea
Coating $ 1,112 $ 1,112 $ 1,112
Item No. 5a
Same specifications as Item No. 5 but includes polyurea coating on inside walls of container for organic and liquid waste containment
Unit Cost with Polyurea
Coating $ 1,620 $ 1,620 $ 1,620
Other Costs such as Delivery and Handling Fee (List):

All included above

CITY OF OXNARD (In 3 ½” Letters)
ENVIRONMENTAL RESOURCES DIVISION (In 3 ½” Letters)
Ph. 385-8060 (In 1” Numerals)
● For Blue Color Recycle Containers the word “RECYCLE” shall be stenciled on the front side of the container above the pockets. Use minimum 3 ½” letters, in black paint. ● For Green Color Green Waste Containers the words “GREEN WASTE” shall be stenciled on the front side of the container above the pockets. Use minimum 3 ½” letters, in black paint. ● For Brown Color Organic Waste Containers the words “ORGANIC WASTE” shall be stenciled on the front side of the container above the pockets. Use minimum 3 ½” letters, in black paint. ● Label each container with a waste stream specific sticker (refuse, recycle, green waste, organic waste) that uses text and/or images to explain which materials are allowed and prohibited in the container.
● ID Weld – Container sequence numbers will be issued within ten days from the date of order.

The numbers are to be three inches high, raised weld bead on the right hand pocket facing the container.

723
McLaughlin Waste Equipment, Inc.

RATE SHEET
● 1
6” inseam weld. ID weld should include a dash mark after the container ID number that d
esignates the container size of 2.

Container sequence numbers will be issued within ten days from date of order. The numbers are to be three inches high, raised weld bead on the right hand pocket facing the container.

Metal Refuse 10 -Yard, 10-Yard Bottom Radius, 13.4-Yard, 20-Yard Sealed/Enclosed, 30-Yard, 40-Yard, and 40-Yard Sealed/Enclosed Containers I
tem No. 6
10 Cubic Yard Roll-off Container. Refuse Gray Color, Recycle Blue Color, Green Waste Green Color or Organic Waste Brown Color or any other color as requested by the City.

Type Height Length Width
Open Top Drop Body 24” overall w/wheels
39”
18’
18’ 10” OD
17’ 8” ID
96”OD
90” ID
Quantity 1 – 14 (1st Tier) 15 – 29 (2nd Tier) 30 – 50 (3rd Tier) Unit Cost without
Polyurea Coating $ 6,029 $ 6,029 $ 6,029
Item No. 6a
Same specification as Item No. 6 but includes polyurea coating on inside walls and bottom of container for organic and liquid waste containment
Unit Cost with Polyurea
Coating $ 8,179 $ 8,179 $ 8,179
Item No. 6b
724
McLaughlin Waste Equipment, Inc.

RATE SHEET

10 Cubic Yard Rectangular or Radius Bottom Roll-off Container Type Height Length Width

Open Top Drop Body

24” overall w/wheels
39”
18’
18’ 10” OD
17’ 8” ID
96” OD
90” ID
Unit Cost without
Polyurea Coating $ 6,029 $ 6,029 $ 6,029
Other Costs such as Delivery and Handling Fee (List):

All included above

Item No. 7

13.4 Cubic Yard Roll-off Container. Refuse Gray Color, Recycle Blue Color, Green Waste Green Color or Organic Waste Brown Color or any other color as requested by the City.

Type Height Length Width

Open Top Drop Body

36” overall w/wheels
75”
16’
16’ 10” OD
15’ 8” ID
96” OD
90” ID
Quantity 1 – 14 (1st Tier) 15 – 29 (2nd Tier) 30 – 50 (3rd Tier) Unit Cost without
Polyurea Coating

$ 6,651

$ 6,651
Item No. 7a
Same specification as Item No. 7 but includes polyurea coating on inside walls and bottom of container for organic and liquid waste containment
Unit Cost with Polyurea
Coating $ 8,802 $ 8,802 $ 8,802
Other Costs such as Delivery and Handling Fee (List):

All included above

725
McLaughlin Waste Equipment, Inc.

RATE SHEET
Item No. 8
20 Cubic Yard Sealed Roll-off Container. Refuse Gray Color, Recycle Blue Color, Green Waste Green Color or Organic Waste Brown Color as requested by the City.

Type Height Length Width
Low Profile Rolling Roof
Round Bottom Drop
Body
48” overall w/wheels
56” 16’ 4’
Quantity 1 – 14 (1st Tier) 15 – 29 (2nd Tier) 30 – 60 (3rd Tier) Unit Cost without
Polyurea Coating $ 9,320 $ 9,320 $ 9,320
Item No. 8a
Same specification as Item No. 8 but includes polyurea coating on inside walls and bottom of container for organic and liquid waste containment
Unit Cost with Polyurea
Coating $ 11.850 $ 11,850 $ 11,850
Other Costs such as Delivery and Handling Fee (List):

All included above
It
em No. 9
30 Cubic Yard Roll-off Container. Refuse Gray Color, Recycle Blue Color, Green Waste Green Color or Organic Waste Brown or any other color as requested by the City.

Type Height Length Width
Open Top Drop Body 72” overall w/wheels
87”
18’
18’ 10” OD
17’ 8” ID
96” OD
90” ID
Quantity 1 – 9 (1st Tier) 10 – 19 (2nd Tier) 20 – 30 (3rd Tier) Unit Cost without
Polyurea Coating $ 7,241 $ 7,241 $ 7,241
Item No. 9a
Same specification as Item No. 9 but includes polyurea coating on inside walls and bottom of container for organic and liquid waste containment
Unit Cost with Polyurea
Coating $ 10,221 $ 10,221 $ 10,221
Other Costs such as Delivery and Handling Fee (List):

All included above
726
McLaughlin Waste Equipment, Inc.

RATE SHEET

Item No. 10
40 Cubic Yard Roll-off Container. Refuse Gray Color, Recycle Blue Color, Green Waste Green Color or Organic Waste Brown Color or any other color as requested by the City.

Type Height Length Width

Open Top Drop Body

78” overall w/wheels
93”
22’
22’ 10” OD
21’ 8” ID
96”OD
90” ID
Quantity 1 – 19 (1st Tier) 20 – 39 (2nd Tier) 40 – 75 (3rd Tier) Unit Cost without
Polyurea Coating $ 8,416 $ 8,416 $ 8,416
Item No. 10a
Same specification as Item No. 10 but includes polyurea coating on inside walls and bottom of container for organic and liquid waste containment.

Unit Cost with Polyurea
Coating $ 11,706 $ 11,706 $ 11,706
Item No. 10b

40 Cubic Yard Sealed/Enclosed Roll-off Container - Same specification as Item No. 10a but includes polyurea coating on inside walls and bottom of container for organic and liquid waste containment Type Height Length Width
Low Profile Rolling Roof
Standard Drop Body
90” including door, 78”
without door, over all
w/wheels 100”

22’

6.5’
Unit Cost without
Polyurea Coating $ 12,045 $ 12,045 $ 12,045
Item No. 10c
Same specification as Item 10b but includes polyurea coating on inside walls and bottom for organic and liquid waste containment
Unit Cost with Polyurea
Coating $ 15,335 $ 15,335 $ 15,335
Other Costs such as Delivery and Handling Fee (List):

All included above
Unit cost for 2nd Tier shall apply when the City has completed its purchase of the quantity in the 1st Tier. Unit cost for the 3rd Tier shall apply when the City has completed its purchase of the quantity in the 2nd Tier. 727
Public Works and Transportation Committee
February 27, 2024
City Council
March 19, 2024
Eric Zetz
Environmental Resources Division Manager
Purchase Order to McLaughlin
Waste Equipment, Inc. for
Purchase of Metal Refuse
Containers
728

RECOMMENDATION
FOR PUBLIC WORKS AND TRANSPORTATION COMMITTEE:

That the Public Works and Transportation Committee recommend that the City Council authorize the Mayor to execute a Purchase Order with McLaughlin Waste Equipment, Inc. for an amount not to exceed $2,500,000 for a three-year term ending June 30, 2027, for metal refuse containers.

FOR CITY CITY COUNCIL:

BACKGROUND
3 • Environmental Resources Division (ER) provides weekly uninterrupted refuse and recycling collection to
approximately 16,500 commercial and multi-family dwelling units with approximately 10,500 metal containers
• Sufficient inventory must be maintained for container exchanges requested by customers due for repair or
replacement
• Additionally, customers request metal refuse containers for special collections of bulky waste, construction and
demolition projects, commercial and multifamily
developments
730

BACKGROUND
• State mandate AB 341 requires commercial recycling of businesses and multi-family (units of 5 or more) generating more than 4-cubic yards of refuse per week
• State mandate AB 1826 requires commercial organics
recycling of businesses and multi-family (units of 5 or more) generating more than 4-cubic yards of refuse per
week
4 731

BACKGROUND - TYPES AND SIZES OF METAL REFUSE CONTAINERS 5 13.4 Cubic Yard 30 Cubic Yard 40 Cubic Yard
2 Cubic Yard
4 Cubic Yard
732

DISCUSSION
• Request for Bid (RFB) issued on November 17, 2023
• Posted on City website and www.publicpurchase.com
• 19 vendors received bid notification
• One firm responded with a qualified bid proposal:
• McLaughlin Waste Equipment, LLC. (McLaughlin)
6 733

DISCUSSION
Purchase Plan
7 Container Type Number of Units
1 Cubic Yard Container 80
2 Cubic Yard Container 30
3 Cubic Yard Container 40
4 Cubic Yard Container 30
10 Cubic Yard Container 5
10 Cubic Yard Container Radius
Bottom
5 13.4 Cubic Yard Container 5
20 Cubic Yard Container 5
30 Cubic Yard Container 5
40 Cubic Yard Container 5
734

FINANCIAL IMPACT
• Total cost of the purchase order with McLaughlin Waste Equipment will not exceed $2,500,000 for a term of three years
• Spending plan for FY 2024-25 is $520,000 and funds will be requested in the Environmental Resources Fund (631) FY 204-25 Proposed Budget during the budget process
• Future funding for subsequent fiscal years will be requested during the annual budget process.
8 735
QUESTIONS?
736

CITY COUNCIL AGENDA REPORT

REPORTS
AGENDA ITEM NO. N.4

DATE: March 19, 2024

TO: City Council

FROM: Michael Wolfe, Public Works Director, (805) 385-8055, [email protected]

SUBJECT: Authorization to Accept a State Grant for $9.5M to fund Electrical Improvements for the Oxnard Wastewater Treatment Plant Reliability Improvement Project PW 20-102. (10 minutes)

RECOMMENDATION

That the City Council:

1. Accept a grant from the California State Water Resource Control Board in the amount of $9.5 million for the Oxnard Wastewater Treatment Plant Reliability Project; and

(This item did not originate in Committee as this is a capital improvement project specifically listed in the City's Capital Improvement Program budget, which was previously approved by the City Council.)

Please click the following link to view the required Measure M pre-recorded presentation video: https://youtu.be/FMowJ4MAF-g

BACKGROUND

In June 2018, the Governor's office approved the State of California budget, which included the allocation of $9.5 million toward the City of Oxnard’s aging Wastewater Treatment Plant. Assemblymember Jacqui Irwin led the efforts to allocate the funding, supported by Senator Hannah Beth Jackson, Assemblymember Monique Limon, and Oxnard city staff. In June 2023, a three-year extension for the funding was granted by the State in the annual budget. The funding was allocated to the new Main Electrical Building portion of the OWTP Reliability Project.

Capital Improvement Program (CIP) Reference:

Project No. C2201 - Oxnard Wastewater Treatment Plant Reliability Improvements Project - CIP 2022-2027 - Adopted May 3, 2022 – Pages 106, 111, 112, 116, 117, & 118.

DISCUSSION

As of February 2023, the OWTP Reliability Project is 30 percent complete, with anticipated final completion in September 2025. The grant-funded Main Electrical Building’s primary structure is nearing completion, the bulk of the electrical equipment has been delivered to the OWTP, and the underground work is progressing. City staff and the contractor have navigated technical field conditions and utility coordination, overcoming multiple obstacles. As the project continues, the City is eligible for reimbursement up to the full value of the grant, slightly over 15% of the total project cost.
737

STRATEGIC PRIORITIES

FINANCIAL IMPACT

The awarded amount of $9.5 Million shall be used to cover Project costs related to Oxnard Wastewater Treatment Plant Reliability Improvements Project (No. C2201). A new appropriation is required in the amount of $9.5 million in State Fund (210) to properly record the revenue and expenditures for this grant award (Project No. C2201). There is no local match required.

COMMITTEE OUTCOME

This item did not originate in Committee as this is a capital improvement project specifically listed in the City's Capital Improvement Program budget, which was previously approved by the City Council.

Prepared by: Timothy Beaman, Supervising Civil Engineer, Luis Ortega, Management Analyst

ATTACHMENTS

1. Presentation

738
City Council
March 19, 2024
Tim Beaman, PE
Supervising Civil Engineer
Authorization to Accept a State Grant for $9.5M
to fund Electrical Improvements for the Oxnard
Wastewater Treatment Plant Reliability
Improvement Project PW 20-102
739
RECOMMENDATION 2
That the City Council:

1. Accept a grant from California State Water Resource Control Board in the amount of $9.5 Million for the Oxnard Wastewater Treatment Plant Reliability Project; and

2. Authorize the City Manager to execute grant agreements; the Finance Director or designee to submit financial reports and grant claims and approve budget appropriations for the use of grant funds; and the Director of Public Works or designee to submit non-financial reports. 740
BACKGROUND 3
2018
$9.5M grant for the City of
Oxnard Wastewater
Treatment Plant Electrical
Improvements approved as
part of the State Budget
2023
Three year grant extension
approved by the State
OWTP Reliability Project
awarded
Demolition of previous existing storage building
741
BACKGROUND 4
742
DISCUSSION 5
• OWTP Reliability
Project is 30
percent complete
• Main Electrical
Building
• Primary
Structure
• Underground
Conduit
• Site Civil
Improvements
• Equipment
Delivered
743
DISCUSSION 6
744
DISCUSSION 7
• As work has progressed invoices have been paid by the Wastewater Division Capital Fund (612)
• Grant reimbursement is now available
745
FINANCIAL IMPACT 8
• The awarded amount of $9.5 Million shall be used to cover Project costs related to CIP Project C2201
• A new appropriation is required in the amount of $9.5 in State Fund (210) to properly record the revenue and expenditures for this grant award
• There is no local match required
746

QUESTIONS
9 747

CITY COUNCIL AGENDA REPORT

REPORTS
AGENDA ITEM NO. N.5

DATE: March 19, 2024

TO: City Council

FROM: Michael Wolfe, Public Works Director, (805) 385-8055, [email protected]

SUBJECT: Emergency On-Call Services Performed by Toro Enterprises, Inc. to Protect Properties and City Infrastructure Located Along the Coastal Area of Oxnard Beach. (10 minutes)

RECOMMENDATION

That the City Council approve and authorize the Mayor to execute a one-time payment with Toro Enterprises, Inc. in the amount of $23,478.39 for emergency on-call services performed on December 29, 2023, and December 30, 2023.

(This item did not originate in Committee.)

Please click the following link to view the required Measure M pre-recorded presentation video: https://youtu.be/PEGkGK4zUR4

BACKGROUND

Government Code section 8630 and Chapter 6 of the Oxnard City Code ("OCC") empower the City Manager of the City of Oxnard (“City”), acting in the capacity of the Director of Emergency Services ("Director"), to proclaim the existence or threatened existence of a local emergency when the City is affected or likely to be affected by a public calamity and the City Council is not in session.

On December 21, 2023, the City was inundated with a series of rainstorms that the Los Angeles Times described as "a once-in-a-millennium rainfall." The National Weather Service estimated that approximately 1.36 billion gallons of water dropped on Oxnard in a 60-minute period in the early morning of December 21, which caused flooding throughout the City. In addition to the rainstorms, a high-tide warning with possible coastal flooding was issued for December 29-31, 2023.

As a result, the Director proclaimed the existence of a “Local Emergency” on December 27, 2023, with an "Emergency Proclamation" (Attachment 1). The City Council then ratified the Emergency Proclamation on January 2, 2024 (Attachment 2).

DISCUSSION

Per the January 2, 2024 ratification of Resolution 15,758 proclaiming the existence of a Local Emergency, the Director of Emergency Services shall:

D. To the extent permitted by law, City goods and services procurement requirements are stayed during this local emergency, as necessary to procure and respond to the local emergency, and the Director of Emergency Services is empowered to exercise all powers granted by any local, state, or federal emergency laws, rules, and regulations, and such procurements made by the Director of Emergency Services are hereby ratified; further, the Director of Emergency Services is authorized to appropriate and expend any City funds deemed necessary by the Director of Emergency Services in writing, including unappropriated City reserve funds, to exercise any of said emergency powers or procurement 748
powers, and to transfer such funds to corresponding City budget line items or categories; and

E. To the extent permitted by law, this proclamation of a local emergency is intended to satisfy any local, state, or federal law, or regulation requiring such a proclamation as a prerequisite or requirement for mutual assistance, reimbursement or other cooperation with any other local, state, or federal entity; this proclamation of local emergency also hereby activates any and all existing City emergency plans, and authorizes the Director of Emergency Services to amend such plans in writing as necessary; and

F. The Director of Emergency Services, as delegated by the City Council pursuant to Chapter 6 of the City Code, may promulgate orders and regulations necessary to provide for the protection of life and property

The Public Works Department currently has multiple agreements with Toro Enterprises, Inc. (“Toro”) that include street and alley paving and an on-call services agreement for the Water and Waste Water Divisions. The on-call agreement is for scheduled and non-scheduled, or unplanned repair and maintenance of facilities and infrastructure.

After receiving notice of the high tide warning and potential flooding, staff met with representatives from Toro on December 29, 2023, to discuss building a sand berm to protect the residential properties and City infrastructure along Oxnard Beach. During that on-site meeting, staff and the contractor witnessed the tide wash over the beach and flood Mandalay Beach Road at Fifth Street. The City Manager (Director of Emergency Services) was immediately contacted and staff instructed Toro to begin building the sand berm based on the time and material prices contained within the current on-call Agreement.

The Toro invoice, for the two days of work that was required to build the berm, was held pending a decision on when the berm would be removed. At that time, it was the intention of City staff to have Toro remove the berm and submit the invoices for both the construction and removal at the same time. However, after a few months, County Fire offered to remove the berm at no charge to the City in exchange for a coordinated effort for the entire length of the berm that included the beaches for the City of Ventura, the County of Ventura, and the State. County Fire began removing the sand berms on March 4, 2024, with the intention of having all of the berms removed by March 15, 2024.

Therefore, staff is now recommending the invoice be approved for payment for the construction of the berm by Toro in the amount of $23,478.39.

STRATEGIC PRIORITIES

This agenda item is a routine operational item or does not relate to the five strategic priorities adopted by City Council on March 16, 2021.

FINANCIAL IMPACT

The cost of this one-time on-call emergency service with Toro Enterprises, Inc. Is $23,478.39. Funding is available in the General Fund (1013301-53200) Parks Operations budget.

COMMITTEE OUTCOME

This item did not originate in Committee.

Prepared by: Steve Howlett, Assistant Public Works Director

ATTACHMENTS

1. Resolution 23.02

2. Resolution 15,758

3. Presentation

749

CITY OF OXNARD
RESOLUTION NO. 23-02

RESOLUTION OF THE DIRECTOR OF EMERGENCY SERVICES

OF THE CITY OF OXNARD PROCLAIMING THE EXISTENCE

OF A LOCAL EMERGENCY
WHEREAS, Chapter 6 of the Oxnard City Code empowers the City Manager of the City of Oxnard (City"), acting in the capacity of the Director of Emergency Services, to proclaim the existence or threatened existence of a local emergency when the City is affected or likely to be affected by a public calamity and the City Council is not in session; and
WHEREAS, the Director of Emergency Services does hereby find:

The severe rainstorm that commenced the week of December 18, 2023 produced more than 6 inches of rainfall in Oxnard, 4.5 inches of which fell between 1 :00 a.m. and 3 :00 a.m. the morning of December 21; and
The National Weather Service reported rainfall to be as much as 3.18 inches in one hour, which is the highest rate recorded for the area for at least 100 years; and The torrential rain caused extensive street flooding as well as flood damage to many homes, businesses, and vehicles within the city and neighboring jurisdictions and the unincorporated areas of Ventura County; and
Beginning on December 20, 2023, City staff dedicated resources to respond within the city and to assist other agencies in responding to the severe rainstorm throughout the County, including making available additional emergency response units and specialty-trained swift water rescue teams, managing road closures and flooding issues, and activating the City's Emergency Operations Center at an Enhanced Operations/Monitoring level to assist in coordination and information sharing, both within the city and throughout Ventura County; and
The aforesaid condition s of extreme peril warrant and necessitate the proclamation of the existence of a local emergency within the city; and The City Council of the City of Oxnard is not in session (and cannot immediately be called into session).

NOW, THEREFORE, IT IS HEREBY PROCLAIMED
Section 1. That a Local Emergency now exists throughout the city.

Section 2. The conditions and powers granted during this Local Emergency shall continue for no more than seven (7) days unless this Proclamation is ratified by a Resolution of the City Council pursuant to Government Code Section 8630. rev. 2023
750
IT IS FURTHER PROCLAIMED AND ORDERED that during the existence of the Local Emergency the powers, functions, and duties of the Office of Emergency Services and Disaster Council of the City shall be those prescribed by state law, and by the ordinances, resolutions and other adopted policies of the City.

Dated: _1z__,{�z_4�("hJ�Z3�- By:-----,/)-,--- M----l'c---:,-::------_:::-_-_ -_ ---- hi6e City Manager/Director of Emergency
Services
City of Oxnard
ATTEST:

City Clerk
APPROVED AS TO FORM:

City Attorney
rev. 2023
751
752
753
754
755
756
757
Emergency On-Call Services Performed by
Toro Enterprises, Inc. to Protect Properties
and City Infrastructure located along the
coastal area of Oxnard Beach
City Council
March 19, 2024
Steve Howlett, Assistant Director
Public Works Department
758
That the City Council approve and authorize the Mayor to execute a one-time payment with Toro Enterprises, Inc. in the amount of $23,478.39 for emergency on-call services
performed on December 29, 2023, and December 30, 2023.

RECOMMENDATION
2 759
• Government Code section 8630 and Chapter 6 of the Oxnard City Code empowers the City Manager of the City of Oxnard, acting in the capacity of the Director of Emergency Services ("Director"), to proclaim the existence, or threatened existence, of a local emergency when the City is affected, or likely to be affected, by a public calamity and the City Council is not in session.
• On December 21, 2023, the City was inundated with a series of rainstorms that the Los Angeles Times described as "a
once-in-a-millennium rainfall.“ In addition to the rainstorms, a high-tide warning with possible coastal flooding was issued for December 29-31, 2023. • As a result, the Director proclaimed the existence of a “Local Emergency” on December 27, 2023 with an "Emergency Proclamation" (Attachment 1). The City Council then ratified the Emergency Proclamation on January 2, 2024 (Attachment 2).

BACKGROUND
3 760
• Per the January 2, 2024 ratification of Resolution 15,758 proclaiming the existence of a Local Emergency, the Director of Emergency Services shall:
• D. To the extent permitted by law, City goods and services procurement requirements are stayed during this local emergency, as necessary to procure and respond to the local emergency, and the Director of Emergency Services is empowered to exercise all powers granted by any local, state, or federal emergency laws, rules, and regulations, and such procurements made by the Director of Emergency Services are hereby ratified; further, the Director of Emergency Services is authorized to appropriate and expend any City funds deemed necessary by the Director of Emergency Services in writing, including unappropriated City reserve funds, to exercise any of said emergency powers or procurement powers, and to transfer such funds to corresponding City budget line items or categories; and

DISCUSSION
4 761
• E. To the extent permitted by law, this proclamation of a local emergency is intended to satisfy any local, state, or federal law, or regulation requiring such a proclamation as a prerequisite or requirement for mutual assistance, reimbursement or other cooperation with any other local, state, or federal entity; this proclamation of local emergency also hereby activates any and all existing City emergency plans, and authorizes the Director of Emergency Services to amend such plans in writing as necessary; and
• F. The Director of Emergency Services, as delegated by the City Council pursuant to Chapter 6 of the City Code, may promulgate orders and regulations necessary to provide for the protection of life and property

DISCUSSION
5 762
• The Public Works Department currently has multiple agreements with Toro Enterprises, Inc. (“Toro”) that include street and alley paving and an on-call services agreement for the Water and Waste Water Divisions. The on-call agreement is for scheduled and non-scheduled, or unplanned repair and maintenance of facilities and infrastructure. • After receiving notice of the high tide warning and potential flooding, staff met with representatives from Toro on December 29, 2023 to discuss building a sand berm to protect the residential properties and City infrastructure along Oxnard Beach. During that on-site meeting, staff and the contractor witnessed the tide wash over the beach and flood Mandalay Beach Road at Fifth Street. The City Manager (Director of Emergency Services) was immediately contacted and staff instructed Toro to begin building the sand berm based on the time and material prices contained within the current on-call Agreement.

DISCUSSION
6 763
• The Toro invoice, for the two days of work that was required to build the berm, was held pending a decision on when the berm would be removed.
• At that time, it was the intention of City staff to have Toro remove the berm and submit the invoices for both the construction and removal at the same time. However, after a few months, County Fire offered to remove the berm at no charge to the City in exchange for a coordinated effort for the entire length of the berm that included the beaches for the City of Ventura, the County of Ventura, and the State.

County Fire began removing the sand berms on March 4, 2024, with the intention of having all of the berms removed by March 15, 2024.

• Therefore, staff is now recommending the invoice be approved for payment for the construction of the berm by Toro in the amount of $23,478.39

DISCUSSION
7 764
The cost of this one-time on-call emergency service with Toro Enterprises, Inc. Is $23,478.39. Funding is available in the General Fund (1013301-53200) Parks Operations budget.

FINANCIAL IMPACT
8 765

QUESTIONS
766

CITY COUNCIL AGENDA REPORT

REPORTS
AGENDA ITEM NO. N.6

DATE: March 19, 2024

TO: City Council

FROM: Jeff Pengilley, Community Development Director, (805) 385-8208, [email protected]

SUBJECT: City of Oxnard 2023 General Plan Annual Progress Report. (10 minutes)

RECOMMENDATION

That the Oxnard City Council receive and file the City of Oxnard 2023 General Plan and Housing Element Annual Progress Report.

(This item did not originate in Committee)

Please click the following link to view the required Measure M pre-recorded presentation video: https://youtu.be/s4ls4Uarphg

BACKGROUND

Government Code section 65400(a)(2) mandates the preparation and filing of an annual report with the legislative body regarding the status of a city's or county General Plan. The General Plan Annual Progress Report and Housing Element Annual Progress Report, must then be submitted to the Governor's Office of Planning and Research (OPR) and the State Department of Housing and Community Development (HCD) by April 1st of each year.

This City Council staff report consists of two separate reports, the General Plan Annual Progress Report (Attachment 1) and the Housing Element Annual Progress Report (Attachment 1, Exhibit 1):

1. The General Plan Annual Progress Report is a text based report without any standard form or format dictated by OPR or HCD.

2. The Housing Element Annual Progress Report (Attachment 1, Exhibit 1) is prepared using standardized spreadsheet-based forms provided by HCD. Staff does not have the ability to change the format or readability of this document. As the Housing Element is one of the required elements of the Oxnard General Plan, the General Plan Annual Progress Report includes a summary of the data included within the Housing Element Annual Progress Report.

The 2023 Annual Progress Report, which looks at the progress towards the goals, policies and programs of the 2021-2029 6th-Cycle Amended Housing Element (“Housing Element”), must be presented to the City Council for its review and acceptance, as a consent or discussion item on a regular meeting agenda. In accordance with these requirements, this report is being presented to the City Council and the public to provide information regarding the implementation of the General Plan within the City of Oxnard.

DISCUSSION

The City of Oxnard 2023 General Plan Annual Progress Report and Housing Element Annual Progress Report provide an overview of the City’s General Plan and Zoning Ordinance Amendments that are currently in process or were completed 767
in 2023, as well as an inventory of the 2030 General Plan Amendment history.

In 2023, there were three pending General Plan Amendments, but there were no adopted General Plan Amendments.

Exhibit 1 of Attachment 1 presents a summary of all nineteen (19) adopted and three (3) pending General Plan Amendments since the adoption of the 2030 General Plan. The General Plan as amended through 2023 complies with the General Plan Guidelines.

The Oxnard City Code was amended on November 7, 2023 to implement Programs 6, 9, 22, 27, and 32 of the Housing Element and to implement State housing laws. These seven (7) ordinances affected regulations regarding: Accessory Dwelling Units (ADUs) parking; Density Bonus requirements; Supportive Housing and Low Barrier Navigation Center zoning; Emergency Shelter standards and parking; Single Room Occupancy zoning, standards and parking; Farmworker Housing zoning; Residential Care Facility zoning and parking; and objective standards for Reasonable Accommodation.

The 2023 General Plan Annual Progress Report highlights some of the key long range projects such as the pending Inclusionary Housing Ordinance update; the Local Coastal Plan Update, and Implementation of the Clime Action and Adaptation Plan. It also highlights major development projects including: the Sakioka Specific Plan, RiverPark Specific Plan Amendments; the Village Development project; and Lockwood 1, 2, and 3.

In addition, as required by State law, the General Plan Annual Progress Report includes a discussion regarding the City’s progress in meeting its share of the regional housing needs and effort to promote housing development. This includes statistics on ADU’s and residential Planning and Building permit data. In summary, in 2023 Planning approved 254 units, building issued permits for 641 units and issued 372 certificates of occupancy for residential units.

A summary of housing development activity by affordability category is provided in the General Plan Annual Progress Report Table 3 of Attachment 1. In summary, in 2023 the City permitted the following units in these income categories:
• Very Low Income (50% of Area Median Income - AMI) - 38 units • Low Income (80% AMI) - 173 units
• Moderate Income (120% AMI) - 46 units
• Above Moderate Income (+120% AMI) - 384 units
• Total Units in 2023 - 641 units

The 641 units produced in 2023, bring the total units to date for this housing cycle to 995, or 13.17% of our RHNA allocation. During the remaining years of this cycle an additional 7,554 units are needed to hit the City’s allocation. A detailed compilation of housing development activity is included in the Housing Element Annual Progress Report (Attachment 1, Exhibit 1).

STRATEGIC PRIORITIES

This agenda item is state-mandated and is a routine operational item and does not relate to the four strategic plans adopted by City Council on March 16, 2021.

FINANCIAL IMPACT

There is no fiscal impact associated with this staff report.

COMMITTEE OUTCOME

This item did not originate in Committee as it is a routine operational item. Pursuant to State law this item is to be presented to the public and City Council annually, as an informational item for discussion only. No deliberation or decisions are necessary, and therefore committee review is not warranted.

Prepared by: Kathleen Mallory, Planning & Sustainability Manager, Joe Pearson II, AICP, Planning & Environmental Services Manager

ATTACHMENTS
768

1. Draft 2023 City of Oxnard General Plan Annual Progress Report

2. Presentation

769
CityofOxnard2023GeneralPlanAnnualProgressReport
Preparedby:

CommunityDevelopmentDepartment–PlanningDivision
214S.CStreet
Oxnard,CA93030
SubmittedtotheCityofOxnard-CityCouncil,March19,2024
770
TableofContentsIntroduction 3
OverviewofGeneralPlanBackgroundandAmendments 3
GeneralPlanAmendmentsin2023 4
GeneralPlanAmendmentsinProcessin2023 4
SummaryofrecentlycompletedandactiveZoningTextAmendments,andLongRangePlanningProjectsCurrentlyBeingImplemented 5 OrdinanceAmendments 5
LongRangeProjectsCurrentlyBeingImplemented 6
Summaryof2023ActiveDevelopmentsofInterest 7
AReviewOfTheCity’sProgressInMeetingTheRegionalHousingNeedAllocation(RHNA)Objectives 9 Conclusion 11
Exhibits 11

1.GeneralPlanAmendments(AsofDecember31,2023) 11

2.2023CityofOxnardHousingElementAnnualReport/HCDExcelTable 11 Page2
771
Introduction
GovernmentCodeSection65400requirestheCitytoannuallyprepareareportregardingthestatusoftheCity’s2030General Plan(General Plan)andprogressinitsimplementation(GeneralPlanProgressReport)andprovidetheGeneralPlanProgressReporttotheOfficeofPlanningandResearch(OPR)andtheDepartment of HousingandCommunityDevelopment (HCD). TheGeneral PlanProgressReportprovides for the annual review of the General Plan to assess the level of implementation andeffectiveness of theGeneral Planas aguidefor orderlygrowthanddevelopment,preservationandconservationofopenspacelandandnatural resources,andtheefficientexpenditureofpublicfunds.ThisGeneralPlanProgressReportsummarizestheGeneralPlanimplementationprogressfor2023.TheGeneralPlanProgressReportalsoprovidesinformationregardingtheCity’sprogressinmeetingitsshareofregionalhousingneeds.

PursuanttoStatelaw,thisreportmustbesubmittedtotheCityCouncil,theStateOfficeofPlanningandResearch(OPR)andHCDbyApril 1stofeachyear.TheAnnualProgressReportincludesthefollowingelements:

1. OverviewofGeneral Planbackgroundandstatus,includingasummaryofrecentlycompletedandactiveGeneralPlanAmendments;2. SummaryofrecentlycompletedandactiveZoningTextamendments,andLongRangePlanningProjectscurrentlybeingimplemented;3. Summaryof2023ActiveDevelopmentProjectsofInterest;and4. Review of the City’s progress in meeting the regional housing need allocationobjectives.

OverviewofGeneralPlanBackgroundandAmendments
TheGeneralPlanistheCity’sofficialpolicythatsetsoutavisiontoguidefuturedevelopmentintheCity.Local governmentsarerequiredtokeeptheirGeneralPlanscurrentandinternallyconsistent,andCityactions must beconsistent withthisplan.AlthoughGeneral Plansmustbekeptcurrent,thereisnospecificrequirementthatalocalgovernmentupdatetheGeneralPlanonaprescribedtimeline,withtheexception of the Housing Element, whichis formallyrequiredtobeupdatedeveryeight years. Asdetailed below, the City’s 2021-2029 Amended HousingElement was adoptedonOctober 4, 2022(“HousingElement”). TheOxnardGeneral PlanwasadoptedinOctober2011.Specifically,Chapter9“Implementation” of theGeneral PlanlaysouttheimplementationgoalsandpoliciesoftheGeneralPlan.AsoutlinedinExhibit2manyofthegoalsandpolicieswillremainongoinguntil2030.Additionally,specifictohousing,ChapterGoftheHousingElementoutlinesthegoals,policies,andprogramsthatwillguidetheCity’seffortsinmeetingtheRegionalHousingNeedsAssessment(RHNA)andrelatedcurrentandfuturehousingneeds.The2023AnnualReportwilllookattheprogresstowardsthegoals,policiesandprogramsoftheHousingElement. EachHousingElementprogramanditsimplementationstatusaresummarizedinExhibit2(HCDTableD). Page3 772
GeneralPlanAmendmentsin2023During2023,theCitydidnotapprove anyGeneralPlanAmendments.Exhibit1,attachedtothisreport,summarizestheGeneralPlanAmendmentssinceadoptionoftheCity's2030GeneralPlan.

GeneralPlanAmendmentsinProcessin2023
TealClubSpecificPlanProject(PlanningandZoningPermitNo.15-620-03),LocatedinareaboundedbyDorisAvenueonthenorth,PattersonRoadonthewest,TealClubRoadonthesouth,andVenturaRoadontheeast:ThisproposedSpecificPlanincludesarequestfor990residentialunitsofvaryingdensity,single-family, townhomes, condominium, and apartment units; 24 acres, community park; 8 acrespublic/semipublicuse;4acresofmixeduse,retail,commercial;10acresofBusiness/ResearchPark.ThisprojectalsoincludestheadoptionofaTealClubSpecificPlan(TCSP)andPre-Zoningthatwouldallowfortheannexationofa174.6-acrecollectionofsevenagriculturalparcels(knownlocallyas“TealClub”)totheCity.Additional parcelssouthofTealClubRoadwouldalsobeannexedintotheCity,andincludeamixofvacantlandandresidentialdevelopmentwithancillaryvehiclestorageandshopuses. TheCitypreparedandreleasedaDraftEnvironmentalImpactReport(EIR)fortheTCSP. A60-daypubliccommentperiodwas provided. Citystaff is currentlyfinalizingtheSpecific PlanandDevelopmentAgreementdocumentsandpreparingtheprojectforpublichearingsin2024.

Maulhardt/StilesNECSPSub-NeighborhoodPlan(PlanningandZoningPermitNo.21-620-04),LocatedattheNortheasternCorner of RoseAveandCaminoDel Sol (APN:214-0-020-615;&625):TheprojectproposestocreateaSub-NeighborhoodPlanundertheNortheastCommunitySpecificPlanthatwouldcreate the framework for a future development of approximately 500-950 residential units andapproximately40,000squarefeetcommercialdevelopmentonthe56acresprojectsite.TheproposedTentativeTractMapproposestocreate14masterlots.Theprojectwillalsoprovideforapproximately11.05acresofimprovedparkareas,includinga5.4acreexpansionofEastVillagePark.

RioDel ValleCampusExpansionMasterPlan(PlanningandZoningPermitNo.23-620-02),Locatedat3100NorthRoseAvenue(APN:144-0-110-445&-650):Theprojectconsistsofasouthernexpansionarea and improvements to the existing campus. The southern expansion area will accommodateclassroomandathleticfieldexpansionsandanewtransportationandparkingfacility,relocatedfromapreviousantiquatedfacilityonVineyardAvenue.Together,withtheexistingcampusarea,theexpansionareawillconstitutethenewcampusofRioDelValleMiddleSchool.InordertoallowfortheproposedexpansiontheexistingcampusandsouthernexpansionareamustbeannexedintotheCityofOxnard,whichrequirestheGeneralPlanAmendmenttoaddthepropertytothe2030GeneralPlan.

SummaryofRecentlyCompletedZoningTextAmendments
OrdinanceAmendments
ZoningCodeAmendments toImplement 6thCycleHousingElement (Planning&ZoningPermitNo.23-580-03);OnNovember7,2023theCityCounciladoptedseven(7)ordinancestoimplementtheCityofOxnardHousingElementPrograms6,9,22,27and32.TheseprogramscalledforspecificupdatestotheCity’s zoningcodeandDowntownPlantocomplywithcurrent statehousinglaws andaddressPage4 773
identified constraints to residential development. Key amendments to the City’s Zoning CodeandDowntownPlanincludedupdatestoADUparking,DensityBonusrequirements,SupportiveHousingandLowBarrierNavigationCenterzoning;EmergencyShelterstandardsandparking,SingleRoomOccupancyzoning,standardsandparking;FarmworkerHousingzoning,ResidentialCareFacilityzoningandparking,objectivestandardsforReasonableAccommodation,andotherordinancemodificationstostreamline,clarifyandsimplifypermittingrequirements tocomplywithStateregulatoryrequirementsandlaws.DetailontheapprovedrevisionsareoutlinedintheCityCouncilpacketCityCouncilMeeting(1stTue)•CityofOxnardMeetingAgendas•CivicClerk.AftertheordinancesecondreadingonDecember5,2023,thezoningtextamendmentsbecameeffectiveonJanuary4th,2024.

SummaryofLongRangeProjectsCurrentlyBeingImplemented
InclusionaryHousingOrdinanceUpdate (Planning&ZoningPermitNo.23-580-01):TheCityhasbeenintheprocessofupdatingtheCity’sexistinginclusionaryhousingordinancetoimplementProgram10oftheCity’sHousingElement.Theexistingordinancerequiresthatfor-saledevelopmentprovide10%ofdwellingunitsasaffordabletolowincomehouseholds,andrentaldevelopmentprovideatleast5%ofdwellingunits as affordablefor verylowincomehouseholds and5%asaffordabletolowerincomehouseholds. In 2022, staff conductedcommunityoutreachtoobtaininput fromaffordablehousingadvocates,developers,andbusinessorganizationsonpotentialchangestotheCity’sexistingInclusionaryHousingOrdinance.InNovember2022aCityCouncilappointedCommitteeknownastheCommunityServices,PublicSafety,Housing&DevelopmentCommittee(“Committee”)provideddirectionregardingkeypolicyquestions ontheInclusionaryHousingOrdinanceupdate.BasedoncommunityinputandCommitteedirection,staffpreparedandpublishedadraftupdatetotheInclusionaryHousingOrdinancefor public reviewinJanuary2023. TheInclusionaryHousingOrdinanceUpdatewasreviewedbythePlanningCommissiononApril 6,2023andtheCommissionrecommendedsubstantialrevisionstothedraftordinance;someofthesechangeswereinconflictwithpriorCommitteedirection.

Inworkingontheordinanceupdateandinreviewingcommunityinput,confirmingstateregulationsnecessitated requesting an opinion from the State of California Attorney General on how localinclusionaryunitsmaybecalculatedinprojectsthatarealsoseekingtoutilizeStateDensityBonusasameanstosecureadditionaldensityforaresidentialdevelopmentproject.Specifically,duetoconflictinggovernmentcodelanguagetheCityaskedforclarificationifthelocalinclusionaryhousingrequirementsmaybeappliedtothecompletenumberofunitsinadevelopment,includingunitscreatedasaresultofdensitybonusallowedpursuanttostatelaw.ThedraftInclusionaryordinancehasbeenplacedonholdwhiletheCitywaitsforaresponsefromtheAttorneyGeneral.

LocalCoastalProgram(LCP)Update
TheCaliforniaCoastalActrequiresthattheCityprepareandimplementLocalCoastalPrograms(LCPs)toprotect natural and man-made coastal resources and maximize public access to the shorelines inconformancewiththeCoastal Act.TheLCPidentifiesadaptationstrategiesthataddressrisingthreatsandconcernsofclimatechange,suchassealevelrise(SLR),andguidesdevelopmentinthecoastalzonewithpolicydirectivesforfuturedevelopmentandprotectionofcoastalresources.

TheCity’s workontheLCPwas pausedfor afewyearsduetoCaliforniaCoastal Commission(CCC)actionsandpolicyapproaches.In2023,theCityjoinedSmartCoastCalifornia,aconsortiumofcoastal Page5
774
communitiespromotinglocalcoastalpolicysolutions. ThisorganizationhashelpedfuelandsecureCCCsupportforcitiestodeveloppoliciesandapproachesuniquetotheirjurisdiction.Forthisreason,aswellasCCCandHCDmandatesandlaws,theCityinitiatedworkontheLCPupdatein2023.

Inlate2023,theCityissuedaRequestforProposal(RFP)foracomprehensiveupdatetotheLCP,whichisreflectiveofupdatestotheCity’sCoastalLandUsePlan(LUP)aswellastheLocalImplementationPlan(LIP).Acomprehensiveupdatetothe LCPwillhelptheCitysecureCCCapprovalwhile:(1)supportingthe community’s vision for the future; (2) addressing the City’s specific coastal hazard risks; (3)conformingwiththeCoastalActpoliciesasapprovedbytheCityCouncil;(4)generallyfollowingpolicydirectionsintheCCC’supdatedSLRPolicyGuidance,withconsiderationtotheoutcomeoftheCity’sSLRmodel and analysis as appropriate for the City of Oxnard; and (5) providingtheCitywithmoreadaptationstrategiestoreduceimpactsfromrisingconcernsofclimatechangeandhazardousevents.Theupdateisanticipatedtotakethree(3)yearstocomplete.

CityofOxnardClimateActionandAdaptationPlan(CAAP)
OnDecember7,2022,theCityCouncilapprovedtheCity'sfirstCAAP(ResolutionNo.15,652). ACAAPisaplanforreducingGreenhouseGases(GHGs)thatcontributetoglobalclimatechange,andforadaptingtotheanticipatedeffectsofclimatechange.TheCAAPhadtwoprimaryobjectives:

1. ToreduceGHGemissionsthroughtheimplementationofreductionmeasurestomeetorexceedreductiontargetsmandatedbytheStateofCaliforniaviaSenateBill32(SB32),whichcallsforastatewidereductionofGHGemissionsto40percentbelow1990levelsby2030;and2. Toenhancethecommunity’sresiliencetoachangingclimatebyaddressingthevulnerabilitiesandrisksthatareexpectedtooccurasaresultofthoseimpacts.

TheCAAPwasalsodevelopedtocomplywiththe2030GeneralPlan,SustainableCommunitiesChapter,Goal 1: SupportingandParticipatinginGlobal WarmingandClimateChangeAdaptationanalysisandprograms.

OneoftheprimarywaystoachievetheCAAPgoalsistocontinuesecuring100%greenenergyfromthecity’s energyprovider,theCleanPowerAlliance(CPA).

In June 2022, the City Council authorized the City Manager to enter into a Memorandum ofUnderstanding(MOU) withtheCleanPower Alliance(CPA) toparticipateintheCPAPower ReadyProgramfor theCity-ownedbuildinglocatedat214SouthCStreet(ServiceCenter). Staff’sworktoimplement theCAAPcontinuedthrough2023throughworkingwiththeCPAtodesignthesolarandbatterystoragesystemfor emergencyandresiliencepurposes. StaffalsoparticipatedinCPAEnergyPlanning&ResourceCommitteemeetingsandCouncilmembersparticipatedinCPABoardofDirectormeetingstocontinuehelpingtoshaperenewableenergypolicyfortheCitytoachieveCAAPgoals.

Summaryof2023ActiveDevelopmentsofInterest
InadditiontothecontinuedprogressofthelargerdevelopmentsintheCity,suchastheWagonWheelproject and Riverpark developments, and on Housing Element Additive Zone sites in 2023. Also,throughouttheCitytherewasanincreaseinthedemandforAccessoryDwellingUnits.Aseachofthese Page6
775
areidentifiedintheGeneralPlan,abriefsummaryoftheprogressmadeineachareain2023hasbeenprovidedbelow.

SakiokaFarmSpecificPlan
OnJune16, 2020, CityCouncil toapprovedaDevelopmentAgreementbetweentheCityofOxnard,SakiokaFarmsandAMSCraig,LLC;andaTentativeTractMap,whichsubdividedthe430acreareawithintheSakiokaFarmsBusinessParkSpecificPlaninto129lotswithnewroadsandsidewalks,stormwatermanagement, landscape, andassociatedutilities. InadditiontotheAmazonandArtic ColdStorageDevelopmentswhicharecompletedandoperational,athirddevelopmentwasapproved.In2023,theCityapprovedaproposaltoconstructfourindustrialbuildingstotalling778,720squarefeetandrelatedsiteimprovementsonfourseparatelotstotalling40.87acresite.Altogether,therecentandapproveddevelopmentintheSakiokaareastotalover2.8millionsquarefeetofdevelopment,furtheringthegoalsoftheGeneralPlanthataimtopromoteeconomicdevelopmentthroughjobcreationandcoldstorageprojects.

RiverParkSpecificPlanAmendment(RPSP)
InSeptember 2002, theCityCouncil approvedtheentitlementpermitsfortheRPSPtoguidefuturedevelopment onthe702-acreprojectsite.Theoriginal RPSPallowedforthephaseddevelopmentof2,805dwellingunits and2,485,000squarefeetofcommercial development(includingapproximately221,000squarefeetofexistingofficedevelopment,priortotheadoptionoftheRPSP).TheoriginalRPSPwas developedfollowingthedesignprinciplesoftheNewUrbanismandSmartGrowthmovements,which emphasized the importance of mixed land uses in close proximity, communities scaled forpedestrianwalkability; limitingtheneedforautomobileusage;higherdensitydevelopment,andtheimportanceofphysical design.Several subsequentapprovalsandamendmentshavetakenplacesincethe2002approval.In2020,theapplicantteamsubmittedarequestforaamendmenttotheRPSP,thatwouldallowforthedevelopmentofupto1,025additionalresidentialunitsundertheRPSP,inexchangeforareductionofuptoapproximately562,457squarefeetofnon-residentialdevelopmentpotentialinaccordancewithspecifieddevelopment scenarios. TheProject was approvedbytheCityCouncil onMarch15, 2022. Thefirst project resultingfromthis approval wasthe333-unitForeApartmentsatRiverParkproject,whichwasapprovedbythePlanningCommissiononJuly21,2022.ThisProjecthasstartedconstruction.Asecondprojectproposed280units,referredtoas“ThePointe”,wassubmittedin2023andiscurrentlymovingthroughtheentitlementprocess.

VillageSpecificPlan(a.k.a.“WagonWheel“)
InJanuary2009,theOxnardCityCouncilapprovedtheentitlementpermitsfortheVillageSpecificPlantoguidefuturedevelopmentonthe62-acreprojectsite. TheVillageSpecificPlanprovidesinfrastructureplans, guidelines, standards, and regulations for up to1,500dwellingunits, 50,300squarefeet ofcommercial development,andrelatedroads,parking,andtransitparking.TheVillageSpecificPlanhasbeendevelopedovertime,withcompletionoftheVillageFamilyApartment(120-unitsaffordabletolower income households) in 2016, Wagon Wheel Junction (mixed-use 219-units and 15,990 sf.commercial)in2019,andvariouslotswithinOxfordFlats(144-unitcondominium),ParkPlace(111-unitcondominiums) and Mayfair (88-unit condominiums) in 2020 through present. In 2023 continued Page7
776
constructionofTownSquare(mixeduse448-unitresidentialwith80oftheunitsrestrictedformoderateincomeand34,310sfofcommercial).

HousingElementAdditiveZoneSites,LockwoodDevelopment
ToaccommodateaffordablehousingonsitesidentifiedinSupplement1oftheHousingElement,theCityamendedthezoneonapproximately63parcelstoincludeanaffordablehousingadditivezone(-AHPand-AHD) ontopof theexistingzoningtoallowdevelopment of 30dwellingunits peracre. Thenewadditivezoneshaveproventobesuccessfulandseveralhousingprojectshavebeenapprovedundertheprogram.Forexample,onHousingElementSite1theLockwoodSeniorApartments(173lower-incomeunits)andtheLockwood2SeniorApartment(168lower-incomeunits)wereunderconstructionin2023,andtheLockwood3Apartments (234units) isproposed.OnHousingElementSite3,whichwasanunderutilizedautodealershipsite, a142-unitdevelopmentwasapprovedin2023andwill provide5unitsaffordabletoverylowincomehouseholdsand18unitsaffordabletolowincomehouseholds.

AccessoryDwellingUnits
Permittingactivityforaccessorydwellingunits(ADU)hasincreasedsignificantly.Statelawrevisionsin2017and2019ledtorevisionstothedevelopmentstandardsfortheseunitsin2019and2020.TheOrdinanceAmendments,incompliancewithStatelaw,madeiteasiertoobtainpermitsforADUsbyreducing fees and parking requirements, allowing for multiple ADUs on each lot, andcreatinganexpedited process for converting existing permittedspace(e.g., inagarageor detachedaccessorystructure)intoanaccessorydwellingunit.ThenumberofADUspermittedin2020wasmorethandoublethenumber of permits issuedin2019, withfurther increases in2021and2022.In2023,87ADUsreceivedplanningpermitapprovals/entitlements,178wereissuedabuildingpermit,and67unitswereconstructedandoccupied. TheHousingElement projects thedevelopment of 283ADUs duringthe2021-2029HousingElementCycle.AsaresultoftheCity’supdatestotheADUordinanceandongoingCitypromotionofADUs,thePlanningDepartmententitled425ADUsin2022and2023,and253ADUswereissuedbuildingpermits in2022and2023.Therefore,theCityisontracktomeettheHousingElementADUprojectionof283unitsasearlyas2024,andcouldsignificantlyexceedthatprojectionbytheendoftheHousingElementcycleonOctober15,2029.

Table1AnnualADUStatistics(Units)
Year
PlanningApplicationsReceived
EntitlementsGranted
BuildingPermitApplicationsReceived
BuildingPermitsIssued
FinalInspection/CO2013 0 0 0 0 02014 1 0 0 0 02015 0 1 0 0 02016 0 0 1 0 02017 17 2 3 0 02018 44 25 20 4 12019 50 55 30 13 3 Page8
777
2020 129 123 111 27 92021 176 157 106 63 142022 327 338 335 75 612023 110* 111* 167 191 73Total 811 855 773 373 161 *InApril 2023, inordertohelpstreamlinetheADUpermittingprocess,Planningnolongerrequiredseparateplanningapplicationandentitlements.

AReviewOfTheCity’sProgressInMeetingTheRegionalHousingNeedAllocation(RHNA)Objectives Statelawrequiresallregionalcouncilsofgovernmenttodeterminetheexistingandprojectedhousingneedforitsregion.TheCityofOxnardisintheregioncoveredbytheSouthernCaliforniaAssociationofGovernments(SCAG).ForeachHousingElementplanningcycle,SCAGisrequiredtodeterminetheshareoftheregionalhousingthatneedstobeallocatedtoeachcityandunincorporatedcountyareaswithintheSCAGregion.ThisiscalledtheRegional HousingNeedAssessment(RHNA)allocation.TheCityofOxnard’sHousingElementwasadoptedbytheOxnardCityCouncilonOctober4,2022andcertifiedbytheStateof California, Department of HousingandCommunityDevelopment(HCD)onOctober25,2022.

TheCitypreparesanAnnualProgressReportthatdocumentsachievementsinmeetingtheobjectivesofthe City’s HousingElement. This Annual Progress Report provides HCDwithanupdateonbuildingactivityduringtheHousingElementcycleandprogressmadetoimplementapprovedHousingElementprograms.Thisyear’sAnnual ProgressReportincludeshousingdataforthe2023calendaryear.Italsoincludes thestatus of adoptedHousingElementprograms.TheAnnual ProgressReportissubmittedusingatemplateprovidedbyHCD.TheseformsareprovidedinExhibit2(HCDTablesA,A2,B,andD).

PlanningandBuildingPermitActivityin2023
AsshowninTable3below,planningentitlementsweregrantedforatotal of254residential unitsin2023. Accessorydwellingunits madeup87of theseunits, withtheremainingunitsresultingfrommultifamilydevelopments,twosinglefamilysubdivisions,andtwosinglefamilydevelopments.

Buildingpermitswereissuedforatotalof641residentialunitsin2023.Oftheseunits,333wereunitslocatedwithintheRiverpark.TheremainderwerelocatedthroughouttheCityandincludedmultifamilyunits,SingleFamilyDwellings,andAccessoryDwellingUnits.ACertificateofOccupancywasgrantedforatotalof372dwellingunitsin2023.

Table2PlanningandBuildingPermitActivityin2023
PlanningEntitlements BuildingPermits CertificatesofOccupancy Page9
778
SingleFamilyDwellings 2 7 4
MultiFamily/Apartments
142 443 295
AccessoryDwellingUnits
110 191 73
Total 254 641 372
MethodologyandReportingRequirementforDeterminingAffordability To categorize the affordability of housing units that were issued building permits, both medianhouseholdincomeandthecostofthenewhousingunitsaretakenintoaccount.AccordingtotheU.S.DepartmentofHousingandUrbanDevelopment(HUD),theannualmedianfamilyincomeforafamilyoffour inVenturaCountyin2023was$123,500Affordablehousingisgenerallydefinedashousingonwhichtheoccupant is payingnomorethan30percentofgrossincomeforhousingcosts,includingutilities.Basedonthis,themaximummonthlyaffordablehousingpaymentforafamilyoffourmakingmedianincomewouldbe$3,088.

CityofOxnard’sProgressinMeetingHousingNeed
AsummaryofdevelopmentactivitybyaffordabilitycategoryisprovidedinTable4below,ascomparedagainst theassignedRHNAtargets for the2021-20296thCycleHousingElement . Atotal of8,549dwellingunitswereallocatedtotheCityofOxnardfor2021to2029.In2023,641unitswereissuedbuildingpermits.Approximately,forty(40)percentoftheunitsissuedbuildingpermitsin2023metthecriteria for placement in the lower-income and moderate income household categories while theremainingdwellingunits(60%)werecategorizedasdwellingsaffordabletoabovemoderatehouseholds.

Table3RegionalHousingNeedsAllocationProgressPermittedUnitsIssuedbyAffordability IncomeLevel
RHNAAllocationbyIncomeLevel
2021(Partial) 2022 2023 2024 2025 2026 2027 2028 2029
TotalUnitstoDate(allyears)
TotalRemainingRHNAbyIncomeLevel
PercentCompleted
VeryLow 1,840 4 101 38 143 1,735 8.24%
Low 1,071 7 78 173 258 986 26.17%
Moderate 1,538 15 3 46 64 1,520 4.21%
AboveModerate 4,100 58 88 384 530 3,954 13.40%
TotalRHNA 8,549
TotalUnits 84 270 641 995 7,554
Page10
779

13.17%
Conclusion
This General PlanAnnual Progress Report has beenpreparedincompliancewithGovernmentCodeSection65400.TheReportistobeprovidedtotheOxnardCityCouncilatapublicmeetingonMarch19,2024,anditwill besubmittedtotheOfficeofPlanningandResearchandtheDepartmentofHousingandCommunityDevelopmentbyApril1,2024.

Exhibits

1. GeneralPlanAmendments(AsofDecember31,2023)

2. 2023CityofOxnardHousingElementAnnualReport/HCDExcelTable Page11
780
Exhibit1GeneralPlanAmendments(AsofDecember31,2023)
AmendmentNumber
AdoptionDate
CityCaseNo.

GeneralPlanAmendmentProjectName
GPAAdoptingReso.No.
1 10/11/201110-620-01
Adoptionof2030GeneralPlan 14,118
2 6/12/201210-620-02
GPAfor2006-2014HousingElement 14,236
3 7/9/201313-620-01
GPA/AmendHousingElementAAHOP 14,424
4 9/9/201414-620-01
ChangeofLandUseDesignationfromIndustrialBusinessandResearchParktoCommercialGeneral 14,684 5 12/9/201414-620-02
RepealLasCortasSpecificPlan 14,708
6 1/26/201615-620-02
ChangeofLandUseDesignationfromIndustrialLighttoIndustrialLimited 14,890 7 6/7/201616-620-01
UpdateSustainability,Infrastructure,andHazardsGoalsandPolicies 14,925 8 12/13/201616-620-03
CreationofUrbanVillageProcess 14,981
9 12/13/201616-620-02
CreationofnewCommunityDevelopmentGoalstoaddresstheSB244provisionsfortheNyelandAcresCommunity 14,983 10 12/13/201615-620-04
Adoptionof2013-2021HousingElement 14,982
11 10/10/201717-620-02
MidCycle2013-2021HousingElementUpdate 15,060
12 12/12/201717-620-03
DesignationofAnnexedSchoolPropertyasSCH 15,074
Page12
781
13 1/30/201817-620-04 CostcoFuelStation 15,086
14 7/16/201918-620-01
AdoptionofDowntownCode(replacetheexisting“CentralBusinessDistrict”landusedesignationwithtwonewdesignations,“Downtown”and“DowntownEdge”andupdatereferencestotheselandusedesignationswithinthegeneralplan.) 15,252 15 2/4/202017-620-01
RioUrbanaHousingProject(approvedSubjecttoLAFCO) 15,299/15,315 16 10/5/2021
21-620-02and21-620-03
Adoptionof2021-2029HousingElementandtextandmapchangestotheGeneralPlanLandUseElement 15,490 17 4/19/202220-620-02
ChangeofLandUseDesignationfromIndustrialBusinessandResearchParktoResidentialMedium 15,564 18 10/4/202221-620-03
Adoptionof2021-2029AmendedHousingElement 15,635
19 12/7/202222-620-01
AmendmenttoSafetyElementofGeneralPlan 15,653
Page13
782
Jurisidiction Name
Reporting Calendar Year
First Name
Last Name
Title Click here to download APR Instructions
Email
Phone
Street Address
City
Zipcode
v_2_15_24
Click here to add rows to a table. If you add too many rows, you may select a cell in the row you wish to remove and type ctrl + d.
214 South C Street
Oxnard
93030
Jeff
Pengilley
Community Development Director
[email protected]
8053858208
Mailing Address
Please Start Here
General Information
2023
Oxnard
Contact Information
Optional: Click here to import last year's data. This is best used when the workbook is new and empty. You will be prompted to pick an old workbook to import from. Project and program data will be copied exactly how it was entered in last year's form and must be updated. If a project is no longer has any reportable activity, you may delete the project by selecting a cell in the row and typing ctrl + d.

Annual Progress Report January 2020
783
Optional: This runs a macro which checks to ensure all required fields are filled out. The macro will create two files saved in the same directory this APR file is saved in. One file will be a copy of the APR with highlighted cells which require information. The other file will be list of the problematic cells, along with a description of the nature of the error.

Optional: Save before running. This copies data on Table A2, and creates another workbook with the table split across 4 tabs, each of which can fit onto a single page for easier printing. Running this macro will remove the comments on the column headers, which contain the instructions. Do not save the APR file after running in order to preserve comments once it is reopened.

Optional: This macro identifies dates entered that occurred outside of the reporting year. RHNA credit is only given for building permits issued during the reporting year.

Link to the online system:https://apr.hcd.ca.gov/APR/login.do Toggles formatting that turns cells green/yellow/red based on data validation rules.

Submittal Instructions
Please save your file as Jurisdictionname2023 (no spaces). Example: the city of San Luis Obispo would save their file as SanLuisObispo2023 Housing Element Annual Progress Reports (APRs) forms and tables must be submitted to HCD and the Governor's Office of Planning and Research (OPR) on or before April 1 of each year for the prior calendar year; submit separate reports directly to both HCD and OPR pursuant to Government Code section 65400. There are two options for submitting APRs:

1. Online Annual Progress Reporting System - Please see the link to the online system to the left. This allows you to upload the completed APR form into directly into HCD’s database limiting the risk of errors. If you would like to use the online system, email [email protected] and HCD will send you the login information for your jurisdiction. Please note: Using the online system only provides the information to HCD. The APR must still be submitted to OPR. Their email address is [email protected].

2. Email - If you prefer to submit via email, you can complete the excel Annual Progress Report forms and submit to HCD at [email protected] and to OPR at [email protected]. Please send the Excel workbook, not a scanned or PDF copy of the tables.
784
Jurisdiction Oxnard
Reporting Year 2023
Housing Element Planning Period 6th Cycle
Current Year
Deed Restricted 16
Non-Deed
Restricted 22
Deed Restricted 74
Non-Deed
Restricted 99
Deed Restricted 17
Non-Deed
Restricted 29
384
641
Units by Structure Type Entitled Permitted Completed
Single-family Attached 0 49 24
Single-family Detached 2 7 4
2 to 4 units per structure 4 2 33
5+ units per structure 138 392 238
Accessory Dwelling Unit 110 191 73
Mobile/Manufactured Home 0 0 0
Total 254 641 372
Infill Housing Developments and Infill Units Permitted # of Projects Units 212 641
0 0
81 532
0 0
0 0
(Jan. 1 - Dec. 31)
10/15/2021 - 10/15/2029
Number of SB 35 Streamlining Applications Approved
Very Low
Low
Moderate
Total Housing Applications Submitted:

Number of Proposed Units in All Applications Received:

Total Housing Units Approved:

Total Housing Units Disapproved:

Total Units
Housing Applications Summary
Use of SB 35 Streamlining Provisions - Applications
Note: Units serving extremely low-income households are included in the very low-income permitted units totals Number of SB 35 Streamlining Applications
Above Moderate
Indicated as Infill
Not Indicated as Infill
Building Permits Issued by Affordability Summary
Income Level
785
Income Rental Ownership Total
Very Low 0 0 0
Low 0 0 0
Moderate 0 0 0
Above Moderate 0 0 0
Total 0 0 0
Streamlining Provisions Used - Permitted Units # of Projects Units SB 9 (2021) - Duplex in SF Zone 0 0
SB 9 (2021) - Residential Lot Split 0 0
AB 2011 (2022) 0 0
SB 6 (2022) 0 0
SB 35 (2017) 0 0
Ministerial and Discretionary Applications # of Applications Units Ministerial 78 248
Discretionary 3 284
Density Bonus Applications and Units Permitted
Number of Applications Submitted Requesting a Density Bonus 3 Number of Units in Applications Submitted Requesting a Density Bonus 421 Number of Projects Permitted with a Density Bonus 1
Number of Units in Projects Permitted with a Density Bonus 58 Housing Element Programs Implemented and Sites Rezoned Count 42 0
Programs Implemented
Sites Rezoned to Accommodate the RHNA
Units Constructed - SB 35 Streamlining Permits
786
Jurisdiction Oxnard ANNUAL ELEMENT PROGRESS REPORT Note: "+" indicates an optional field Reporting Year 2023 (Jan. 1 - Dec. 31) Housing Element Implementation Planning Period 6th Cycle 10/15/2021 - 10/15/2029
Date
Application
Submitted
Total
Approved
Units by
Project
Total
Disapproved
Units by
Project
Streamlining Application
Status Project Type Notes
2 3 4 6 7 8 9 11 12 13
Prior APN+ Current APN Street Address Project Name+ Local Jurisdiction Tracking ID
Unit Category
(SFA,SFD,2 to
4,5+,ADU,MH)
Tenure
R=Renter
O=Owner
Date
Application
Submitted
(see
instructions)
Very Low-
Income Deed
Restricted
Very Low-
Income Non
Deed
Restricted
Low-Income
Deed
Restricted
Low-Income
Non Deed
Restricted
Moderate-
Income Deed
Restricted
Moderate-
Income
Non Deed
Restricted
Above
Moderate-
Income
Total PROPOSED
Units by Project
Total

APPROVED
Units by project
Total

DISAPPROVED
Units by Project
Please select
streamlining
provision/s the
application was
submitted pursuant
to.

Did the housing
development
application seek
incentives or
concessions
pursuant to
Government Code
section 65915?
Were incentives
or concessions
reqested
pursuant to
Government
Code section
65915 approved?
Please indicate
the status of the
application.

Is the project
considered a
ministerial
project or
discretionary
project?
Notes+
Summary Row: Start Data Entry Below 16 2 32 79 0 29 374 532 0 0 200-0-062-1251301 Kingswood
Way 23-131-01
ADU R
1/3/2023
1 1 NONE No N/A Approved Ministerial
200-0-062-1251301 Kingswood
Way 23-131-02
ADU R
1/3/2023
1 1 NONE No N/A Approved Ministerial
201-0-152-010 205 Lupita
Street 23-131-03 ADU R
1/9/2023
1 1 NONE No N/A Approved Ministerial
221-0-201-075 3811 Terrace
Drive 23-131-04 ADU R
1/10/2023
1 1 NONE No N/A Approved Ministerial
221-0-201-075 3811 Terace
Drive 23-131-05 ADU R
1/10/2023
1 1 NONE No N/A Approved Ministerial
183-0-292-1152414 E El Cajon
Way 23-131-06 ADU R
1/12/2023
1 1 NONE No N/A Approved Ministerial
213-0-090-295 2152 Lockwood
St 23-131-07 ADU R
1/12/2023
15 15 NONE No N/A Approved Ministerial
213-0-090-205 2001 Outlet
Center Dr 23-131-08 ADU R
1/12/2023
20 20 NONE No N/A Approved Ministerial
204-0-161-130637 E Iris St 23-131-09 ADU R 1/17/2023 1 1 NONE No N/A Approved Ministerial 205-0-341-0754127 S J St 23-131-10 ADU R 1/19/2023 1 1 NONE No N/A Approved Ministerial 205-0-132-1754717 S A ST 23-131-11 ADU R 1/25/2023 1 1 NONE No N/A Approved Ministerial 203-0-061-110501 Wolff ST 23-131-12 ADU R 1/26/2023 1 1 NONE No N/A Approved Ministerial 203-0-201-1151150 W Fir St 23-131-13 ADU R 1/30/2023 1 1 NONE No N/A Approved Ministerial 200-0-191-140 637 W Robert
Ave 23-131-14 ADU R
1/30/2023
1 1 NONE No N/A Approved Ministerial
172-0-120-305500 E Dollie St 23-131-15 ADU R 1/30/2023 1 1 NONE No N/A Approved Ministerial 203-0-011-4501239 S M St 23-131-16 ADU R 1/31/2023 1 1 NONE No N/A Approved Ministerial 142-0-295-0251903 Snow Ave 23-131-17 ADU R
2/2/2023
1 1 NONE No N/A Approved Ministerial
203-0-080-230 211 West Hill
ST 23-131-18 ADU R
2/2/2023
1 1 NONE No N/A Approved Ministerial
201-0-061-050 409 N McKinley
ST 23-131-19 ADU R
2/2/2023
1 1 NONE No N/A Approved Ministerial
203-0-080-230 211 West Hill
ST 23-131-20 ADU R
2/2/2023
1 1 NONE No N/A Approved Ministerial
203-0-316-2851708 S E St 23-131-21 ADU R 2/7/2023 1 1 NONE No N/A Approved Ministerial 205-0-234-035 930 Palomar
Way 23-131-22 ADU R
2/8/2023
1 1 NONE No N/A Approved Ministerial
219-0-376-185 525 De Anza
Way 23-131-23 ADU R
2/8/2023
1 1 NONE No N/A Approved Ministerial
203-0-242-185931 W Iris St 23-131-24 ADU R 2/9/2023 1 1 NONE No N/A Approved Ministerial 205-0-454-105 500 Van Ness
Ave 23-131-25 ADU R
2/9/2023
1 1 NONE No N/A Approved Ministerial
220-0-102-045 2450 Alexander
ST 23-131-26 ADU R
2/14/2023
1 1 NONE No N/A Approved Ministerial
205-0-032-175 1130 Redwood
St 23-131-27 ADU R
2/15/2023
1 1 NONE No N/A Approved Ministerial
205-0-032-175 1130 Redwood
St 23-131-28 ADU R
2/15/2023
1 1 NONE No N/A Approved Ministerial
203-0-092-220 1313 W Cedar
St 23-131-29 ADU R
2/15/2023
1 1 NONE No N/A Approved Ministerial
203-0-092-220 1313 W Cedar
St 23-131-30 ADU R
2/15/2023
1 1 NONE No N/A Approved Ministerial
204-0-112-220371 E Guava St 23-131-31 ADU R
2/21/2023
1 1 NONE No N/A Approved Ministerial
202-0-134-170659 S D St 23-131-32 ADU R 2/21/2023 1 1 NONE No N/A Approved Ministerial 221-0-026-325 4610 Terrace
Ave 23-131-33 ADU R
2/21/2023
1 1 NONE No N/A Approved Ministerial
221-0-026-305 4630 Terrace
Ave 23-131-34 ADU R
2/21/2023
1 1 NONE No N/A Approved Ministerial
205-0-192-0352625 S N ST 23-131-35 ADU R 2/21/2023 1 1 NONE No N/A Approved Ministerial 224-0-033-085 4500 Phoenix
Drive 23-131-36 ADU R
2/21/2023
1 1 NONE No N/A Approved Ministerial
Table A
Cells in grey contain auto-calculation formulas
51 Project Identifier Unit Types Proposed Units - Affordability by Household Incomes Density Bonus Law Applications
10 Housing Development Applications Submitted
787
224-0-033-085 4500 Phoenix
Drive 23-131-37 ADU R
2/21/2023
1 1 NONE No N/A Approved Ministerial
205-0-222-0853410 S J St 23-131-38 ADU R 2/28/2023 1 1 NONE No N/A Approved Ministerial 200-0-323-160324 Palm Dr 23-131-39 ADU R 2/22/2023 1 1 NONE No N/A Approved Ministerial 204-0-232-195623 Poplar St 23-131-40 ADU R 2/22/2023 1 1 NONE No N/A Approved Ministerial 181-0-094-045 1700 Firethorne
Pl 23-131-41 ADU R
2/22/2023
1 1 NONE No N/A Approved Ministerial
201-0-114-230 144 S Hayes
Ave 23-131-42 ADU R
3/2/2023
1 1 NONE No N/A Approved Ministerial
181-0-081-0552100 Oneida Pl 23-131-43 ADU R
3/2/2023
1 1 NONE No N/A Approved Ministerial
200-0-143-260 523 Devonshire
Dr 23-131-44 ADU R
3/2/2023
1 1 NONE No N/A Approved Ministerial
200-0-143-260 523 Devonshire
Dr 23-131-45 ADU R
3/2/2023
1 1 NONE No N/A Approved Ministerial
222-0-112-095 5305 S Saviers
Rd 23-131-46 ADU R
3/7/2023
1 1 NONE No N/A Approved Ministerial
201-0-153-120130 Lupita St 23-131-47 ADU R 3/7/2023 1 1 NONE No N/A Approved Ministerial 222-0-112-105 5309 S Saviers
Rd 23-131-48 ADU R
3/7/2023
1 1 NONE No N/A Approved Ministerial
222-0-112-115 5313 S Saviers
Rd 23-131-49 ADU R
3/7/2023
1 1 NONE No N/A Approved Ministerial
205-0-074-2353014 S C St 23-131-50 ADU R 3/7/2023 1 1 NONE No N/A Approved Ministerial 204-0-072-150242 E Ash St 23-131-51 ADU R 3/14/2023 1 1 NONE No N/A Approved Ministerial 200-0-172-2901009 Doris Ave 23-131-52 ADU R
3/14/2023
1 1 NONE No N/A Approved Ministerial
205-0-243-1854230 S A St 23-131-53 ADU R 3/16/2023 1 1 NONE No N/A Approved Ministerial 201-0-063-240 400 N. BONITA
ST 23-131-54 ADU R
3/21/2023
1 1 NONE No N/A Approved Ministerial
203-0-143-0951419 W. Elm St 23-131-55 ADU R
3/22/2023
1 1 NONE No N/A Approved Ministerial
203-0-143-0951419 W. Elm St 23-131-56 ADU R
3/22/2023
1 1 NONE No N/A Approved Ministerial
220-0-052-1252450 Trinity Pl 23-131-57 ADU R 3/22/2023 1 1 NONE No N/A Approved Ministerial 220-0-052-1252450 Trinity Pl 23-131-58 ADU R 3/22/2023 1 1 NONE No N/A Approved Ministerial 200-0-323-080 305 Magnolia
Ave 23-131-59 ADU R
3/22/2023
1 1 NONE No N/A Approved Ministerial
205-0-132-1954726 S B St 23-131-60 ADU R 3/24/2023 1 1 NONE No N/A Approved Ministerial 201-0-312-1551467 Morris St 23-131-61 ADU R 3/29/2023 1 1 NONE No N/A Approved Ministerial 201-0-312-1551467 Morris St 23-131-62 ADU R 3/29/2023 1 1 NONE No N/A Approved Ministerial 142-0-142-0452211 Isabella St 23-131-63 ADU R
4/4/2023
1 1 NONE No N/A Approved Ministerial
202-0-071-150210 S. F St. 23-131-64 ADU R 4/5/2023 1 1 NONE No N/A Approved Ministerial 186-0-094-055 2120 El Cajon
Way 23-131-65 ADU R
4/6/2023
1 1 NONE No N/A Approved Ministerial
202-0-052-130128 S C St 23-131-66 ADU R 4/7/2023 1 1 NONE No N/A Approved Ministerial 202-0-052-130128 S C St 23-131-67 ADU R 4/7/2023 1 1 NONE No N/A Approved Ministerial 222-0-095-075 620 Cuesta Del
Mar 23-131-68 ADU R
4/10/2023
1 1 NONE No N/A Approved Ministerial
200-0-283-170300 N J St 23-131-69 ADU R 4/11/2023 1 1 NONE No N/A Approved Ministerial 225-0-034-0953201 Merced Pl 23-131-70 ADU R
4/11/2023
1 1 NONE No N/A Approved Ministerial
220-0-051-0452451 Trinity Pl 23-131-71 ADU R 4/11/2023 1 1 NONE No N/A Approved Ministerial 203-0-022-2001158 S M St 23-131-72 ADU R 4/11/2023 1 1 NONE No N/A Approved Ministerial 142-0-152-0552271 Mono St 23-131-73 ADU R 4/12/2023 1 1 NONE No N/A Approved Ministerial 142-0-122-0651320 Sabrina St 23-131-75 ADU R
4/18/2023
1 1 NONE No N/A Approved Ministerial
202-0-063-080452 S. H St 23-131-76 ADU R 4/20/2023 1 1 NONE No N/A Approved Ministerial 200-0-074-245 551 Kentwood
Dr. 23-131-77 ADU R
4/24/2023
1 1 NONE No N/A Approved Ministerial
202-0-045-100417 W. First St 21-131-79 ADU R 1/12/2023 1 1 NONE No N/A Approved Ministerial 213-0-090-2752151 Lockwood
Street 20-500-04
5+ R
7/31/2023
8 30 197 235 NONE Yes Yes Pending Discretionary
225-0-014-275, -
265, and -250
2300 East
Pleasant Valley
Road
23-500-10
5+ R
11/8/2023
3 2 43 48 NONE Yes Yes Pending Discretionary
222-0-051-050 412 Howell
Road 23-200-07 SFD O
5/23/2023
1 1 NONE No No Approved Discretionary
200-0-100-0201345 N. Oxnard
Boulevard 21-200-11
5+ R
7/12/2023
5 18 115 138 NONE Yes Yes Approved Ministerial
788
Jurisdiction Oxnard ANNUAL ELEMENT PROGRESS REPORT
Reporting Year 2023 (Jan. 1 - Dec. 31) Housing Element Implementation Cells in grey contain auto-calculation formulas Planning Period 6th Cycle 10/15/2021 - 10/15/2029
Table A2
Streamlining Infill
Housing without Financial
Assistance or Deed
Restrictions
Term of Affordability
or Deed Restriction Notes
2 3 5 6 8 9 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 Prior APN+ Current APN Street Address Project Name+ Local Jurisdiction Tracking ID
Unit Category
(SFA,SFD,2 to
4,5+,ADU,MH)
Tenure
R=Renter
O=Owner
Very Low-
Income Deed
Restricted
Very Low-
Income Non
Deed Restricted
Low- Income
Deed
Restricted
Low- Income
Non Deed
Restricted
Moderate-
Income Deed
Restricted
Moderate-
Income Non
Deed Restricted
Above
Moderate-
Income
Entitlement
Date Approved# of Units issued
Entitlements
Very Low-
Income Deed
Restricted
Very Low-
Income Non
Deed Restricted
Low- Income
Deed
Restricted
Low- Income
Non Deed
Restricted
Moderate-
Income Deed
Restricted
Moderate-
Income Non
Deed Restricted
Above
Moderate-
Income
Building Permits
Date Issued
# of Units Issued
Building Permits
Very Low-
Income Deed
Restricted
Very Low-
Income Non
Deed
Restricted
Low- Income
Deed
Restricted
Low- Income
Non Deed
Restricted
Moderate-
Income Deed
Restricted
Moderate-
Income Non
Deed Restricted
Above
Moderate-
Income
Certificates of
Occupancy or other
forms of readiness
(see instructions)
Date Issued
# of Units
issued
Certificates of
Occupancy or
other forms of
readiness
How many of the
units were
Extremely Low
Income?
Please select the
streamlining
provision the project
was APPROVED
pursuant to. (may
select multiple)
Infill Units?
Y/N+
Assistance Programs
for Each Development
(may select multiple -
see instructions)
Deed Restriction
Type
(may select multiple -
see instructions)
For units affordable without
financial assistance or deed
restrictions, explain how the
locality determined the units
were affordable
(see instructions)
Term of Affordability or
Deed Restriction (years)
(if affordable in perpetuity
enter 1000)+
Number of
Demolished/Destroyed
Units
Demolished or
Destroyed Units
Demolished/Des
troyed Units
Owner or
Renter
Total Density Bonus Applied to
the Project (Percentage
Increase in Total Allowable
Units or Total Maximum
Allowable Residential Gross
Floor Area)
Number of Other
Incentives,
Concessions, Waivers,
or Other Modifications
Given to the Project
(Excluding Parking
Waivers or Parking
Reductions)
List the incentives,
concessions,
waivers, and
modifications
(Excluding Parking
Waivers or Parking
Modifications)
Did the project receive a
reduction or waiver of
parking standards? (Y/N)
Notes+
Summary Row: Start Data Entry Below 5 2 18 61 0 29 139 254 16 22 74 99 17 29 384 641 0 10 0 28 43 7 284 372 0 0 202-0-045-100 417 W. First St 21-131-79 ADU R 1 1/12/2023 1 0 0 NONE Y Applicant provided estimated rental price
200-0-062-125 1301 Kingswood
Way 23-131-01 ADU R 1 1/3/2023 1 0 0 NONE Y Applicant provided estimated rental price
200-0-062-125 1301 Kingswood
Way 23-131-02 ADU R 1 1/3/2023 1 0 0 NONE Y Applicant provided estimated rental price
201-0-152-010 205 Lupita Street 23-131-03 ADU R 1 1/9/2023 1 1 11/7/2023 1 0 NONE Y Applicant provided estimated rental price
221-0-201-075 3811 Terrace Drive 23-131-04 ADU R 1 1/10/2023 1 0 0 NONE Y Applicant provided estimated rental price
221-0-201-075 3811 Terace Drive 23-131-05 ADU R 1 1/10/2023 1 0 0 NONE Y Applicant provided estimated rental price
183-0-292-115 2414 E El Cajon
Way 23-131-06 ADU R 1 1/12/2023 1 0 0 NONE Y
213-0-090-295 2152 Lockwood St 23-131-07 ADU R 15 1/12/2023 15 0 0 NONE Y Applicant provided estimated rental price
213-0-090-2052001 Outlet Center
Dr 23-131-08 ADU R 20 1/12/2023 20 0 0 NONE Y Applicant provided estimated rental price
204-0-161-130 637 E Iris St 23-131-09 ADU R 1 1/17/2023 1 0 0 NONE Y 205-0-341-075 4127 S J St 23-131-10 ADU R 1 1/19/2023 1 0 0 NONE Y 205-0-132-175 4717 S A ST 23-131-11 ADU R 1 1/25/2023 1 0 0 NONE Y 203-0-061-110 501 Wolff ST 23-131-12 ADU R 1 1/26/2023 1 0 0 NONE Y Applicant provided estimated rental price
203-0-201-115 1150 W Fir St 23-131-13 ADU R 1 1/30/2023 1 0 0 NONE Y Applicant provided estimated rental price
200-0-191-140 637 W Robert Ave 23-131-14 ADU R 1 1/30/2023 1 0 0 NONE Y Applicant provided estimated rental price
172-0-120-305 500 E Dollie St 23-131-15 ADU R 1 1/30/2023 1 1 10/2/2023 1 0 NONE Y Applicant provided estimated rental price
203-0-011-450 1239 S M St 23-131-16 ADU R 1 1/31/2023 1 0 0 NONE Y Applicant provided estimated rental price
142-0-295-025 1903 Snow Ave 23-131-17 ADU R 1 2/2/2023 1 0 0 NONE Y Applicant provided estimated rental price
203-0-080-230 211 West Hill ST 23-131-18 ADU R 1 2/2/2023 1 0 0 NONE Y Applicant provided estimated rental price
201-0-061-050 409 N McKinley ST 23-131-19 ADU R 1 2/2/2023 1 0 0 NONE Y Applicant provided estimated rental price
203-0-080-230 211 West Hill ST 23-131-20 ADU R 1 2/2/2023 1 0 0 NONE Y Applicant provided estimated rental price
203-0-316-285 1708 S E St 23-131-21 ADU R 1 2/7/2023 1 1 10/18/2023 1 0 NONE Y Applicant provided estimated rental price
205-0-234-035 930 Palomar Way 23-131-22 ADU R 1 2/8/2023 1 0 0 NONE Y Applicant provided estimated rental price
219-0-376-185 525 De Anza Way 23-131-23 ADU R 1 2/8/2023 1 0 0 NONE Y Applicant provided estimated rental price
203-0-242-185 931 W Iris St 23-131-24 ADU R 1 2/9/2023 1 0 0 NONE Y Applicant provided estimated rental price
205-0-454-105 500 Van Ness Ave 23-131-25 ADU R 1 2/9/2023 1 0 0 NONE Y Applicant provided estimated rental price
220-0-102-045 2450 Alexander ST 23-131-26 ADU R 1 2/14/2023 1 0 0 NONE Y Applicant provided estimated rental price
205-0-032-1751130 Redwood St 23-131-27 ADU R 1 2/15/2023 1 1 11/13/2023 1 0 NONE Y 205-0-032-175 1130 Redwood St 23-131-28 ADU R 1 2/15/2023 1 1 6/15/2023 1 1 8/10/2023 1 NONE Y Applicant provided estimated rental price
203-0-092-2201313 W Cedar St 23-131-29 ADU R 1 2/15/2023 1 0 0 NONE Y 203-0-092-220 1313 W Cedar St 23-131-30 ADU R 1 2/15/2023 1 1 8/16/2023 1 0 NONE Y Applicant provided estimated rental price
204-0-112-220 371 E Guava St 23-131-31 ADU R 1 2/21/2023 1 0 0 NONE Y Applicant provided estimated rental price
202-0-134-170 659 S D St 23-131-32 ADU R 1 2/21/2023 1 0 0 NONE Y Applicant provided estimated rental price
221-0-026-325 4610 Terrace Ave 23-131-33 ADU R 1 2/21/2023 1 1 12/28/2023 1 0 NONE Y Applicant provided estimated rental price
221-0-026-305 4630 Terrace Ave 23-131-34 ADU R 1 2/21/2023 1 0 0 NONE Y Applicant provided estimated rental price
205-0-192-035 2625 S N ST 23-131-35 ADU R 1 2/21/2023 1 1 12/6/2023 1 0 NONE Y Applicant provided estimated rental price
224-0-033-085 4500 Phoenix Drive 23-131-36 ADU R 1 2/21/2023 1 0 0 NONE Y 224-0-033-085 4500 Phoenix Drive 23-131-37 ADU R 1 2/21/2023 1 0 0 NONE Y 205-0-222-085 3410 S J St 23-131-38 ADU R 1 2/28/2023 1 0 0 NONE Y 200-0-323-160 324 Palm Dr 23-131-39 ADU R 1 2/22/2023 1 0 0 NONE Y Applicant provided estimated rental price
204-0-232-195 623 Poplar St 23-131-40 ADU R 1 2/22/2023 1 0 0 NONE Y Applicant provided estimated rental price
181-0-094-045 1700 Firethorne Pl 23-131-41 ADU R 1 2/22/2023 1 0 1 7/31/2023 1 NONE Y Applicant provided estimated rental price
201-0-114-230 144 S Hayes Ave 23-131-42 ADU R 1 3/2/2023 1 0 0 NONE Y Applicant provided estimated rental price
181-0-081-055 2100 Oneida Pl 23-131-43 ADU R 1 3/2/2023 1 0 0 NONE Y Applicant provided estimated rental price
200-0-143-260 523 Devonshire Dr 23-131-44 ADU R 1 3/2/2023 1 0 0 NONE Y Applicant provided estimated rental price
200-0-143-260 523 Devonshire Dr 23-131-45 ADU R 1 3/2/2023 1 0 0 NONE Y Applicant provided estimated rental price
222-0-112-095 5305 S Saviers Rd 23-131-46 ADU R 1 3/7/2023 1 0 0 NONE Y Applicant provided estimated rental price
201-0-153-120 130 Lupita St 23-131-47 ADU R 1 3/7/2023 1 0 0 NONE Y 222-0-112-105 5309 S Saviers Rd 23-131-48 ADU R 1 3/7/2023 1 0 0 NONE Y Applicant provided estimated rental price
222-0-112-115 5313 S Saviers Rd 23-131-49 ADU R 1 3/7/2023 1 0 0 NONE Y Applicant provided estimated rental price
205-0-074-235 3014 S C St 23-131-50 ADU R 1 3/7/2023 1 0 0 NONE Y Applicant provided estimated rental price
204-0-072-150 242 E Ash St 23-131-51 ADU R 1 3/14/2023 1 0 0 NONE Y 200-0-172-290 1009 Doris Ave 23-131-52 ADU R 1 3/14/2023 1 0 0 NONE Y Applicant provided estimated rental price
205-0-243-185 4230 S A St 23-131-53 ADU R 1 3/16/2023 1 1 12/19/2023 1 0 NONE Y Applicant provided estimated rental price
201-0-063-240 400 N. BONITA ST 23-131-54 ADU R 1 3/21/2023 1 0 0 NONE Y Applicant provided estimated rental price
203-0-143-095 1419 W. Elm St 23-131-55 ADU R 1 3/22/2023 1 0 0 NONE Y Applicant provided estimated rental price
203-0-143-095 1419 W. Elm St 23-131-56 ADU R 1 3/22/2023 1 0 0 NONE Y Applicant provided estimated rental price
220-0-052-125 2450 Trinity Pl 23-131-57 ADU R 1 3/22/2023 1 0 0 NONE Y 220-0-052-125 2450 Trinity Pl 23-131-58 ADU R 1 3/22/2023 1 0 0 NONE Y 200-0-323-080 305 Magnolia Ave 23-131-59 ADU R 1 3/22/2023 1 0 0 NONE Y Applicant provided estimated rental price
205-0-132-195 4726 S B St 23-131-60 ADU R 1 3/24/2023 1 0 0 NONE Y 201-0-312-155 1467 Morris St 23-131-61 ADU R 1 3/29/2023 1 0 0 NONE Y Applicant provided estimated rental price
201-0-312-155 1467 Morris St 23-131-62 ADU R 1 3/29/2023 1 0 0 NONE Y Applicant provided estimated rental price
142-0-142-045 2211 Isabella St 23-131-63 ADU R 1 4/4/2023 1 1 8/28/2023 1 1 12/8/2023 1 NONE Y Applicant provided estimated rental price
202-0-071-150 210 S. F St. 23-131-64 ADU R 1 4/5/2023 1 0 0 NONE Y 186-0-094-055 2120 El Cajon Way 23-131-65 ADU R 1 4/6/2023 1 0 0 NONE Y Applicant provided estimated rental price
202-0-052-130 128 S C St 23-131-66 ADU R 1 4/7/2023 1 0 0 NONE Y Applicant provided estimated rental price
202-0-052-130 128 S C St 23-131-67 ADU R 1 4/7/2023 1 0 0 NONE Y Applicant provided estimated rental price
222-0-095-075 620 Cuesta Del
Mar 23-131-68 ADU R 1 4/10/2023 1 0 0 NONE Y Applicant provided estimated rental price
200-0-283-170 300 N J St 23-131-69 ADU R 1 4/11/2023 1 0 0 NONE Y Applicant provided estimated rental price
225-0-034-095 3201 Merced Pl 23-131-70 ADU R 1 4/11/2023 1 0 0 NONE Y 220-0-051-045 2451 Trinity Pl 23-131-71 ADU R 1 4/11/2023 1 0 0 NONE Y 203-0-022-200 1158 S M St 23-131-72 ADU R 1 4/11/2023 1 0 0 NONE Y Applicant provided estimated rental price
142-0-152-055 2271 Mono St 23-131-73 ADU R 1 4/12/2023 1 0 0 NONE Y 142-0-122-065 1320 Sabrina St 23-131-75 ADU R 1 4/18/2023 1 0 0 NONE Y Applicant provided estimated rental price
202-0-063-080 452 S. H St 23-131-76 ADU R 1 4/20/2023 1 0 0 NONE Y Applicant provided estimated rental price
200-0-074-245 551 Kentwood Dr. 23-131-77 ADU R 1 4/24/2023 1 0 0 NONE Y Applicant provided estimated rental price
219-0-015-100 175 Frank Ave 23-1585 ADU R 0 1 10/24/2023 1 0 NONE Y Applicant provided estimated rental price
179-0-085-095 2110 Patricia St 23-2442 ADU R 0 1 12/18/2023 1 0 NONE Y Applicant provided estimated rental price
204-0-081-160 115 E Date St 23-1692 ADU R 0 1 10/17/2023 1 0 NONE Y Applicant provided estimated rental price
205-0-243-165 201 W Bard Rd 19-3973 ADU R 0 1 2/14/2023 1 1 9/29/2023 1 NONE Y 222-0-051-050412 Howell Road 23-200-07 SFD O 1 12/19/2023 1 0 0 NONE Y 200-0-100-020 1345 N. Oxnard
Boulevard 21-200-11 5+ R 5 18 115 8/17/2023
138
0 0 NONE Y Other Other 50.0%
3 Development
Standards
Modification
Yes
Used both inclusionary
and density bonus
191-0-081-365 1105 Capri Way 22-400-05 SFD O 1 6/22/2023 1 0 0 NONE Y 196-0-031-155940 Dunes Street 22-400-01 2 to 4 R 2 2/2/2023 2 0 0 NONE Y 196-0-032-015 920 Catamaran
Street 22-400-04 2 to 4 R 2 4/20/2023 2 0 0 NONE Y
204-0-232-085 604 Olive St 22-131-104 ADU R 1 5/24/2022 1 1 12/20/2023 1 0 0 NONE Y Applicant provided estimated rental price
219-0-082-115 3341 Paula St 22-131-121 ADU R 1 7/5/2022 1 1 9/5/2023 1 0 NONE Y Applicant provided estimated rental price
219-0-082-115 3341 Paula St 22-131-122 ADU R 1 7/5/2022 1 0 0 NONE Y Applicant provided estimated rental price
204-0-161-140 633 Iris Street 18-2453 ADU R 0 1 3/28/2023 1 0 NONE Y 205-0-153-175 3043 South M
Street 20-1999 ADU R 0 1 4/3/2023 1 0 0 NONE Y Applicant provided estimated rental price
183-0-324-075 1521 Piedmont
Street 20-2137 ADU R 0 1 8/7/2023 1 1 12/4/2023 1 NONE Y 203-0-101-185 950 Cedar Ct Apt 5 20-2730 ADU R 0 1 7/12/2023 1 0 NONE Y 200-0-284-130 205 N H Street 20-2928 ADU R 0 1 8/21/2023 1 0 NONE Y Applicant provided estimated rental price
201-0-055-080 321 N Roosevelt 20-3905 ADU R 0 1 2/14/2023 1 1 5/23/2023 1 NONE Y 201-0-033-170 474 N Bonita 21-0291 ADU R 0 1 3/6/2023 1 0 NONE Y Applicant provided estimated rental price
225-0-033-035 3020 Merced 21-0332 ADU R 0 1 2/6/2023 1 0 NONE Y 205-0-064-075460 TEAKWOOD
ST 21-1468 ADU R 0 2 5/11/2023 2 0 NONE Y Applicant provided estimated rental price
204-0-152-200435 E LAUREL ST 21-1646 ADU R 0 1 1/17/2023 1 0 NONE Y 205-0-222-035 3327 S G ST 21-1820 ADU R 0 2 3/29/2023 2 0 NONE Y Applicant provided estimated rental price
204-0-131-040245 E HEMLOCK
ST 21-2087 ADU R 0 1 2/1/2023 1 1 8/2/2023 1 NONE Y Applicant provided estimated rental price
205-0-042-175 930 REDWOOD
ST 21-2246 ADU R 0 1 2/21/2023 1 0 NONE Y Applicant provided estimated rental price
200-0-163-1051035 RODERICK
AVE 21-2522 ADU R 0 1 8/24/2023 1 0 NONE Y
224-0-081-365 4330 DRAKE DR 21-2597 ADU R 0 1 9/21/2023 1 0 NONE Y Applicant provided estimated rental price
219-0-413-0753800 SAN SIMEON
AVE 21-2634 ADU R 0 1 8/3/2023 1 0 NONE Y
185-0-012-155 3561 TAFFRAIL LN 21-2701 ADU R 0 1 4/27/2023 1 1 9/29/2023 1 NONE Y 215-0-114-025 1626 OFELIA WAY 21-2768 ADU R 0 1 2/15/2023 1 1 9/7/2023 1 NONE Y 220-0-084-1252064 SAN BENITO
St 21-2829 ADU R 0 1 4/3/2023 1 0 NONE Y
215-0-055-140 1215 LIADA WAY 21-2903 ADU R 0 1 1/27/2023 1 0 0 NONE Y Applicant provided estimated rental price
205-0-242-165 4006 S B ST 21-2913 ADU R 0 1 4/19/2023 1 0 NONE Y 202-0-265-135 1145 RIGGING
PLACE 21-2980 ADU R 0 1 11/30/2023 1 0 NONE Y
Density Bonus
1 Unit Types Affordability by Household Incomes - Completed Entitlement Affordability by Household Incomes - Building Permits Affordability by Household Incomes - Certificates of Occupancy 4 7 10
Note: "+" indicates an optional field
Housing with Financial Assistance
and/or Deed Restrictions Demolished/Destroyed UnitsProject Identifier Annual Building Activity Report Summary - New Construction, Entitled, Permits and Completed Units 789
Jurisdiction Oxnard ANNUAL ELEMENT PROGRESS REPORT
Reporting Year 2023 (Jan. 1 - Dec. 31) Housing Element Implementation Cells in grey contain auto-calculation formulas Planning Period 6th Cycle 10/15/2021 - 10/15/2029
Note: "+" indicates an optional field
221-0-071-1454300 HIGHLAND
AVE 21-3330 ADU R 0 1 2/8/2023 1 1 6/27/2023 1 NONE Y
205-0-315-2251031 W CHANNEL
ISLAND BLVD 21-3351 ADU R
0 1 3/22/2023 1 0 NONE Y
201-0-322-0151532 MORRIS ST 21-3450 ADU R 0 1 6/7/2023 1 1 11/21/2023 1 NONE Y 219-0-344-015 300 DE ANZA 21-3450 ADU R 0 1 3/10/2023 1 0 NONE Y 202-0-030-490 130 S H ST 21-3840 ADU R 0 1 5/2/2023 1 0 NONE Y 225-0-075-1252144 ABBOTT ST 21-4134 ADU R 0 1 3/1/2023 1 0 NONE Y 187-0-026-115 1521 FATHOM DR 21-4235 ADU R 0 2 2/21/2023 2 0 NONE Y Applicant provided estimated rental price
215-0-094-105 625 VALENTINA
DR 21-4316 ADU R 0 1 9/12/2023 1 0 NONE Y
215-0-200-185 1303 EVITA PL 21-4457 ADU R 0 1 4/25/2023 1 0 NONE Y Applicant provided estimated rental price
205-0-052-045633 SPRUCE ST 21-4595 ADU R 0 1 7/19/2023 1 1 11/21/2023 1 NONE Y 201-0-064-330 911 COOPER RD 21-4741 ADU R 0 1 3/1/2023 1 0 NONE Y Applicant provided estimated rental price
183-0-352-2051431 WOODLAND
ST 21-4920 ADU R 0 1 6/30/2023 1 0 0 NONE Y Applicant provided estimated rental price
200-0-183-075824 N H STREET 21-4979 ADU R 0 1 4/12/2023 1 0 NONE Y 219-0-401-1253500 SAN SIMEON
AVE 21-5005 ADU R 0 1 11/20/2023 1 0 NONE Y
200-0-283-060 333 N. I STRET 21-5112 ADU R 0 1 4/11/2023 1 0 NONE Y Applicant provided estimated rental price
201-0-123-140161 N GARFIELD
AVE 22-264 ADU R 0 1 1/12/2023 1 1 5/2/2023 1 NONE Y
201-0-123-150165 N GARFIELD
AVE 22-265 ADU R 0 1 1/12/2023 1 1 5/2/2023 1 NONE Y
201-0-123-160 168 N GRANT AVE 22-279 ADU R 0 1 1/12/2023 1 0 NONE Y 201-0-123-130 164 N GRANT AVE 22-277 ADU R 0 1 1/12/2023 1 0 NONE Y 219-0-062-0152904 FOURNIER
ST 22-406 ADU R 0 1 4/7/2023 1 0 NONE Y
202-0165-270 926 KING ST 22-412 ADU R 0 1 10/31/2023 1 0 NONE Y Applicant provided estimated rental price
204-0-074-290325 E CEDAR ST 22-502 ADU R 0 1 7/25/2023 1 0 NONE Y 142-0-293-085 942 BANCAL WAY 22-507 ADU R 0 1 4/25/2023 1 1 8/9/2023 1 NONE Y Applicant provided estimated rental price
203-0-212-240 308 W. FIR AVE 22-568 ADU R 0 2 8/14/2023 2 0 NONE Y Applicant provided estimated rental price
220-0-105-1851861 NAPOLEON
AV 22-707 ADU R 0 1 1/30/2023 1 0 0 NONE Y Applicant provided estimated rental price
221-0-162-1151220 MONET PL 22-776 ADU R 0 1 8/9/2023 1 1 10/12/2023 1 NONE Y 204-0-192-325 625 MAPLE ST 22-903 ADU R 0 1 10/2/2023 1 0 NONE Y Applicant provided estimated rental price
203-0-022-010 1255 HILL ST 22-1603 ADU R 0 1 1/18/2023 1 1 7/7/2023 1 NONE Y 204-0-191-150655 E LAUREL ST 22-1671 ADU R 0 1 7/3/2023 1 0 NONE Y 200-0-283-140 204 N J ST 22-1733 ADU R 0 1 3/23/2023 1 1 7/26/2023 1 NONE Y Applicant provided estimated rental price
222-0-205-015800 BERKSHIRE
PL 22-2366 ADU R 0 1 8/21/2023 1 0 NONE Y Applicant provided estimated rental price
140-0-015-015 2422 LOBELIA DR 22-3735 ADU R 0 1 8/1/2023 1 0 0 NONE Y Applicant provided estimated rental price
201-0-064-260 227 N JUANITA
AVE 22-4053; 23-3613 ADU R 0 2 8/30/2023 2 0 NONE Y
187-0-123-015 1600 LOOKOUT
DR 23-1606 ADU R 0 1 12/5/2023 1 0 NONE Y
204-0-193-145 664 Maple 23-3170 ADU R 0 1 8/24/2023 1 0 NONE Y 220-0-173-025 2004 FALKNER PL 23-4251 ADU R 0 1 12/20/2023 1 0 NONE Y 203-0-231-0751352 W HEMLOCK
ST 21-131-172 ADU R 1 1/3/2022 1 1 2/15/2023 1 1 3/24/2023 1 0 NONE Y Applicant provided estimated rental price
2030-315-045 710 W CEDAR ST 21-131-171 ADU R 1 2/3/2022 1 1 4/19/2023 1 0 0 NONE Y Applicant provided estimated rental price
203-0-315-045 626 W ELM ST 21-131-170 ADU R 1 2/3/2022 1 1 2/16/2023 1 0 NONE Y 205-0-313-125 2400 S L ST 21-131-162 ADU R 1 1/18/2022 1 1 1/24/2023 1 0 0 NONE Y Applicant provided estimated rental price
200-0-244-220 238 DOUGLASS 21-131-139 ADU R 1 1/13/2022 1 1 1/26/2023 1 0 NONE Y Applicant provided estimated rental price
202-0-045-020 434 MAGNOLIA
AVE 21-131-45 ADU R 1 2/28/2022 1 1 10/7/2022 1 1 4/13/2023 1 NONE Y Applicant provided estimated rental price
215-0-261-315 245 Libre St, Unit A 22-131-3 ADU R 1 1/3/2022 1 1 2/16/2023 1 0 0 NONE Y Applicant provided estimated rental price
189-0-042-055 1740 West
Hemlock ST 22-131-10 ADU R 1 1/28/2022 1 1 1/24/2023 1 1 8/15/2023 1 NONE Y Applicant provided estimated rental price
185-0-154-065 2042 Mistral PL 22-131-12 ADU R 1 1/31/2022 1 1 1/10/2023 1 1 4/6/2023 1 NONE Y Applicant provided estimated rental price
220-0-073-115 2434 Dupont ST 22-131-23 ADU R 1 2/16/2022 1 1 1/17/2023 1 1 7/21/2023 1 NONE Y Applicant provided estimated rental price
183-0-383-065 1700 Elsinore CR 22-131-24 ADU R 1 2/17/2022 1 1 8/3/2023 1 0 NONE Y Applicant provided estimated rental price
183-0-383-065 1700 Elsinore CR 22-131-25 ADU R 1 2/17/2022 1 1 8/3/2023 1 0 NONE Y Applicant provided estimated rental price
219-0-044-105 244 Mc Millan AVE 22-131-26 ADU R 1 2/17/2022 1 1 1/18/2023 1 0 NONE Y Applicant provided estimated rental price
224-0-083-115 1806 Berkshire ST 22-131-27 ADU R 1 2/17/2022 1 1 1/18/2023 1 1 11/29/2023 1 0 NONE Y Applicant provided estimated rental price
204-0-082-320 254 E. Date ST 22-131-32 ADU R 1 2/25/2022 1 1 12/14/2023 1 0 0 NONE Y Applicant provided estimated rental price
216-0-094-175112 Featherstone
St 22-131-34 ADU R 1 3/3/2022 1 1 1/12/2023 1 1 10/3/2023 1 0 NONE Y Applicant provided estimated rental price
203-0-292-040 152 West Iris ST 22-131-35 ADU R 1 3/7/2022 1 1 1/18/2023 1 1 10/12/2023 1 NONE Y Applicant provided estimated rental price
132-0-041-140 2677 Colonia AVE 22-131-37 ADU R 1 3/8/2022 1 1 12/13/2022 1 1 7/14/2023 1 0 NONE Y Applicant provided estimated rental price
203-0-211-0301720 Valley Park
DR 22-131-41 ADU R 1 3/9/2022 1 1 8/29/2023 1 0 NONE Y Applicant provided estimated rental price
203-0-101-255 830 Cedar ST 22-131-43 ADU R 1 3/11/2022 1 1 6/14/2023 1 0 0 NONE Y Applicant provided estimated rental price
215-0-103-033 725 Rosalinda Dr 22-131-45 ADU R 1 3/22/2022 1 1 2/9/2023 1 0 NONE Y Applicant provided estimated rental price
205-0-384-075 4721 S. F ST 22-131-48 ADU R 1 3/28/2022 1 1 6/22/2023 1 0 0 NONE Y Applicant provided estimated rental price
203-0-012-270 1104 S. Ventura
RD 22-131-51 ADU R 1 3/30/2022 1 1 6/1/2023 1 0 NONE Y Applicant provided estimated rental price
203-0-012-270 1104 S. Ventura
RD 22-131-52 ADU R 1 3/30/2022 1 1 6/1/2023 1 0 NONE Y Applicant provided estimated rental price
205-0-457-075 610 Sonoma WY 22-131-55 ADU R 1 5/31/2022 1 1 5/5/2023 1 0 0 NONE Y Applicant provided estimated rental price
201-0-193-125 644 E. Maple ST 22-131-59 ADU R 1 4/13/2022 1 1 8/24/2023 1 0 0 NONE Y Applicant provided estimated rental price
201-0-193-125 644 E. Maple ST 22-131-60 ADU R 1 4/13/2022 1 1 8/24/2023 1 0 0 NONE Y Applicant provided estimated rental price
200-0-303-090 402 Doris AVE 22-131-61 ADU R 1 4/14/2022 1 1 5/9/2023 1 0 NONE Y Applicant provided estimated rental price
205-0-041-135 3148 Jackson ST 22-131-65 ADU R 1 4/18/2022 1 1 8/24/2023 1 0 NONE Y Applicant provided estimated rental price
205-0-234-075 864 Palomar WY 22-131-66 ADU R 1 4/18/2022 1 1 3/14/2023 1 0 NONE Y Applicant provided estimated rental price
205-0-234-075 864 Palomar WY 22-131-67 ADU R 1 4/18/2022 1 1 3/14/2023 1 0 NONE Y Applicant provided estimated rental price
200-0-163-215 1235 Roderick AVE 22-131-68 ADU R 1 4/18/2022 1 1 10/12/2023 1 0 NONE Y Applicant provided estimated rental price
200-0-262-255 524 North N St 22-131-69 ADU R 1 4/18/2022 1 1 9/5/2023 1 0 NONE Y Applicant provided estimated rental price
205-0-274-085 3965 South A ST 22-131-72 ADU R 1 4/20/2022 1 1 6/22/2023 1 0 NONE Y Applicant provided estimated rental price
205-0-274-085 3965 South A ST 22-131-73 ADU R 1 4/20/2022 1 1 6/22/2023 1 0 NONE Y Applicant provided estimated rental price
200-0-045-075 1340 Ivywood DR 22-131-74 ADU R 1 4/21/2022 1 1 6/8/2023 1 0 NONE Y Applicant provided estimated rental price
200-0-244-110 319 Doris AVE 22-131-76 ADU R 1 5/2/2022 1 1 4/27/2023 1 0 NONE Y Applicant provided estimated rental price
202-0-151-220 842 South F ST 22-131-78 ADU R 1 5/3/2022 1 1 2/16/2023 1 1 4/4/2023 1 NONE Y Applicant provided estimated rental price
203-0-302-075 1912 South E ST 22-131-79 ADU R 1 5/3/2022 1 1 1/30/2023 1 0 NONE Y Applicant provided estimated rental price
205-0-065-035 3023 South E ST 22-131-82 ADU R 1 5/5/2022 1 1 8/24/2023 1 0 NONE Y Applicant provided estimated rental price
200-0-162-035 1221 Devonshire
DR 22-131-83 ADU R 1 5/5/2022 1 1 6/28/2023 1 0 NONE Y Applicant provided estimated rental price
187-0-141-165 3050 Luff CT 22-131-85 ADU R 1 5/6/2022 1 1 12/15/2022 1 1 5/17/2023 1 NONE Y Applicant provided estimated rental price
183-0-391-045 1441 Ambrose AVE 22-131-86 ADU R 1 5/6/2022 1 1 11/1/2023 1 0 NONE Y Other Applicant provided estimated rental price
N/A
201-0-121-170 600 Cooper RD 22-131-87 ADU R 1 5/6/2022 1 1 4/20/2023 1 0 NONE Y Applicant provided estimated rental price
183-0-391-045 1211 Kelp ST 22-131-88 ADU R 1 5/6/2022 1 1 4/3/2023 1 0 NONE Y Applicant provided estimated rental price
203-0314-035 700 West fir AVE 22-131-89 ADU R 1 5/9/2022 1 1 12/19/2022 1 1 7/19/2023 1 NONE Y Applicant provided estimated rental price
203-0-312-055 614 W. Hemlock St 22-131-90 ADU R 1 5/9/2022 1 1 7/3/2023 1 0 NONE Y Applicant provided estimated rental price
221-0-071-045 1101 Yale ST 22-131-93 ADU R 1 5/18/2022 1 1 8/21/2023 1 0 NONE Y Applicant provided estimated rental price
219-0-283-015 524 E. Channel
Islands Bl 22-131-99 ADU R 1 5/19/2022 1 1 12/6/2022 1 1 12/4/2023 1 0 NONE Y Applicant provided estimated rental price
204-0-193-085 604 Maple St 22-131-100 ADU R 1 5/20/2022 1 1 9/22/2023 1 0 NONE Y Applicant provided estimated rental price
204-0-193-085 604 Maple ST 22-131-101 ADU R 1 5/20/2022 1 1 9/22/2023 1 0 NONE Y Applicant provided estimated rental price
205-0-202-085 3400 S. D ST 22-131-102 ADU R 1 5/20/2022 1 1 7/25/2023 1 0 NONE Y Applicant provided estimated rental price
205-0-131-1054501 South Saviers
RD 22-131-106 ADU R 1 6/6/2022 1 1 3/14/2023 1 1 11/16/2023 1 NONE Y Applicant provided estimated rental price
216-0-131-035 2011 San Luis St 22-131-107 ADU R 1 6/6/2022 1 1 10/11/2023 1 0 NONE Y Applicant provided estimated rental price
201-0-062-080 315 North Bonita
AVE 22-131-108 ADU R 1 6/6/2022 1 1 2/10/2023 1 1 7/20/2023 1 NONE Y Applicant provided estimated rental price
205-0-141-075 124 West Dollie St 22-131-111 ADU R 1 6/7/2022 1 1 8/22/2023 1 0 NONE Y Applicant provided estimated rental price
205-0-141-075 124 West Dollie St 22-131-112 ADU R 1 6/7/2022 1 1 8/8/2023 1 0 NONE Y Applicant provided estimated rental price
200-0-243-090 321 Douglas AVE 22-131-113 ADU R 1 6/8/2022 1 1 10/9/2023 1 0 NONE Y Applicant provided estimated rental price
203-0231-125 1306 Hemlock ST 22-131-114 ADU R 1 6/13/2022 1 1 8/1/2023 1 0 NONE Y Applicant provided estimated rental price
204-0-163-150 655 E. Kamala ST 22-131-117 ADU R 1 6/22/2022 1 1 4/20/2023 1 1 9/29/2023 1 NONE Y Applicant provided estimated rental price
222-0-121-045 4821 Refsing PL 22-131-123 ADU R 1 7/5/2022 1 1 2/13/2023 1 0 NONE Y Applicant provided estimated rental price
221-0-141-015 4401 Dallas Drive 22-131-124 ADU R 1 7/7/2022 1 1 4/4/2023 1 0 NONE Y Applicant provided estimated rental price
132-0-075-115 250 Iowa PL 22-131-125 ADU R 1 7/11/2022 1 1 9/8/2023 1 0 NONE Y Applicant provided estimated rental price
205-0-101-165 135 Homer St 22-131-127 ADU R 1 7/18/2022 1 1 9/28/2023 1 0 NONE Y Applicant provided estimated rental price
203-0-212-010 1805 valley Park Dr 22-131-128 ADU R 1 7/18/2022 1 1 10/23/2023 1 0 NONE Y Applicant provided estimated rental price
205-0062-015 405 W. Spruce 22-131-131 ADU R 1 7/27/2022 1 1 5/18/2023 1 1 9/7/2023 1 NONE Y Applicant provided estimated rental price
200-0-234-140 441 Doris AVE 22-131-135 ADU R 1 7/29/2022 1 1 12/19/2023 1 0 NONE Y Applicant provided estimated rental price
200-0-234-140 441 Doris AVE 22-131-136 ADU R 1 7/29/2022 1 1 12/19/2023 1 0 NONE Y Applicant provided estimated rental price
222-0-262-095 4451 Clover Dr 22-131-146 ADU R 1 8/15/2022 1 1 7/14/2023 1 0 NONE Y Applicant provided estimated rental price
222-0-262-095 4451 Clover Dr 22-131-147 ADU R 1 8/15/2022 1 1 7/14/2023 1 0 NONE Y Applicant provided estimated rental price
201-0-112-230154 North Harrison
AVE 22-131-149 ADU R 1 8/17/2022 1 1 5/10/2023 1 0 NONE Y Applicant provided estimated rental price
222-0-041-230 400 E. Pleasant
Valley RD 22-131-153 ADU R 1 8/24/2022 1 1 5/16/2023 1 0 NONE Y Applicant provided estimated rental price
222-0-041-220 410 E. Pleasant
Valley RD 22-131-154 ADU R 1 8/24/2022 1 1 5/16/2023 1 0 NONE Y Applicant provided estimated rental price
222-0-041-260 430 E. Pleasant
Valley RD 22-131-155 ADU R 1 8/24/2022 1 1 5/16/2023 1 0 NONE Y Applicant provided estimated rental price
222-0-041-250 440 E. Pleasant
Valley RD 22-131-156 ADU R 1 8/24/2022 1 1 5/16/2023 1 0 NONE Y Applicant provided estimated rental price
200-0-333-145 22 Carriage Square 22-131-158 ADU R 1 8/30/2022 1 1 9/21/2023 1 0 NONE Y Applicant provided estimated rental price
200-0-265-070 1344 Palm DR 22-131-162 ADU R 1 9/1/2022 1 1 10/11/2023 1 0 NONE Y Applicant provided estimated rental price
205-0-134-225 4700 C ST 22-131-165 ADU R 1 9/23/2022 1 1 3/9/2023 1 0 0 NONE Y Applicant provided estimated rental price
203-0-144-035 1323 W. Fir AVE 22-131-166 ADU R 1 9/7/2022 1 1 7/25/2023 1 0 NONE Y Applicant provided estimated rental price
186-0-412-0251321 South Ventura
RD 22-131-169 ADU R 1 9/8/2022 1 1 10/11/2023 1 0 NONE Y 201-0-324-075 1624 E. 2nd ST 22-131-171 ADU R 1 9/9/2022 1 1 7/19/2023 1 0 NONE Y Applicant provided estimated rental price
790
Jurisdiction Oxnard ANNUAL ELEMENT PROGRESS REPORT
Reporting Year 2023 (Jan. 1 - Dec. 31) Housing Element Implementation Cells in grey contain auto-calculation formulas Planning Period 6th Cycle 10/15/2021 - 10/15/2029
Note: "+" indicates an optional field
201-0-324-075 1624 E. 2nd St 22-131-172 ADU R 1 9/9/2022 1 1 7/19/2023 1 0 NONE Y Applicant provided estimated rental price
222-0-192-115 321 W. Clara ST 22-131-173 ADU R 1 9/9/2022 1 1 10/17/2023 1 0 NONE Y Applicant provided estimated rental price
142-0-143-085 2141 Mono St 22-131-177 ADU R 1 9/12/2022 1 1 11/20/2023 1 0 NONE Y Applicant provided estimated rental price
201-0-114-120 148 S. Hayes AVE 22-131-182 ADU R 1 9/15/2022 1 1 3/16/2023 1 1 7/31/2023 1 NONE Y Applicant provided estimated rental price
205-0235-075 3421 South J St 22-131-189 ADU R 1 9/29/2022 1 1 7/12/2023 1 0 NONE Y Applicant provided estimated rental price
216-0-135-095 140 N. Julian St 22-131-192 ADU R 1 9/28/2022 1 1 10/4/2023 1 0 NONE Y Applicant provided estimated rental price
203-0-150-27 1171 W. Fir AVE 22-131-193 ADU R 1 9/28/2022 1 1 8/23/2023 1 0 NONE Y Applicant provided estimated rental price
204-0-133-180 2224 San Marino St 22-131-194 ADU R 1 9/29/2022 1 1 8/21/2023 1 0 NONE Y Applicant provided estimated rental price
204-0-133-1802224 San Marino
ST 22-131-195 ADU R 1 9/29/2022 1 1 8/21/2023 1 0 NONE Y Applicant provided estimated rental price
139-0-311-265 1411 Kumquat Pl 22-131-199 ADU R 1 10/3/2022 1 1 8/1/2023 1 0 NONE Y Applicant provided estimated rental price
204-0-071-240 111 Ash St 22-131-200 ADU R 1 10/4/2022 1 1 8/15/2023 1 0 NONE Y Applicant provided estimated rental price
204-0-071-240 111 Ash ST 22-131-201 ADU R 1 10/4/2022 1 1 8/15/2023 1 0 NONE Y Applicant provided estimated rental price
203-0-131-070 304 W. Birch ST 22-131-203 ADU R 1 10/5/2022 1 1 12/11/2023 1 0 NONE Y Applicant provided estimated rental price
203-0-131-070 304 W. Birch ST 22-131-204 ADU R 1 10/5/2022 1 1 12/11/2023 1 0 NONE Y Applicant provided estimated rental price
225-0-092-115 3140 Nevada AVE 22-131-209 ADU R 1 10/6/2022 1 1 10/19/2023 1 0 NONE Y Applicant provided estimated rental price
203-0-092-040 1433 S. J ST 22-131-210 ADU R 1 10/6/2022 1 1 10/12/2023 1 0 NONE Y Applicant provided estimated rental price
203-0-092-040 1433 S. J ST 22-131-211 ADU R 1 10/6/2022 1 1 10/12/2023 1 0 NONE Y Applicant provided estimated rental price
200-0-142-185 443 Eastwood DR 22-131-235 ADU R 1 10/24/2022 1 1 12/27/2023 1 0 0 NONE Y Applicant provided estimated rental price
203-0-022-180 1174 So. M ST 22-131-240 ADU R 1 10/27/2022 1 1 7/6/2023 1 1 12/21/2023 1 NONE Y Applicant provided estimated rental price
203-0-022-180 1174 So. M ST 22-131-241 ADU R 1 10/27/2022 1 1 7/6/2023 1 1 12/21/2023 1 NONE Y Applicant provided estimated rental price
205-0-463-365 931 Redwood St 22-131-243 ADU R 1 11/2/2022 1 1 8/30/2023 1 1 12/19/2023 1 NONE Y Applicant provided estimated rental price
187-0-027-075 3530 Keel AVE 22-131-245 ADU R 1 11/9/2022 1 1 8/21/2023 1 1 12/18/2023 1 NONE Y Applicant provided estimated rental price
205-0-033-245 3004 Lassen St 22-131-259 ADU R 1 11/8/2022 1 1 7/10/2023 1 0 NONE Y Applicant provided estimated rental price
205-0-162-055 3139 S N St 22-131-260 ADU R 1 11/14/2022 1 1 11/6/2023 1 0 NONE Y Applicant provided estimated rental price
205-0-456-015 4904 S. F ST 22-131-263 ADU R 1 11/14/2022 1 1 6/8/2023 1 0 NONE Y Applicant provided estimated rental price
216-0-174-275 1825 Ferrara Way 22-131-270 ADU R 1 11/14/2022 1 1 11/16/2023 1 0 0 NONE Y Applicant provided estimated rental price
205-0-101-185 153 HOMER ST 22-131-271 ADU R 1 12/1/2022 1 1 6/21/2023 1 1 9/21/2023 1 NONE Y Applicant provided estimated rental price
205-0-043-185 3100 S. K ST 22-131-279 ADU R 1 11/22/2022 1 1 10/25/2023 1 0 0 NONE Y Applicant provided estimated rental price
203-0-211-160 342 W Elm St 22-131-287 ADU R 1 12/1/2022 1 1 8/9/2023 1 0 NONE Y Applicant provided estimated rental price
203-0-315-105 633 W. Fir Avenue 22-131-288 ADU R 1 12/1/2022 1 1 12/5/2023 1 0 NONE Y Applicant provided estimated rental price
200-0-172-360 1121 W. Doris AVE 22-131-293 ADU R 1 12/7/2022 1 1 5/30/2023 1 1 7/20/2023 1 NONE Y Applicant provided estimated rental price
139-0-354-135 1211 Holly St 22-131-295 ADU R 1 12/7/2022 1 1 9/18/2023 1 0 NONE Y Applicant provided estimated rental price
185-0-205-285 2922 Naples Drive 22-131-297 ADU R 1 12/8/2022 1 1 8/1/2023 1 0 NONE Y Applicant provided estimated rental price
203-0-133-130 129 N I St 22-131-298 ADU R 1 12/12/2022 1 1 7/20/2023 1 0 NONE Y Applicant provided estimated rental price
205-0-171-035 3023 Napa St 22-131-303 ADU R 1 12/14/2022 1 1 8/21/2023 1 0 NONE Y Applicant provided estimated rental price
222-0-041-140 351 Howell Rd 22-131-312 ADU R 1 12/16/2022 1 1 11/13/2023 1 0 NONE Y Applicant provided estimated rental price
203-0-292-240 178 W JUNIPER
ST 21-131-157 ADU R 1 12/29/2021 1 1 11/29/2022 1 1 6/16/2023 1 NONE Y Applicant provided estimated rental price
200-0-172-290 1009 DORIS AVE 21-131-51 ADU R 1 6/23/2021 1 1 9/29/2022 1 1 9/15/2023 1 NONE Y Applicant provided estimated rental price
200-0-232-050 650 DOUGLAS
AVE 21-131-65 ADU R 1 7/21/2021 1 1 3/23/2022 1 1 2/28/2023 1 NONE Y Applicant provided estimated rental price
200-0-232-050 650 DOUGLAS
AVE 21-131-64 ADU R 1 7/21/2021 1 1 3/23/2022 1 1 2/28/2023 1 NONE Y Applicant provided estimated rental price
200-0-022-045 622 glenwood 20-2669 ADU R 0 1 10/5/2022 1 1 4/17/2023 1 NONE Y 142-0-252-085 416 Firenze 20-2642 ADU R 0 1 9/26/2022 1 1 2/13/2023 1 NONE Y 222-0-135-015 4910 Petit Drive 20-2149 ADU R 0 1 10/31/2022 1 1 2/28/2023 1 NONE Y 219-0-073-075 3173 Clinton 19-1351 ADU R 0 1 5/31/2022 1 1 12/8/2023 1 0 NONE Y Applicant provided estimated rental price
202-0-266-185 1224 Seaport Drive 20-3793 ADU R 0 1 4/27/2022 1 1 4/12/2023 1 NONE Y 204-0-121-085 575 Fir Court 21-1751 ADU R 0 1 6/15/2022 1 1 9/28/2023 1 NONE Y 200-0-363-165 410 Ivywood Drive 21-4740 ADU R 0 1 6/8/2022 1 1 1/23/2023 1 0 NONE Y Applicant provided estimated rental price
183-0-332-245 1430 Tehama 21-4944 ADU R 0 1 9/7/2022 1 1 9/7/2023 1 NONE Y Applicant provided estimated rental price
216-0-141-0152010 San Jacinto
Street 22-575 ADU R 0 1 12/2/2022 1 1 9/22/2023 1 NONE Y Applicant provided estimated rental price
183-0-172-095 894 Saratoga
Street 22-3141 ADU R 0 1 12/13/2022 1 1 6/5/2023 1 NONE Y Applicant provided estimated rental price
204-0-073-080 1416 California 20-3503 ADU R 0 1 4/26/2022 1 1 6/15/2023 1 NONE Y 201-0-122-150 128 Garfield Ave 21-2363 ADU R 0 1 5/17/2022 1 1 2/23/2023 1 NONE Y Applicant provided estimated rental price
203-0-222-200 112 W. Fir 21-2683 ADU R 0 1 10/5/2022 1 1 6/21/2023 1 0 NONE Y Applicant provided estimated rental price
200-0-191-140 637 Robert 21-2770 ADU R 0 1 12/2/2022 1 1 6/16/2023 1 NONE Y 202-0-041-090 128 N. F Street 21-2787 ADU R 0 1 4/8/2022 1 1 9/22/2023 1 NONE Y 203-0-032-2401126 S. K Street 22-302 ADU R 0 1 10/19/2022 1 1 4/14/2023 1 NONE Y 203-0-223-080171 W. Iris Street 22-597 ADU R 0 1 10/17/2022 1 1 10/12/2023 1 NONE Y 139-0-094-055 1320 Bluebell
Street 22-1336 ADU R 0 1 12/20/2022 1 1 10/19/2023 1 NONE Y Applicant provided estimated rental price
196-0-023-1654981 DUNES CIR 18-4502 2 to 4 R 0 2 11/3/2023 2 0 NONE Y 139-0-080-3351357 ALTHEA CT 20-1533 5+ R 0 1 5/4/2023 1 0 NONE Y 191-0-064-2755135 SEABREEZE
WAY 22-488 SFD O
0 1 2/22/2023 1 0 NONE Y
188-0-036-035 4031 NICE CT 22-1517 SFD O 0 1 11/8/2023 1 0 NONE Y 188-0-057-045
2150

KINGSBRIDGE
WAY
22-2842 SFD O
0 1 3/9/2023 1 0 NONE Y
191-0-064-3755241 SEABREEZE
WAY 22-5148 SFD O
0 1 10/24/2023 1 0 NONE Y
132-0-051-530 2711 COLONIA
AVE 23-1674 SFD O 0 1 12/14/2023 1 0 NONE Y
188-0-120-1004201 W HEMLOCK
ST 21-4872 SFD O 0 1 8/16/2023 1 0 NONE Y
132-0-100-0952700 N VENTURA
RD 22-2142 5+ R 0 16 17 17 283 10/25/2023 333 0 0 NONE Y Other INC, Other 55 Development Agreement 225-0-014-020 2161 ETTING RD 22-3861 5+ R
0 57 1 10/30/2023 58 0 NONE Y VHHP DB 55 20.0%
10 Development
Standards
Modification
Yes
200-0-501-025 305 N F ST 101-
202 21-3155 SFA O 0 4 6/20/2023 4 0 NONE Y
200-0-501-025 307 N F ST 101-
202 21-3156 SFA O 0 4 6/20/2023 4 0 NONE Y
200-0-501-025 311 N F ST 101-
202 21-3158 SFA O 0 4 6/20/2023 4 0 NONE Y
200-0-501-025 313 N F ST 101-
202 21-3159 SFA O 0 4 6/20/2023 4 0 NONE Y
139-0-610-355743 WINCHESTER
DR 22-4389 SFA O 0 3 12/5/2023 3 0 NONE Y
139-0-610-355731 WINCHESTER
DR 22-4390 SFA O 0 3 10/16/2023 3 0 NONE Y
139-0-610-355725 WINCHESTER
DR 22-4391 SFA O 0 3 9/21/2023 3 0 NONE Y
139-0-610-355719 WINCHESTER
DR 22-4392 SFA O 0 3 9/21/2023 3 0 NONE Y
139-0-610-355713 WINCHESTER
DR 22-4393 SFA O 0 3 5/19/2023 3 0 NONE Y
139-0-610-355749 WINCHESTER
DR 22-4394 SFA O 0 3 9/21/2023 3 0 NONE Y
139-0-610-355755 WINCHESTER
DR 22-4395 SFA O 0 3 12/5/2023 3 0 NONE Y
139-0-610-355761 WINCHESTER
DR 22-4396 SFA O 0 3 12/5/2023 3 0 NONE Y
139-0-610-355701 WINCHESTER
DR 22-4397 SFA O 0 3 5/19/2023 3 0 NONE Y
139-0-610-355737 WINCHESTER
DR 22-4398 SFA O 0 3 10/16/2023 3 0 NONE Y
139-0-610-355707 WINCHESTER
DR 22-4399 SFA O 0 3 5/19/2023 3 0 NONE Y
188-0-047-0552311 PENINSULA
RD 21-3400 SFD O 0 1 2/9/2023 1 0 NONE Y
181-0-093-0551630 DIEGO WAY 20-4364 ADU R 0 0 1 3/28/2023 1 NONE Y 203-0-161-385 1807 Guava 17-6507 ADU R 0 0 1 10/9/2023 1 NONE Y 183-0-363-175 1640 Alturas 21-1005 ADU R 0 0 1 1/11/2023 1 NONE Y Applicant provided estimated rental price
225-0-052-245 4340 Dapper 20-3626 ADU R 0 0 1 1 4/21/2023 2 NONE Y Applicant provided estimated rental price
2050383115 4710 S J ST 20-2800 ADU R 0 1 10/20/2021 1 1 6/28/2023 1 0 NONE Y Applicant provided estimated rental price
2030291010 336 W IRIS ST #2 20-2183 ADU R 0 1 1/12/2021 1 1 8/8/2023 1 NONE Y 2200041055 2621 TRINITY PL 20-2135 ADU R 0 1 5/24/2021 1 1 2/1/2023 1 NONE Y 201-0-033-250 546 N BONITA
AVE 18-2330 ADU R 0 0 1 3/6/2023 1 NONE Y
139-0-610-175 2640 WAGON
WHEEL RD 18-3586 5+ R
0 0 43 195 12/5/2023 238 NONE Y Other Other
Affordable Units
Required Per
Development Agreement
191-0-072-1455117 WHITECAP
ST 19-1625 SFD O 0 0 1 2/6/2023 1 NONE Y
191-0-091-0451125 CAPRI WAY 19-3859 SFD O 0 0 1 6/19/2023 1 NONE Y 191-0-033-2855353 REEF WAY 20-1792 SFD O 0 0 1 3/28/2023 1 NONE Y 188-0-015-1952024 NAPOLI DR 20-397 SFD O 0 0 1 12/4/2023 1 NONE Y 200-0-291-345 317 N F ST 101-
202 21-3161 2 to 4 O 0 4 9/15/2022 4 4 5/30/2023 4 NONE Y 200-0-291-345 319 N F ST 101-
202 21-3162 2 to 4 O 0 4 9/15/2022 4 4 7/28/2023 4 NONE Y 200-0-291-345 321 N F ST 101-
202 21-3163 2 to 4 O 0 4 9/15/2022 4 4 8/14/2023 4 NONE Y 2000291345 303 N F ST 101-
202 21-2953 2 to 4 O 0 4 9/20/2021 4 4 8/17/2023 4 NONE Y 2000291345 309 N F ST 101-
202 21-3157 2 to 4 O 0 4 9/20/2021 4 4 2/28/2023 4 NONE Y 2000291345 315 N F ST 101-
202 21-3161 2 to 4 O 0 4 9/20/2021 4 4 2/28/2023 4 NONE Y 139-0-610-375 2850 Wagon Wheel 21-5016 SFA O 0 12 1/27/2022 12 12 3/28/2023 12 NONE Y 139-0-610-375 2860 Wagon Wheel 21-5017 SFA O 0 12 7/22/2022 12 12 6/6/2023 12 NONE Y 139-0-610-355713 WINCHESTER
DR 22-4393 2 to 4 O 0 0 3 12/27/2023 3 NONE Y
139-0-610-355707 WINCHESTER
DR 22-4399 2 to 4 O 0 0 3 12/27/2023 3 NONE Y
139-0-610-355701 WINCHESTER
DR 22-4397 2 to 4 O 0 0 3 12/26/2023 3 NONE Y
791
Jurisdiction Oxnard ANNUAL ELEMENT PROGRESS REPORT
Reporting Year 2023 (Jan. 1 - Dec. 31) Housing Element Implementation Planning Period 6th Cycle 10/15/2021 - 10/15/2029
1 Projection Period 3 4
RHNA Allocation by
Income Level
Projection Period -
06/30/2021-
10/14/2021
2021 2022 2023 2024 2025 2026 2027 2028 2029 Total Units to Date (all years)
Total Remaining
RHNA by Income
Level
Deed Restricted - - 89 16 - - - - - - Non-Deed Restricted 2 2 12 22 - - - - - - Deed Restricted - - 52 74 - - - - - - Non-Deed Restricted 4 3 26 99 - - - - - - Deed Restricted - - - 17 - - - - - - Non-Deed Restricted 9 6 3 29 - - - - - - Above Moderate 4,100 43 15 88 384 - - - - - - 530 3,570 8,549
58 26 270 641 - - - - - - 995 7,554 5 6 7
Extremely low-Income
Need 2021 2022 2023 2024 2025 2026 2027 2028 2029 Total Units to Date
Total Units
Remaining
920 - - - - - - - - - - 920 VLI Deed Restricted
VLI Non Deed Restricted
LI Deed Restricted
LI Non Deed Restricted
MI Deed Restricted
MI Non Deed Restricted
Above Mod Income
Please note: The APR form can only display data for one planning period. To view progress for a different planning period, you may login to HCD's online APR system, or contact HCD staff at [email protected].
1,474
143
This table is auto-populated once you enter your jurisdiction name and current year data. Past year information comes from previous APRs.
64 Moderate
1,840
1,071
1,538
Please contact HCD if your data is different than the material supplied here 258
2 Table B
Regional Housing Needs Allocation Progress
Permitted Units Issued by Affordability
1,697
813
Please note: For the last year of the 5th cycle, Table B will only include units that were permitted during the portion of the year that was in the 5th cycle. For the first year of the 6th cycle, Table B will only include units that were permitted since the start of the planning period. Projection Period units are in a separate column.

Total RHNA
Total Units
Income Level
Very Low
Low
Extremely Low-Income Units*
Note: units serving extremely low-income households are included in the very low-income RHNA progress and must be reported as very low-income units in section 7 of Table A2. They must also be reported in the extremely low-income category (section 13) in Table A2 to be counted as progress toward meeting the extremely low-income housing need determined pursuant to Government Code 65583(a)(1). *Extremely low-income houisng need determined pursuant to Government Code 65583(a)(1). Value in Section 5 is default value, assumed to be half of the very low-income RHNA. May be overwritten.

Progress toward extremely low-income housing need, as determined pursuant to Government Code 65583(a)(1).

Please Note: Table B does not currently contain data from Table F or Table F2 for prior years. You may login to the APR system to see Table B that contains this data. 792
Jurisdiction Oxnard ANNUAL ELEMENT PROGRESS REPORT
Reporting Year 2023 (Jan. 1 - Dec. 31) Housing Element Implementation Planning Period 6th Cycle 10/15/2021 - 10/15/2029
Date of Rezone Rezone Type
2 4 5 6 7 9 10 11
APN Street Address Project Name+
Local
Jurisdiction
Tracking ID+
Date of Rezone Very Low-Income Low-Income Moderate-IncomeAbove Moderate- Income
Rezone Type Parcel Size
(Acres)
General Plan
Designation Zoning Minimum
Density Allowed
Maximum
Density Allowed
Realistic
Capacity Vacant/NonvacantDescription of Existing
Uses
Note: "+" indicates an optional field
Cells in grey contain auto-calculation formulas
Summary Row: Start Data Entry Below
83 Project Identifier RHNA Shortfall by Household Income Category Sites Description 1 Sites Identified or Rezoned to Accommodate Shortfall Housing Need and No Net-Loss Law Table C
793
Jurisdiction Oxnard
Reporting Year 2023 (Jan. 1 - Dec. 31)
1 2 3 4
Name of Program Objective Timeframe in H.E Status of Program Implementation Program 1: Code
Compliance Program
Ensure compliance with
City codes, with a focus
on substandard housing,
which includes garage
conversions and
unpermitted additions.
300 cases per month.

Ongoing
Program 1 is an ongoing program with no specific objective for calendar year 2023.

In 2023, the Code Compliance Division had a staff of eight field officers and one manager who carried an average of over 400 cases per month. Code Compliance officers work with neighborhood advisory groups and respond to complaints to identify violations, and then direct owners to appropriate City departments to achieve compliance. The types of cases related to residential properties are as follows: substandard housing, property maintenance, zoning violations, weed abatement, inoperable vehicles, and encroachments.

The Housing Department serves as a liaison for Code Compliance in mobile home parks under HCD jurisdiction.

Community Development also implements this program through the permit review process for additions and/or new development. On every discretionary permit, standard a condition of approval require maintenance of property and removal of graffiti within a minimum of five calendar days.

Code Compliance inspectors meet regularly with Community Development building inspector field staff and the City Attorney’s Office to coordinate and prioritize the Code Compliance workload. Most cases referred involve home improvements completed without permits (replacement windows, water heaters, etc.), substandard housing including conversion of garages or internal subdivisions to create illegal living quarters that violate Building, Housing, Health and Safety, and Zoning Codes.

Program 2: Citywide
Homeowner Repair
Program
Provide loans to
rehabilitate 3 very lowand
3 low-income homes
annually, as funding
allows.

Seek funding annually
In program year 2023, the Citywide Homeowner Repair Program was not implemented. At this time there does not appear to be a high demand for the program, additionally the City has not been able to find an outside service provider that has the capacity to provide this service on behalf of the City. The City will continue to reevalute the need for the program and a service provider that can administer the program on behalf of the City on an annual basis.

Program 3:

No Net Loss Monitoring
Maintain sufficient sites to
meet the RHNA throughout the planning
period
Assess whether sufficient
sites remain annually and
continue to maintain
sufficient sites at all
income
categories throughout the
planning period.

Program 3 is an ongoing program with annual assessment of sufficient Housing Element site to meet the City’s RHNA obligations.

As of the end of 2023, there is remaining land to meet the remaining capacity needs for ___ extremely low to low income units. Approximately ___ units have been entitled in 2023 on ___ Housing Element sites (Sites 1, 3, _____) at densities projected in Supplement 1 the City of Oxnard’s certified 2021-2029 Housing Element. As of January 2024 over _____ lower income units are presently in the plancheck process or under construction.

The City continues, to review Accessory Dwelling Units (ADU) permitting activity as an alternative source of lower income units to satisfy the remaining capacity need for extremely low to low income units. A total of 87 ADU applications were entiled in 2023, and 178 ADUs were issued building permits in 2023. Based on the number of ADU permits filed, continued strong public interest and ongoing City promotion of ADUs, the Planning Manager anticipates the City will meet the Housing Element ADU projection of 283 ADUs as early as 2024, and could significant exceed that projection by the end of the Houisng Element Cycle on October 15, 2029. Based on surveys and information provided by a sample of ADU applicants, most of the ADU are being offered for rents that qualify as very low to lower income units. As a result, these units can be counted towards the remaining RHNA lower income unit need. With the Program 3 lower income need being met by the Housing Element sites and ADUs the program goal has been completed.

Program 4: Urban Village
Program
Implement the 2030
General Plan Urban
Village Program.

Accomodate at least 372
lower income units in
Urban Village areas
identified in Supplement 1
to increase access to
higher opportunity areas,
prioritizing construction of
affordable units
At the time projects
subject to the Urban
Village
Program are approved.

Program 4 is an ongoing program with no specific objective for calendar year 2023.

The City approved the Riverpark Specific Plan Amendment in 2022; Riverpark includes 1,025 residential units, of which 118 are affordable to lower income households. The City is also processing two specific plans that also fall under Urban Village program. 1) The Teal Club Specific Plan (88.4 acres), which includes 990 units in a range of affordability and densities, including 662 attached residential units at densities between 18 and 30 du/ac, of which 148 units will be affordable to lower income households; and 2) The Northeast Community Specific Plan Specific Plan amendment (Maulhardt 44.2 acres), which includes 530 units, including 172 attached single-family units and 358 apartments, of which 106 will be restricted as affordable to lower income households. The Teal Club EIR was circulated for public review in December 2022 and the City anticipates completion by the end of 2024. The Northeast Community Specific Plan is anticipated to be complete in Summer 2025.

The Urban Village policies are intended to provide and promote a pedestrian orientation to reduce trips and vehicle miles traveled in order to reduce greenhouse gas emissions. Development of the Urban Villages affirmatively furthers fair housing by increasing access to housing in moderate and higher resource areas by reducing constraints on development of affordable residential units and expanding where they can be built. Within these areas, as stipulated in the 2030 General Plan Land Use Element a minimum of 15 percent of the Urban Village housing would be affordable to lower and moderate income households.

ANNUAL ELEMENT PROGRESS REPORT
Housing Element Implementation
Housing Programs Progress Report
Describe progress of all programs including local efforts to remove governmental constraints to the maintenance, improvement, and development of housing as identified in the housing element.

Table D
Program Implementation Status pursuant to GC Section 65583 794
Program 5: Parcel
Assemblage or Lot
Consolidation Program
Support State legislation
that enables site
assembly through
creation of a taxincrement
supported
program or district
Implement as feasible
during the planning
period if State legislation
and/or programs enable a
tax-increment or
similar program that leads
to funding for site
assembly.

Program 5 is an ongoing program with no specific objective for calendar year 2023.

Program 5 was updated in the City’s 2021-2029 Housing element ("Housing Element") to include waive of parcel assemblage/lot consolidation fees for targeted Housing Element sites with contiguous parcels less than 0.5 acres. In 2023 no developers requested this waiver. No further progress in this program was achieved as no state-level program was initiated. Community Development will continue to monitor enabling legislation and seek funding.

Program 6: Zoning Code
Amendments
Revise Zoning Code to
comply with recently
adopted state law.

End of Fiscal Year 2022-
2023 for Chapter 16
amendments; Chapter 17
(Coastal Zoning)
amendments once
the City updates its Local
Coastal Plan in Fiscal
Year 2027-2028.

Program 6 is a program with implementation during fiscal year 2022-2023.

In November 2023 the City Council approved seven ordinances to update Chapter 16 Zoning Code of the Oxnard City Code (OCC) pursuant to Housing Element Programs 6 (Zoning Code Amendments), 9 (Farmworker Housing), 22 (Special Needs Groups), 27 (Parking Standards) and 32 (Senate Bill 35) in the Housing Element to comply with current state housing laws and address identified constraints to residential development. These updates included code updates to OCC requirements on Accessory Dwelling Units (ADUs) parking, Density Bonus requirements; zoning for farmworker housing, supportive housing, and low-barrier navigation centers; SROs zoning, standards and parking; residential care facilities zoning and parking, emergency shelter standards and parking, objective standards for reasonable accommodation, and other modifications to clarify permitting requirements and reduce barriers to consturction. After the ordinance second reading on December 5, 2023, the zoning text amendments became effective on January 4th, 2024.

In October 2021 the City Council had also approved five ordinances for zoning code and zoning map amendments to accomodate RHNA for the Housing Element. These updates have resulted in additional development opportunities and projects approved citywide. In 2023, the Lockwood Senior Apartments (173 lower-income units) and the Lockwood 2 Senior Apartment (168 lower-income units) were under construction on BRP AHD zoned parcels, and a 234-unit apartment complex has also been proposed on an adjacent BRP zoned parcel.

A 142-unit apartment project has also been approved under the new Site Plan Revieew (SPR) ministerial process for development on a C2 AHP zoned parcel.

Five of the units in this development will be affordable to very low income households and 18 units will be affordable to low income households In July of 2020 and 2023, the City updated ADU regulations to be consistent with state ADU legislation. These regulations are promoting construction of Program 7: Housing
Permitting Process
Review
Review and streamline
permitting process, ADUs,
and manufactured
housing.

Annually and as project
applications are
submitted.

Program 7 is an ongoing program with annual assessment of the permitting process for unnecessary and/or duplicative regulations and ways to streamline the process.

In 2023, the City updated the City permitting regulations or procedures involving manufactured housing and ADUs, which is scheduled for completion 2023 under Program 6.

Program 8: SOAR
Affordable Housing
Exemption Study
Develop guidelines for the possible use
of the affordable housing
exemption in the SOAR ordinance.

During the planning
period,
if needed.

Program 8 is ongoing in terms of the continuous evaluation of the need for a SOAR affordable housing exemption throughout the housing cycle.

As documented in the 2021-2029 6-Cycle Housing Element, SOAR has not been an impediment to development of affordable housing. Affordable housing is being developed and Housing Element sites are available without need to use the 20-acre per year Oxnard SOAR affordable housing exemption. This program will likely not be needed through the end of this RHNA planning period.

Program 9: Farmworker
Housing Program
Review and pursue
farmworker housing
opportunities. Complete
amendments to the OCC
to comply with state law
regarding Employee
(farmworker) Housing.

Prepare brochure by
Fiscal Year 2022-2023;
Amend Zoning Code to
fully comply with
Employee Housing
Act by Fiscal Year 2023-
2024; continue to
participate with
House Farmworkers
stakeholders and their
projects and meet
with the group at least
twice per year
Program 9 is an ongoing program. The 150-unit Cypress Place at Garden City development will be constucted in two phases and will be affordable multifamily rental housing. Phase 1 includes 90 units and a recreation center for tenants, 43 units within Phase 1 are designated for farmworkers. Phase 1 of the project secured all needed funding and began construction in the March 2023 and is estimated to be completed in April 2025. Dolores Huerta Gardens is a 58 unit affordable multifamily rental development that began construciton in May 2023 and will include 6 units designated for farmworkers. The project is estiamted to be compelted in the first quarter of 2025.

Program 10: Inclusionary
Housing Program
Produce eighteen lower
income units per year on
average on-site. in-lieu
fees lead to an average of
two lower income units
per year.

Update and codify
inclusionary regulations
by
2023; Monitor annually
and ongoing
In 2021 City staff began discussions for updating the Inclusionary Ordiance and began community outreach in 2022 to get community feedback on proposed changes to the City's existing inclusionary Housing Ordinance. In 2022, the Casa De Carmen Permenant Supporitive Housing (PSH) Project, inclusive of 55 affordable PSH rental units and one manager's unit, began construction, the development will include 6 inclusionary housing units targeting households with annual incomes at 30% AMI. This project is expected to be completed in the first quarter of 2025. The Central Terrace Project, an 87 unit affordable rental housing development, inclusive of one manager's unit, also began construciton in 2022. The project recieved $1,250,000 in Affordable Housing in-lieu funds from the City in the form of a gap-financing loan and will include 9 inclusionary units targeting households with incomes at 30%, 50% and 60% AMI. This project is expected to be completed in Spring of 2024.

Program 11:

Homeownership
Assistance Citywide
Assist a total of four
households annually. At
least half of the
households originating
from low resource areas
and/or areas designated
as racially or ethnically
concentrated areas of
poverty in Oxnard.

Develop and disseminate
marketing materials for
by June 2023, update on
an annual basis; Ongoing
During 2023, the City executed an agreement with the Ventura Councty Communty Development Corporation to administered the City's homeownership downpayment asssistance program. In 2023 VCCDC was not able to issue any loans due to a lack of affodable units for sale. 795
Program 12: Mortgage
Credit Certificate (MCC)
Continue working with the
Ventura County
Consortium to distribute
funding and work toward
Oxnard residents using at
least six Mortgage Credit
Certificates per year.

Work with the Ventura
County Consortium to
request that they outreach
to at least twenty-four
households in the areas
designated as low
resource and/or RE/CAPs
through marketing efforts,
so at least half of
applicants are from low
resource areas and/or
areas designated as
racially or ethnically
concentrated areas of
poverty in Oxnard.

Develop and disseminate
marketing materials by
June 2023, update on an
annual basis; Ongoing
and as firsttime
homebuyers’ applications
are pursued
CDLAC is no longer funding the program threrefore, no MCCs were issued in 2023. Ventirua County will apply for funding of this program should the program receive funding again.

Program 13: Financial and
Regulatory Assistance
Continuing to provide financial and
regulatory assistance.

Continue to pursue
funding annually
In 2021 the Central Terrace Apartments, an 87 unit affordable rental development, applied for AHSC funding and was awarded AHSC funding in 2022 as part of their 2021 application as well as all other funding necessary to develop the project. As part of that funding the City will also receive additional pass-through grant funding for the development of the City's Fourth Street Mobility Improvement Project, one of the City's CIP projects, and build other Downtown Oxnard transporation amenities as part of the City's Downtown Oxnard Transit Amenities project. Construction on this project began in summer 2022. The City of Oxnard applied for its 2021 PLHA allocation in 2022 and was awarded $1,981,457 in 2023 as part of that applicaiton.

Program 14: Shelter
Development Program
Continue to work to
provide shelter and
services to address the
homeless need.

Amend Chapter 17
(Coastal Zoning Code) to
fully
address SB 2
requirements for
transitional and
supportive
housing after updating the
City’s Local Coastal Plan
by the end
of Fiscal Year 2027-2028.

The City will comply with
SB 2
requirements for
transitional and
supportive housing
outside of
the Coastal zone by the
end of Fiscal Year 2023-24
The Navigation Center at Case De Carment will include a 110 emergency homeless shelter, office space for leasing and supprotive servicves providers.

The navigation center will be located on the ground floor of the Casa De Carmen mixed use develpoment project which will also include 56 supprotive housing units (inclusive of 1 unrestricted manager's unit). The navigation center is estimated to be completed in the first quarter of 2025. The property address us 241 W. Second Street in downtown Oxnard.

Program 15: Homeless
Assistance
Continue to implement
programs providing
services, and emergency
shelter to homeless
persons.

Ongoing through planning
period.

In 2023, Oxnard Navigation Center (ONC) operated by Mercy House, provided shelter and services to homeless residents. For the first six months of the year, the shelter operated out of two locations at a reduced capacity of 80 (full capacity is 110) in order to provide safer conditions for preventing the spread of COVID-19. In June, the shelter was able to expand back to its full capacity of 110. The ONC provides beds, showers, laundry, meals and other essential services. The ONC also provides case management to create and work through an individualized housing plan with each client.

In 2023, the Encampment Response Funding (ERF) program launched. This program utilizes motel rooms and non-congregate shelter and case management services to people who have been relocated from encampment sites within the City of Oxnard, with the goal of placing its clients into permanent housing.

Street outreach services continued throughout the calendar year through the Salvation Army Street Outreach team, and through September 30 with the Ventura County Health Care Agency encampment response project. The street outreach teams engage with people who are experiencing homelessness to provide practical assistance, housing navigation, employment assistance, health navigation and crisis intervention.

Gabriel’s House/ The Kingdom Center operates a transitional living shelter for homeless women and children in a city-owned facility on South Rose Ave.

Turning Point Foundation serves 10 homeless residents from the City of Oxnard through the Our Place Safe Haven shelter.

The ‘One Stop’ is a drop in service run by the Ventura County Health Care Agency. This service provides health care, behavioral health services, case management, and practical assistance to homeless people. In 2023, the One Stop operated at the Salvation Army office in Oxnard.

Program 16: At-Risk
Household Assistance
Continue to monitor the
431 assisted units, and if
any become at risk, work
with property owners to
develop a strategy to
maintain any at-risk as
affordable.

Ongoing communication
with owners, service
providers, and eligible
potential purchasers;
work with owners
of deed-restricted units on
an ongoing basis, in
particular at the
time of change of
ownership.

Per AB 1521, the City continues to monitor the list of all dwellings in Oxnard that are subsidized by government funding or low-income housing developed through local regulations or incentives.

Should the property owners indicate the desire to convert properties City will provide technical assitance to aid properties owners in extending the property's term of affordability, and if possible, based on available funding, consider providing financial assistance to ensure long-term affordability.

Pursuant to state law, owners of deed-restricted affordable projects, including those through local inclusionary zoning requirements, granted a density bonus or other incentives, are required to provide notice to all prospective tenants, existing tenants, and the City within three years of the scheduled expiration of rental restrictions for any projects losing the restrictions after January 1, 2021.

Owners shall also refer tenants of at-risk units to educational resources regarding tenant rights and conversion procedures and information regarding Section 8 rent subsidies and any other affordable housing opportunities in the City.
796
Program 17: Fostering
Self-Sufficiency
Support non-profit
organizations to assist an
average of 276
households annually, with
Oxnard residents
comprising a minimum of
80 percent of those
assisted, with a program
goal of 100 percent.

Annually and ongoing.

Program 17 is an ongoing program with an annual objective of assisting 90 households. During 2023, 26 Public Housing and 44 Section 8 low-income families participated in the Oxnard Housing Authority's (OHA) Family Self- Sufficiency program. The FSS program focuses on assisting families in reaching milestones such as: improving their credit, enrolling in higher education, improving budgeting skills, and remaining off welfare assistance.The OHA works in collaboration with the Ventura County Credit Union and the Housing Authority of the City of San Buenaventura to offer money management workshops. The OHA also partnered with the Oxnard Adult School to offer ESL Classes and Digital Literacy courses for program participants. The OHA launched a scholarship program and has awarded scholarships to youth who are pursuing a higher education and live in Public Housing or their household is part of the Section 8 program. College preparation workshops are also offered in partnership with Oxnard College and California State University Channel Islands.

Program 18: Section 8
Assistance Program
Continue to participate in
the Section 8 Assistance
program.

Increase voucher
utilization by 95%
seek to raise the payment
standard as needed to
align with private rental
markets.

Expand landlord outreach.

Ongoing. Increase
voucher utilization; raise
payment standards;
expand landlord outreach.

Provide annual
training to landlords
starting in June 2023.

The Oxnard Housing Authority (OHA) continues to participate in the Section 8 program, an average of 1,600 vouchers were in use in 2023. In addition, the OHA was awarded 46 new vouchers under the Emergency Housing Voucher program which have all been issued to eligible families. The payment standards (maximum rent for units under the program) was increased 110% of the fair market rents published by the Department of Housing and Urban Development.

The expansion of landlord engagement efforts is underway.

Program 19: Affirmatively
Furthering Fair Housing
Continue to implement
and advertise the program
in cooperation with the
Housing Rights Center to
achieve the objectives of
AB 686 and comply with
state fair housing law.

Quantified objectives for
specific actions are
included in the action
description.

Fair housing services are
ongoing; Create plan by
Fiscal Year 2022-2023 and
implement on an ongoing
basis.

Timeframes for individual
actions are included in the
action
description.

The City of Oxnard remains under contract with The Housing Rights Center for administration of the Fair Housing Program
Program 20: Energy
Conservation
Increase public
awareness and
information on energy
conservation opportunities
and assistance programs
for new and existing
residential units, and
comply with state energy
conservation
requirements.

Advertise programs and
implement project-related
standards as feasible
when development
applications are received.

Program 20 is an ongoing program with no specific objective for 2023.

In 2022 the City of Oxnard approved a Climate Action and Adaptation Plan (CAAP). The CAAP builds on the City’s successes of implementing the City’s 2030 General Plan and recommits to furthering the City’s sustainability goals and policies. A primary goal of the CAAP is to improve climate and resilience citywide with particular attention to disadvantaged community areas.

The City continues to post and distribute information on currently available weatherization and energy conservation programs to residents and property owners through annual mailings in City utility billings and distributed program information to community organizations and at municipal offices; Community Development continued to enforce state requirements, including Title 24 of the California Code of Regulations, for energy conservation in new residential projects and encouraged residential developers to employ additional energy conservation measures for the siting of buildings, landscaping, and solar access; and Community Development continued to encourage development of affordable housing units that utilize passive or active energy saving features (e.g. solar panels, efficient appliances, and efficient building materials).

Program 21: Reasonable
Accommodation
Continue to implement reasonable
accommodation
ordinance for disabled persons.

Review requests for
reasonable
accommodation
as they are received.

Program 21 is an ongoing program.

As discussed under Program 6, in October 2023 the City amended OCC Section 16-501.5 (Reasonable Accommodation Findings) to only include objective considerations in compliance with the federal Fair Housing Amendment Act.

Program 22: Special
Needs Groups
Work to identify funding and assist in
addressing the housing
needs of special needs groups.

Identify funding
opportunities annually
and/or as funding
becomes available.

Program 22 is an ongoing program with an annual objective of assisting 90 households.

The Oxnard Housing Authority (OHA) adopted a homeless set aside program which allows a total of 15 housing choice vouchers (very-low income) to be set aside each OHA fiscal year for applicants who meet the definition of homelessness. During calendar year 2023,a total of 120 applicants were issued a homeless set aside voucher. In addition, the OHA awarded 40 project based vouchers for the Casa Aliento project and 35 project based vouchers for the Central Terrace Project. Both projects are scheduled to be completed in 2024 and target population is individuals who meet the definition of homeless and non-elderly disabled/homeless.

Program 23: Mobile Home
Park
Conservation Ordinance
Clarify the mobile home park
condominium
conversion process based on recent
case law.

Annually.

In 2023, the actions identified have not occurred. A review of recent case law pertaining to conversions of mobile home parks to condominium ownership to determine if there is a need to modify the mobile home conversion code and/or administrative procedures for mobile home park conversions has not been completed by the City Attorney's office.

Program 24: Annexation
Areas
Allow additional capacity
to meet the City’s RHNA.

Annexation of Rio Urbana
in Fiscal Year 2021-2022.

The Rio Urbana satisfies a portion of the City’s RHNA allocation, including 17 lower income units, 3 moderate and 147 above moderate units. The project was approved by the City of Oxnard in 2020, and Annexation was approved by the County of Ventura, Local Agency Formation Commission (LAFCO) in December 2021. Therefore this portion of the program has been fulfilled.

Program 25: Large
Households
Assist in the development
of larger units to
accommodate large
households
As project applications
are submitted
The 150-unit Cypress Place at Garden City development will be constucted in two phases and will be affordable multifamily rental housing. Phase 1 includes 90 units and a recreation center for tenants, 27 units within Phase 1 are three bedroom units that will accomdate larger families. Phase 1 of the project secured all needed funding and began construction in the March 2023 and is estimated to be completed in April 2025. Phase 2 is still in the process of securing financing. However, once constucted the project will include 21 three bedroom units. The 58-unit Dolores Huerta Gardens project, estiamted to be completed in the first quarter of 2025 will include 18 three bedroom units. 797
Program 26: Extremely
Low-
Income Households
Comply with AB 2634. to
accommodate at least
600 extremely low-income
units (which represents
2/3rd of the City’s
Extremely Low Income
RHNA) in areas
designated as moderate
or higher resource.

Beginning in Fiscal Year
2022-2023, as part of the
City’s Annual Housing
Element workshop, meet
with
developers to Look for
opportunities to develop
or facilitate
extremely low-income
units. provide assistance
to support
development on a project-
by-project basis
throughout the
planning period and on an
annual basis.

In 2022, the Casa De Carmen Permenant Supporitive Housing (PSH) Project, inclusive of 55 affordable PSH rental units and one manager's unit, began construction, the development will target formally homelesss households with annual incomes at 30% AMI. Construction is estimated to be compelted in 2025.

The Central Terrace Project, an 87 unit affordable rental housing development, inclusive of one manager's unit, also began construciton in 2022. The project recieved $1,250,000 in Affordable Housing in-lieu funds from the City in the form of a gap-financing loan and will be targeting households with incomes at 30%, 50% and 60% AMI. Constuction is estimated to be completed in 2024. In 2023, the Dolores Huerta Gardens project begain construciton. It is expected to be completed in the first quater of 2025 and will include 23 units designated for extremely low income households.

Program 27: Review of
Parking Standards
Continue to review alternative parking
requirements in all
zoning districts.

Amend parking
requirements by Fiscal
Year 2023-
2024 and monitor and
report every two years.

Program 27 is an ongoing program with a reporting requirement every two years.

In 2020, the City approved an ADU zone text amendment that included clarification of parking requirements consistent with State law. As discussed under Program 6, the City is in the process of updating Chapter 16 Zoning Code of the Oxnard City Code (OCC), including further update to ADU requirements to recognize current State law that no replacement parking spaces are required if using the garage for an ADU. Pursuant to the Fair Housing Act, the City is also clarify parking requirements for the facilities for elderly, such as independent living, assisted living, memory care as residential uses rather than health care facilities. Consistent with Program 6, the Zoning Code updates are scheduled to be complete in 2023.

Multifamily projects are generally reducing guest parking, utilizing tandem paring, and using more surface parking as the projects qualify for Density Bonus parking standards by complying with the City's Inclusionary Housing Ordinance. The City will continue to allow reduced parking requirements for senior and affordable housing projects with approval of a parking study as well as shared parking when uses with different peaking characteristics (such as offices and apartments) are combined in a single structure.

The City will also monitor the impacts of these parking studies and report every two years on any constraints identified in their annual Housing Element report to HCD (beginning in the 2023 APR). Planning developed the new Downtown Code approved in 2019 with reduced parking requirements for residential uses in the downtown and reductions for studio and one-bedroom apartments, as a result of a review city parking requirements. The City has not establish a fixed parking requirements for congregate living facilities, community care facilities and small residential care facilities for disabled person yet, nor explore the feasibility of an ordinance that would prohibit the long-term storage of cars in Program 28: Large Site
Program Assist with large site developmentAs project applications are submitted.

Program 28 is an ongoing program with no specific objective for 2023.

In April 2020 the City of Oxnard approved the Rio Urbana project for annexation and development of 167 mixed-income units a 10.24 acre parcel. Ventura County LAFCO approved the annexation of the Rio Urbana project site in December 2021. The City’s 2021-2029 Housing Element identifies three additional sites that qualify as Large Sites under this program, including a 13.94 acre parcel near Pleasant Valley Road and Oxnard Boulevard, the 44.21 acre Northeast Community/East Village Specific Plan site, and the 88.4 acre Teal Club Specific Plan site. The City will continue to facilitate mixed-income housing in future new growth areas of the city through development agreements and other mechanisms.

Program 29: City Owned
Sites
and Developer Assistance
Promote development of
affordable housing
projects on City-owned
sites and assist potential
developers with projects.

Accommodate 193 units
affordable to lower income
households on city-owned
properties in low resource
areas.

Beginning in FY 2022/-
2023, as part of the City’s
Annual Housing Element
workshop, outreach to the
community on uses for
surplus land, Promote
awareness of
availability of City-owned
sites and assist
applicants on an
ongoing basis;
disseminate information
on technical
assistance annually.

In 2021 the City executed a Disposition and Development Agreement with Community Development Partners (CDP) and the Housing Trust Fund Ventura County (HTF) for development of the Navigation Center at Casa De Carmen formally known as the Homeless Solutions Center and the 2nd and B Project, to be located on a City owned property at 241 W. 2nd Street in Downtown Oxnard.

In 2022 the City-owned property was donated to the HTF and the project began construction . The Casa De Carmen and the Navigation Center at Case De Carment will include a 110 emergency homeless shelter, office space for leasing and supprotive servicves providers, and 56 supprotive housing units (inclusive of 1 unrestricted manager's unit). Constuction is expected to be completed in the first quarter of 2025.

Program 30: Downtown
Infrastructure and
Financing Study
Ensure sufficient
infrastructure for housing
in Downtown.

Complete in Fiscal Year
2023-2024
Program 30 does not include specific objectives for 2023.

In 2019 the City of Oxnard approved a Downtown Development Code that was projected to result in approximately 2,300 more housing units in the downtown area. The City is conducting a utility capacity study to analyze the capacity and infrastructure upgrade needs for water/wastewater, stormwater, recycled water, refuse, and as needed a parking analysis/inventory to support the new housing units. The study is planned to be complete in Fiscal Year 2023-2024.

Program 31:

Oxnard Boulevard
Corridor, High Quality
Transit Corridor Sites
Selection and Analysis
Identifying parcels suitable and feasible
for housing development opportunities
within the Oxnard Boulevard Corridor
and develop an implemention and
financing approach to fund street
improvements within the Corridor.

Complete in Fiscal Year
2023-2024
Program 31 does not include specific objectives for 2023.

In 2016 the City completed a $250,000 study on transforming a 7.2 mile Oxnard Boulevard corridor into complete streets suitable for transit that would serve new medium- and high-density transit-oriented mixed-use and affordable housing development. Program 31 adds Saviers Road to the study area and identifies parcels suitable and feasible for multi-family housing development opportunities. Gold Coast Transit is planning to expand service in Oxnard’s High Quality Transit Corridor along Oxnard Boulevard sometime in the future.

The study results and a report is planned to be complete in Fiscal Year 2023- 2024.

Program 32:

Senate Bill 35 Procedure
or Policy
Streamline affordable housing projects.Ord complete in Fiscal Year 2021-2022; Dec.2023
In October 2021 the City adopted five ordinances for zoning code amendments to implement the City of Oxnard 2021-2029 Housing Element. These amendments included a new ministerial Site Plan Review (SPR) processes for by-right projects. As discussed under Program 6, the City is in the process of updating Chapter 16 Zoning Code of the Oxnard City Code (OCC), including objective development standards for multi-family development. Consistent with Program 6, the Zoning Code updates are scheduled to be complete by Dec. 2023.
798
Program 33:

Allow Housing in the
Business Research Park
(BRP) Zone
Evaluate opportunities for
housing in select BRP
zoned locations and
amend the zoning code to
allow housing.

Conduct outreach to
property owners and
community starting in
2023.

Fiscal Year 2023-2024
Program 33 does not have specific objectives for 2023.

In October 2021 the City adopted five ordinances for zoning code amendments to implement the City of Oxnard 2021-2029 Housing Element. These amendments included creation of new Affordable Housing additive zones and regulations (AHP and AHD) and an update to Business and Research Park (BRP) zone to allow residential development at a density of 30 dwelling units per acre in parcels zoned with the AHP or AHD additive zone. These zoning amendments accommodated approval of two projects with a total of 341 units affordable lower income households on two BRP AHD zoned parcels.

Program 33 also looks at the establishment of a BRP overlay zone that would provide property owners within the BRP zone with additional options for development of residential units with development standards specific to land use compatibility within the BRP zone. In 2021, in conjunction with preparation of the City’s 2021-2029 Housing Element, staff received letters of support for a BRP overlay zone from four property owners of BRP zoned sites located south of Hwy. 101 and east of Rice Avenue. Opportunities for a BRP overlay zone will be evaluated in Fiscal Year 2023-2024.

Program 34:

Pre-Approved Accessory
Dwelling Units (ADUs)
Support approval and
development of ADUs.

Utilizing pre-approved
ADU plans will reduce
overall development costs
and streamline approvals.

Accommodate at least
320 ADUs to increase
housing choices and
mobility to higher resource
areas.

By Fiscal Year 2023-2024
Program 34 does not have specific objectives for 2023.

The Ventura County Association of Governments (VCOG) is preparing ADU plans that can be pre-approved to streamline the ADU building permit approval process and lower development costs for ADUs. City Building Official will evaluate the plan provisions and determine how and if they can be utilized in the permitting of affordable housing in the City. Provided the VCOG plans are available to the City, the City Building Official will review the VCOG ADU plans by Fiscal Year 2024-2025.

Program 35:

ADU Monitoring Program
Support approval and
development of ADUs.

Assess ADU approval
progress at the time of
Annual Report submittal
and Implement No Net
Loss in
Program 3 if ADU
numbers are not tracking
with projections in
Chapter F of the Housing
Element.

Program 35 is an ongoing program.

The City monitors the number and affordability of ADUs as part of the City’s Housing Element Annual Report. The City has had great success with its ADU program and has greatly exceeded HCD recommended ADU assumption guidelines (“ADU Safe harbor justification”). A total of 327 ADU applications were filed in 2022, and 330 received planning entitlements. Additionally, 67 ADUs received building permits in 2022. The City's adopted 2021-2029 Housing Element projected 283 ADUs to be constructed in the 8-year planning period.

Based on ADU entitlement and construction trends, the City will meet this figure before 2029. The City will continue to promote the City’s successful ADU program, through the City’s website, which contains options to build ADUs and ADU resources.

Program 36:

ADU Promotion Program
Support approval and
development of ADUs.

Maintain ADU webpage on
an ongoing basis,
place examples of ADUs
on webpage, develop list
of
resources, and coordinate
with ADU development
and
financing community by
Fiscal Year 2023-2024.

Program 36 is an ongoing program with no specific objective for 2022.

The City will continue to encourage and publicize the accessory dwelling program on the City’s website to increase public awareness and promote the construction of ADUs. The ADU webpage provides answers to frequently asked questions (FAQs), steps to walk someone through the application process, a matrix to help a potential applicant decide which type of ADU to develop, and application worksheets for each of the seven types of ADUs allowed in the City. https://www.oxnard.org/city-department/community-development/adu-info/ Program 37:

Loss of Affordable Units
Maintain the number of
existing affordable units.

Ongoing, the replacement
requirement will be
implemented immediately
and applied as
applications on
identified sites are
received and processed.

Program 37 is an ongoing program.

In accordance with Government Code Section 65583.2(g), the City also will continue to require replacement housing units subject to the requirements of Government Code Section 65915 (c)(3) on sites identified in the Housing Element site inventory when any new development (residential, mixed-use, or non-residential) occurs on a site that has been occupied by or restricted for the use of lower-income households at any time during the previous five years. No development in 2023 has been subject to this requirement.

Program 38:

Institutional Land Use
Housing Opportunity
Program
Evaluate opportunities for
housing on institutional
properties and amend the
zoning code to allow
housing.

Amend zoning by Fiscal
Year 2024/2025
Program 38 does not have specific objectives for 2023.

The City will evaluate a program to allow institutional properties (properties owned by organizations having a social, educational, or religious purpose such as a school, church, hospital, club or lodge) to build housing affordable to lower income households and/or homeless shelters on their property as part of their mission/community outreach and in conjunction with their existing development or use on their property. The program is planned to be complete in Fiscal Year 2024-2025.

Program 39:

Special Needs Housing –
Farmworker Housing
Study
Achieve a greater
understanding of
farmworker needs and
tailor or develop programs
to meet those needs.

Completion by Fiscal Year
2024-2025
Program 39 does not have specific objectives for 2023.

The City will (1) work with the County of Ventura, advocacy groups, and agricultural organizations to plan, seek funding through grants or other sources for the implementation of a Ventura County’s countywide survey of farmworkers, employers, and housing providers to further define housing conditions, needs and barriers to farmworker housing; and (2) utilize the survey results to develop targeted programs and strategies to address the identified housing needs of farmworkers and to support agricultural businesses with a stable and healthy workforce. The program is planned to be complete in Fiscal Year 2024-2025.

Program 40:

Collaboration with the
Housing Trust Fund
Ventura County
Support development of
affordable housing units.

Ongoing, beginning in
Fiscal Year 2022-2023
The City's Housing Department Director is a member of the Housing Trust Fund Ventura County Board and continues to seek out opportunities for the City to collaborate with the Housing Trust Fund Ventura County for the development of affordable housing. In 2022 the City donatated a City owned property located at 241 W Second Street to the Housing Trust Fund Ventura County for the development of the Case De Carment project which will include 56 affordable rental units, inclusive of one unrestricted Manager's unit, a 110 bed emergency overnight shelter, and office space for supportive services providers and leasing. The project went into construction in 2022 and is expected to be completed in the first quater of 2025.

Program 41:

Annual Housing Element
Workshop
Check in regularly with the
community on housing
needs and programs.

Hold workshop during the
first quarter of the year
annually starting in Fiscal
Year 2021-2022
Program 41 is ongoing.

The City's Housing Element was completed and approved in October 2022. Due to the limited time between Housing Element adoption and Spring 2023, this program was not be implemented in 2023. The annual Housing Element workshop is scheduled for Spring 2024. As part of the process of preparing this report, the City will hold an annual Housing Element workshop to update the community on progress towards implementing the Housing Element. Outreach includes community based organizations with the intention of reaching all segments of the population.
799
Program 42:

ADU Construction Cost
Assistance and
Accelerator Program
Maintain affordability of
ADUs
Establish program by the
end of Fiscal Year 2022-
2023
Based on a review of existing ADU applications submitted to the Community Development Department, it appears that there is a large number of homeowners that have submitted applications to build ADUs on their property.

Therefore, there is not a need to financially incentivise ADU constuction at this time.
800
Jurisdiction Oxnard ANNUAL ELEMENT PROGRESS REPORT
Reporting Period 2023 (Jan. 1 - Dec. 31) Housing Element Implementation Planning Period 6th Cycle 10/15/2021 - 10/15/2029
Description of Commercial
Development Bonus
Commercial Development Bonus
Date Approved
3 4
APN Street Address Project Name+ Local Jurisdiction
Tracking ID+
Very Low
Income
Low
Income
Moderate
Income
Above Moderate
Income
Description of Commercial
Development Bonus
Commercial Development Bonus
Date Approved
Summary Row: Start Data Entry Below
Units Constructed as Part of Agreement
Commercial Development Bonus Approved pursuant to GC Section 65915.7 Table E
Note: "+" indicates an optional field
Project Identifier
1 2
Cells in grey contain auto-calculation
formulas
(CCR Title 25 §6202)
Annual Progress Report January 2020
801
Jurisdiction Oxnard ANNUAL ELEMENT PROGRESS REPORT Note: "+" indicates an optional field Reporting Period 2023 (Jan. 1 - Dec. 31) Housing Element Implementation Cells in grey contain auto-calculation formulas Planning Period 6th Cycle 10/15/2021 - 10/15/2029
The description should adequately document how each
unit complies with subsection (c) of Government Code
Section 65583.1+.

For detailed reporting requirements, see the chcklist
here:

Extremely Low-
Income+ Very Low-Income+ Low-Income+ TOTAL UNITS+
Extremely Low-
Income+
Very Low-
Income+ Low-Income+ TOTAL UNITS+
https://www.hcd.ca.gov/community-
development/docs/adequate-sites-checklist.pdf
Rehabilitation Activity
Preservation of Units At-Risk
Acquisition of Units
Mobilehome Park Preservation
Total Units by Income
Table F
Please note this table is optional: The jurisdiction can use this table to report units that have been substantially rehabilitated, converted from non-affordable to affordable by acquisition, and preserved, including mobilehome park preservation, consistent with the standards set forth in Government Code section 65583.1, subdivision (c). Please note, motel, hotel, hostel rooms or other structures that are converted from non-residential to residential units pursuant to Government Code section 65583.1(c)(1)(D) are considered net-new housing units and must be reported in Table A2 and not reported in Table F.

Activity Type
Units that Do Not Count Towards RHNA+
Listed for Informational Purposes Only
Units that Count Towards RHNA +
Note - Because the statutory requirements severely limit what can be counted, please contact HCD at [email protected] and we will unlock the form which enable you to populate these fields.

Units Rehabilitated, Preserved and Acquired for Alternative Adequate Sites pursuant to Government Code section 65583.1(c) Annual Progress Report January 2020
802
Jurisdiction Oxnard ANNUAL ELEMENT PROGRESS REPORT
Note: "+" indicates
an optional field
Reporting Period 2023 (Jan. 1 - Dec. 31) Housing Element Implementation Cells in grey contain auto-calculation formulas Planning Period 6th Cycle 10/15/2021 - 10/15/2029
Notes
2 3 6
Prior APN+ Current APN Street Address Project Name+
Local
Jurisdiction
Tracking ID
Unit Category
(2 to 4,5+)
Tenure
R=Renter
Very Low-
Income Deed
Restricted
Very Low-
Income Non
Deed
Restricted
Low- Income Deed
Restricted
Low- Income
Non Deed
Restricted
Moderate- Income
Deed Restricted
Moderate-
Income Non Deed
Restricted
Above
Moderate-
Income
Total Moderate Income Units
Converted from Above
Moderate
Date Converted Notes
Summary Row: Start Data Entry Below 0 0 0 0 0 0 0 0
Table F2
Above Moderate Income Units Converted to Moderate Income Pursuant to Government Code section 65400.2 For up to 25 percent of a jurisdiction’s moderate-income regional housing need allocation, the planning agency may include the number of units in an existing multifamily building that were converted to deed-restricted rental housing for moderate-income households by the imposition of affordability covenants and restrictions for the unit. Before adding information to this table, please ensure housing developments meet the requirements described in Government Code 65400.2(b). 5 Project Identifier Unit Types
1 4
Affordability by Household Incomes After Conversion Units credited toward Moderate Income RHNA
803
Jurisdiction Oxnard
Reporting Period 2023 (Jan. 1 - Dec. 31)
Planning Period 6th Cycle 10/15/2021 - 10/15/2029ANNUAL ELEMENT PROGRESS REPORT Housing Element Implementation
2 3 4
APN Street Address Project Name+ Local Jurisdiction
Tracking ID+
Realistic Capacity
Identified in the
Housing Element
Entity to whom the site
transferred Intended Use for Site
1 Summary Row: Start Data Entry Below
Note: "+" indicates an optional field
Cells in grey contain auto-calculation
formulas
Table G
Locally Owned Lands Included in the Housing Element Sites Inventory that have been sold, leased, or otherwise disposed of Project Identifier
NOTE: This table must only be filled out if the housing element sites inventory contains a site which is or was owned by the reporting jurisdiction, and has been sold, leased, or otherwise disposed of during the reporting year.
804
Jurisdiction Oxnard Note: "+" indicates an optional field Reporting Period 2023
(Jan. 1 - Dec.
31)
Cells in grey contain auto-calculation
formulas
Designation Size Notes
1 2 3 4 5 6 7
APN Street Address/Intersection Existing Use Number of
Units
Surplus
Designation
Parcel Size (in
acres) Notes
201021138,
201016013,
201021104,201021
136, 201021122,
201021123,
201021114,
201021113,
201021111,
201016012,
201016011,
201016010,
201016009,
201016008,
201016007,
201021130,
201021115,
201021112
Bounded by E. Fourth St to the North, Fifth St. to
the South, Oxnard Blvd to the West, and Meta
St. to the East. Other parcels include 400 South
Oxnard Boulevard, 127 Enterprise Street, 135
Enterprise Street, 147 Enterprise Street, 151
Enterprise Street, 157 Enterprise Street, 136
Enterprise Street, 135 East Fifth Street, 159 East
Fifth Street
Other 0 Surplus Land 2.01
City issued notice of availability for
these properties in May 2022 and
requested that all offers be made for
all of the parcels listed here together.
202010121,202010
123,
202010137,202010
135,
202010133,202010
131, 202010129,
202010127,
202010125
Bounded by W. Fourth St to the North, Plaza
Park to the South, S. C St. to the West, and S. B
St. to the East.

Other 0 Surplus Land 0.47
City issued notice of availability for
these properties in May 2022 and
requested that all offers be made for
all of the parcels listed here together.
202010120,
202010122,
202010143,
202010136,
202010140,
202010141
425 South B Street only parcel with an assigned
address. All reamaining parcels have no
assigned address and are bounded by by W.

Fourth St to the North, Plaza Park to the South,
S. C St. to the West, and S. B St. to the East,
other parcel includes
Other 0 Surplus Land 0.43
City issued notice of availability for
these properties in May 2022 and
requested that all offers be made for
all of the parcels listed here together.
202010524,
202010522,
202010520,
202010518
Bounded by Fifth St. to the North, W. Sixth St. to
the South, S. B St. to the West, and S. A St. to
the East
Other 0 Surplus Land 0.8
City issued notice of availability for
these properties in May 2022 and
requested that all offers be made for
all of the parcels listed here together.
202010523,
202010521,
202010519,
202010517,
202010512
538 South B Street is the only parcel with
assigned address. All other parcels have no
assigned addresses and are bounded by Fifth St.
to the North, W. Sixth St. to the South, S. B St. to
the West, and S. A St. to the East, other parcel
includes
Other 0 Surplus Land 0.15
City issued notice of availability for
these properties in May 2022 and
requested that all offers be made for
all of the parcels listed here together.
202010321,
202010311,
202010322
318 West Fifth St.is the only parcel with assigned
address. All other parcels have o assigned
address and are bounded by Fifth St. to the
North, W. Sixth St. to the South, S. C St. to the
West, and S. B St. to the East
Other 0 Surplus Land 0.13
City issued notice of availability for
these properties in May 2022 and
requested that all offers be made for
all of the parcels listed here together.
202010313 321 West Sixth Street Other 0 Surplus Land 0.06 City issued notice of availability for these properties in May 2022
202010302,
202010318
Bounded by Fifth St. to the North, W. Sixth St. to
the South, S. C St. to the West, and S. B St. to
the East
Other 0 Surplus Land 0.18
City issued notice of availability for
these properties in May 2022 and
requested that all offers be made for
all of the parcels listed here together.

NOTE: This table must contain an invenory of ALL
surplus/excess lands the reporting jurisdiction owns
Summary Row: Start Data Entry Below
Parcel Identifier

ANNUAL ELEMENT PROGRESS REPORT
Housing Element Implementation
Table H
Locally Owned Surplus Sites
For Ventura County jurisdictions, please format the APN's as follows:999-9-999-999 805
202010320,
202010314
Bounded by Fifth St. to the North, W. Sixth St. to
the South, S. C St. to the West, and S. B St. to
the East
Other 0 Surplus Land 0.19
City issued notice of availability for
these properties in May 2022 and
requested that all offers be made for
all of the parcels listed here together.
202010440 Located on A Street between W. Fourth St. and W Fifth St. Other 0 Surplus Land 0.18 City issued notice of availability for these properties in May 2022
202008519 418 West Fourth Street Other 0 Surplus Land 0.18 City issued notice of availability for these properties in May 2022
132003301 Located on River Park Blvd., nearest cross street is E. Vineyard Ave. Other 0 Surplus Land 1.4 City issued notice of availability for these properties in May 2022
2020054075,
2020054080 241 W Second Street Vacant 0 Exempt Surplus
Land 0.48
HCD issued the City a letter dated
May 26, 2022 stating that HCD
concluded that the property qualifies
as excempt surplus land.
806
807
808
Jurisdiction Oxnard ANNUAL ELEMENT PROGRESS REPORT
Reporting Period 2023 (Jan. 1 - Dec. 31) Housing Element Implementation Planning Period 6th Cycle 10/15/2021 - 10/15/2029
Project Type Date
Units (Beds/Student
Capacity) Granted
Density Bonus
Notes
2 3 5 6
APN Street Address Project Name+ Local Jurisdiction
Tracking ID+
Unit Category
(SH - Student Housing) Date Very Low- Income
Deed Restricted
Very Low- Income
Non Deed
Restricted
Low- Income Deed
Restricted
Low- Income Non
Deed Restricted
Moderate- Income
Deed Restricted
Moderate- Income
Non Deed
Restricted
Above
Moderate-
Income
Total Additional Beds
Created Due to Density
Bonus
Notes
Summary Row: Start Data Entry Below
Note: "+" indicates an optional field
Cells in grey contain auto-calculation formulas
Table J
Student housing development for lower income students for which was granted a density bonus pursuant to subparagraph (F) of paragraph (1) of subdivision (b) of Section 65915 Project Identifier Units (Beds/Student Capacity) Approved 1 4
NOTE: STUDENT HOUSING WITH DENSITY BONUS ONLY. This
table only needs to be completed if there were student housing projects WITH a density bonus approved pursuant to Government Code65915(b)(1)(F)
Annual Progress Report January 2020
809
Jurisdiction Oxnard ANNUAL ELEMENT PROGRESS REPORT
Reporting Period 2023 (Jan. 1 - Dec. 31)
Planning Period 6th Cycle 10/15/2021 - 10/15/2029
Table K
Tenent Preference Policy
Local governments are required to inform HCD about any local tenant preference ordinance the local government maintains when the jurisdiction submits their annual progress report on housing approvals and production, per Government Code 7061 (SB 649, 2022, Cortese). Effective January 1, 2023, local governments adopting a tenant preference are required to create a webpage on their internet website containing authorizing local ordinance and supporting materials, no more than 90 days after the ordinance becomes operational.

Does the Jurisdiction have a local tenant preference policy? If the jurisdiction has a local tenant preference policy, provide a link to the jurisdiction's webpage on their internet website containing authorizing local ordinance and supporting materials.

Notes
810
Jurisdiction Oxnard
Reporting Year 2023 (Jan. 1 - Dec. 31)
Total Award Amount Total award amount is auto-populated based on amounts entered in rows 15-26.

Task $ Amount Awarded $ Cumulative Reimbursement
Requested
Other
Funding Notes
Summary of entitlements, building permits, and certificates of occupancy (auto-populated from Table A2) Current Year
Deed Restricted 5
Non-Deed Restricted 2
Deed Restricted 18
Non-Deed Restricted 61
Deed Restricted 0
Non-Deed Restricted 29
139
254
Current Year
Deed Restricted 16
Non-Deed Restricted 22
Deed Restricted 74
Non-Deed Restricted 99
Deed Restricted 17
Non-Deed Restricted 29
384
641
Current Year
Deed Restricted 0
Non-Deed Restricted 10
Deed Restricted 0
Non-Deed Restricted 28
Deed Restricted 43
Non-Deed Restricted 7
284
372

ANNUAL ELEMENT PROGRESS REPORT
Local Early Action Planning (LEAP) Reporting
(CCR Title 25 §6202)
Please update the status of the proposed uses listed in the entity’s application for funding and the corresponding impact on housing within the region or jurisdiction, as applicable, categorized based on the eligible uses specified in Section 50515.02 or 50515.03, as applicable.
-$
Task Status
Total Units
Certificate of Occupancy Issued by Affordability Summary Income Level
Very Low
Low
Moderate
Above Moderate
Moderate
Above Moderate
Total Units
Completed Entitlement Issued by Affordability Summary
Income Level
Very Low
Low
Moderate
Above Moderate
Total Units
Building Permits Issued by Affordability Summary
Income Level
Very Low
Low
811
City of Oxnard
2023 General Plan and Housing Element
Annual Progress Report
Kathleen Mallory, AICP, Planning & Sustainability Manager Joe Pearson II, AICP, Planning & Environmental Services Manager Community Development Department
City Council
March 19, 2024
812
General Plan and Housing Element Annual Progress
Report
2 ● Annual Progress reports are required each year pursuant to state law.
● Submitted to Governor's Office of Planning and Research, and the State Department of Housing and Community
Development.
● Must be submitted by April 1st of each year.
● Purpose of Annual Reports:
○ Provide Status update for General Plan
○ Describe implementation progress
○ Document progress on Regional Housing Needs
Allocation (RHNA)
813
City of Oxnard 2030 General Plan 3
● State law requires the preparation
and adoption a comprehensive and
long-range General Plan for its
physical development.
● The General Plan provides a city
with a consistent framework for
land use and other
decision-making.
● All City actions affecting physical
development or the use of land
must implement and be found
consistent with the General Plan.

814
2030 General Plan Status
● During 2023, there were no General Plan Amendments. Since the adoption of the 2030 General Plan there have been 19 amendments.
4 815
Pending General Plan Amendments in 2023
● Teal Club Specific Plan Project (Planning and Zoning Permit No. 15-620-03), Located in area bounded by Doris Avenue on the north, Patterson Road on the west, Teal Club Road on the south, and Ventura Road on the east:
○ Proposed Specific Plan includes a request for 990 residential units of varying density, 24 acres, community park; 8 acres public/semi public use; 4 acres of mixed use, retail, commercial; 10 acres of Business/Research Park.
○ Adoption of a Teal Club Specific Plan (TCSP) and Pre-Zoning would allow for the annexation of a 174.6-acre collection of seven agricultural parcels (known locally as “Teal Club” ) to the City.
○ City staff is currently finalizing the Specific Plan and Development Agreement documents and preparing the project for public hearings in 2024.
5 816
Pending General Plan Amendments in 2023
● Maulhardt/Stiles NECSP Sub-Neighborhood Plan (Planning and Zoning Permit No. 21-620-04), Located at the Northeastern Corner of Rose Ave and Camino Del Sol (APN: 214-0-020-615; & 625):
○ Project proposes to create a Sub-Neighborhood Plan under the Northeast Community Specific Plan that would create the framework for a future development of approximately 500-950 residential units and approximately 40,000 square feet
commercial development on the 56 acres project site.
○ Proposed Tentative Tract Map proposes to create 14 master lots.
○ Project will also provide for 11.05 acres of improved park areas, including a 5.4 acre expansion of East Village Park.
6 817
Pending General Plan Amendments in 2023
● Rio Del Valle Campus Expansion Master Plan (Planning and Zoning Permit No. 23-620-02), Located at 3100 North Rose Avenue (APN: 144-0-110-445 & -650):
○ The project consists of a southern expansion area and improvements to the existing campus. The southern expansion area will accommodate classroom and athletic field expansions and a new transportation and parking facility, relocated from a previous antiquated facility on Vineyard Avenue.
○ In order to allow for the proposed expansion the existing campus and southern expansion area must be annexed into the City of Oxnard, which requires the General Plan Amendment to add the property to the 2030 General Plan.
7 818
Ordinance Amendments in 2023
• On November 7, 2023 the City Council adopted seven (7) ordinances to implement the City of Oxnard Housing
Element Programs related to:
• Program 6 (Zoning Code Amendments),
• Program 9 (Farmworker Housing),
• Program 22 (Special Needs Groups),
• Program 27 (Parking Standards), and
• Program 32 (Senate Bill 35)
8 819
Long Range Projects Currently Being Implemented
● Inclusionary Housing Ordinance Update (PZ No. 23-580-01):
○ In early 2022, staff launched community outreach program seeking input on potential changes to the City’s existing Inclusionary Housing Ordinance.
○ November 22, 2022 - the Community Services, Public Safety, Housing & Development Committee provided direction regarding key policy questions on the Inclusionary Housing Ordinance. ○ The Inclusionary Housing Ordinance Update was reviewed by the Planning Commission on April 6, 2023 and the Commission recommended substantial revisions to the draft ordinance. ○ The City is seeking an opinion from the State of California Attorney General on how local inclusionary units may be calculated in projects that are also seeking to utilize State Density Bonus as a means to secure additional density for a residential development project. ○ The draft Inclusionary ordinance has been placed on hold while the City waits for a response from the Attorney General.
9 820
Long Range Projects Currently Being Implemented 10
Local Coastal Plan Update
Climate Action & Adaptation Plan
Implementation
821
2023 Active Development - Sakioka Farm Specific Plan 11 Arctic Cold Storage (Operational)
● 576,000 square feet
● Cold storage building and fruit processing
facility
Amazon
(Operational)
● 1,527,505 square feet
● Multi-story e-commerce
storage and distribution
center
101 Logistics Center Area (Plan
Check)
Four industrial buildings totalling 778,720 square
feet and related site improvements on four
separate lots.
822
Active Development - RiverPark Specific Plan
Amendment (RPSP)
● In 2020, the applicant team submitted a request for an amendment to the RPSP, that would allow for the development of up to 1,025 additional residential units under the RPSP, in exchange for a reduction of up to approximately 562,457 square feet of non-residential development potential in accordance with specified development scenarios.
● The Project was approved by the City Council on March 15, 2022. ● The first project resulting from this approval was the 333-unit Fore Apartments at RiverPark project, which was approved by the Planning Commission on July 21, 2022. This Project has started construction. ● A second project proposed 280 units, referred to as “The Pointe”, was submitted in 2023 and is currently moving through the entitlement process.
12 823
Active Development - Village Specific Plan & Lockwood
Development Projects
The Village Specific Plan - Wagon Wheel
• In January 2009, City Council approved the entitlement permits for the Village Specific Plan to guide future development on the 62-acre project site -up to 1,500 dwelling units, 50,300 square feet of commercial development, and related roads, parking, and transit parking. • Project has been successfully building out.
• In 2023 continued construction of Town Square (mixed use 448-unit residential with 80 of the units restricted for moderate income and 34,310 sf of commercial)
Lockwood 1, 2, and 3 Development Projects
• 2021 City adopted an affordable housing additive zone (AH-Permitted and AH-Discretionary)
• Lockwood 1 (173 lower income apt. unit) and 2 (168 lower income apt. uits) are under construction in 2023
• Lockwood 3 (234 apts. units) is proposed
13 824
Accessory Dwelling Units 14
Annual ADU Statistics
Year
Planning
Applications
Received
Entitlements
Granted
Building Permit
Applications
Received
Building Permits
Issued
Final
Inspection/CO
2013 0 0 0 0 0
2014 1 0 0 0 0
2015 0 1 0 0 0
2016 0 0 1 0 0
2017 17 2 3 0 0
2018 44 25 20 4 1
2019 50 55 30 13 3
2020 129 123 111 27 9
2021 176 157 106 63 14
2022 327 338 335 75 61
2023 110* 111* 167 191 73
Total 811 855 773 373 161
*In April 2023, in order to help streamline the ADU permitting process, Planning no longer required separate planning application and entitlements. 825
Housing Development Activity in 2023 15
Planning and Building Permit Activity in 2023
Planning
Entitlements
Building
Permits
Certificates of
Occupancy
Single Family
Dwellings
2 7 4
Multi
Family/Apartments
142 443 295
Accessory Dwelling
Units
110 191 73
Total 254 641 372
826
16Regional Housing Needs Allocation Progress
Income
Level
RHNA
Allocation
by Income
Level
2021
(Partial) 2022 2023 2024 2025 2026 2027 2028 2029
Total Units to
Date (all
years)
Total
Remaining
RHNA by
Income Level
Percent
Completed
Very Low 1,840 4 101 38 143 1,735 8.24%
Low 1,071 7 78 173 258 986 26.17%
Moderate 1,538 15 3 46 64 1,520 4.21%
Above
Moderate 4,100
58 88 384 530 3,954 13.40%
Total
RHNA 8,549
Total Units 84 270 641 995 7,554

13.17 %
827
Affordable Units Constructed
● Total Units in 2023 - 641 units
➢ Very Low Income (50% of Area Median Income - AMI) - 38 units
➢ Low Income (80% AMI) - 173 units
➢ Moderate Income (120% AMI) - 46 units
➢ Above Moderate Income (+120% AMI) - 384 units
17 828
Recommendation
That the Oxnard City Council receive and file the City of Oxnard 2023 General Plan and Housing Element Annual
Progress Report.
18 829
End of Presentation
830

CITY COUNCIL AGENDA REPORT

REPORTS
AGENDA ITEM NO. N.7

DATE: March 19, 2024

TO: City Council

FROM: Jeff Pengilley, Community Development Director, (805) 385-8208, [email protected]

SUBJECT: Consider an Ordinance Amending Provisions of Chapter 11 of the Oxnard City Code Pertaining to Cannabis Regulations. (15 minutes)

RECOMMENDATION

That the City Council:

Introduce an ordinance (by title only, waiving further reading) titled:

"AN ORDINANCE OF THE CITY COUNCIL OF THE CITY OF OXNARD AMENDING PROVISIONS OF CHAPTER 11, ARTICLE XVII OF THE OXNARD CITY CODE PERTAINING TO CANNABIS REGULATIONS

REGARDING CANNABIS EMPLOYEE PERMITS, CANNABIS AUDIT PROCESSES, HOURS OF OPERATIONS, TRANSFER OF OWNERSHIP, AND A DEFINITION CLARIFICATION."

(This item did not originate in Committee).

Please click the following link to view the required Measure M pre-recorded presentation video: https://youtu.be/ckwlxuicU_c

BACKGROUND

The Council has approved a series of ordinances to allow the following cannabis uses: retail dispensaries (16 licenses); manufacturing (8 licenses); distribution (3 licenses); and testing laboratories (1 license). Most recently, in October 2023, the City Council adopted an ordinance (Ordinance No. 3032) which established new cannabis cultivation regulations and amended Oxnard City Code (OCC) regulations pertaining to cannabis businesses. These amendments to Chapters 11 and 16 clarified the permit processes, updated language to align with State guidelines, and streamlined the renewal processes for cannabis businesses.

As a result of implementing the cannabis programs and discussions with city departments involved with cannabis permitting and compliance, as well as the cannabis operators, seven amendments have been identified to: streamline business operations; expand hours of operations by two hours; address the transferring of ownership; and clarify a definition. These amendments pertain to Chapter 11 of the OCC.

ANALYSIS/DISCUSSION

The amendments identified below would be applicable to all cannabis uses and are considered non-substantial or minor in nature. The proposed OCC amendments do not increase the permitted number of retail, manufacturing, distribution, or testing laboratory licenses. Legislative ordinance changes and the proposed ordinance can be found in Attachments 1 and 2, respectively.

A summary of the OCC amendments is as follows:
831

1. Allow cannabis operators to self-certify all employees after the initial Cannabis Employee Permit is issued (OCC Sec. 11-455(F)).
• The current OCC requires that all cannabis employees receive City approval of a Cannabis Employee Permit (CEP). Per OCC, this permit expires every 3 years, upon which time the operator must secure renewal of a CEP for each employee. The current cost of the CEP renewal is $80 per employee. • This amendment would remove the three-year expiration time period for a CEP provided an employee complies with all stipulated CEP OCC code requirements. The operator would submit an affidavit attesting compliance with OCC regulations to the City at the time of annual Commercial Cannabis Business Permit (CEBP) renewal, the operator will be responsible for.
• Not requiring a CEP renewal would save staff time and applicants time and money; this change would result in a modest cost savings to operators.

2. Allow cannabis applicants to submit a cannabis financial audit report every two years (OCC Sec. 11-476). • The current OCC requires that all cannabis operators submit to the City financial audits on an annual basis, and pay their cannabis business tax quarterly. In November 2023, the City awarded a contract to Avenu Insights & Analytics, LLC. for cannabis financial auditing.
• This amendment allows for flexibility in the auditing frequency based on the discrepancy results of the audit. If the audit reveals a discrepancy of 5% or less of the reported annual gross receipts, then after the first year of a successful audit the operator will be required to submit a financial report to be audited 24 months after the most recent financial audit submitted for the prior 24-month reporting period. For example, a cannabis operator that passes a successful audit in 2023 would submit a financial audit in 2025 reflective of financial reporting associated with years 2024 and 2025. Not requiring an annual audit for those businesses with a discrepancy of 5% or less, would result in the operator not paying for the financial audit (which is $7,500) on an annual basis. If a financial audit reveals a discrepancy of greater than 5% (e.g, 5.01% or greater) of the reported gross receipts, then the cannabis operator would be subject to annual financial auditing for the next two years.

3. Amend the Certified Public Accountant (CPA) requirement for financial audits (OCC Sec. 11-476). • The current OCC requires operators to annually submit for City review and approval, a financial audit prepared by an independent certified public accountant.
• This amendment adds language that allows the City Manager to determine if the City requires the financial audit report to be prepared by a CPA firm. Through discussions with the City’s recently hired cannabis audit firm (Avenu Insights & Analytics, LLC.), staff learned that in many other jurisdictions cannabis audits are not prepared by a CPA. Financial accounting best practices can still be secured through a non-CPA financial auditing firm and the City’s audit requirements do not strictly necessitate the need for the audit report to be prepared by a CPA. The proposed amendment allows for more flexibility for cannabis operators without compromising financial accounting best practices.

4. Increase business hours of operation (OCC Sec. 11-485(L)). • The current OCC allows the operating hours for cannabis retailers to be 9:00 a.m. to 9:00 p.m. • This amendment would increase the operating hours to 8:00 a.m. to 10:00 p.m. The State of California, Department of Cannabis Control allows cannabis retailers to operate from 6:00 a.m. to 10:00 p.m. Retail cannabis operators have been conditioned to comply with the current OCC hour requirements. Therefore, cannabis retail operators who wish to increase their hours of operation, would need to apply for a major modification to their approved Special Use Permit (per OCC Sec. 16-561). The application would be subject to the review and approval by the Planning Commission and pay the discretionary permit fee of $6,825.00.

Upon reviewing existing ordinance language and evaluating the renewal process, additional amendments were identified to clarify business ownership, and a definition as follows:
832

5. Clarify that an operator may change the form of business entity without applying to the City Manager if the new business entity is identical (OCC Sec. 11-468(D)).
• The current OCC states that an operator may change the form of business entity without applying to the City Manager provided that the membership of the new business entity is substantially similar to the original permit holder business entity (at least 60% of the membership is identical). • This amendment would result in an operator being able to change the form of a business entity without applying to the City Manager provided that the membership and percentage of ownership of the new business entity are identical. This amendment is necessary to clarify the Council’s original intent, when adopting Ordinance 3032, to ensure that a change in business entity type is efficiently processed when the change in business type does not result in a change in control of the business.

6. Clarify that a change of ownership shall not result in a change of control (OCC Sec. 11-468(A) & (G)). • The current OCC states that a change of control is deemed to be the aggregate transfer of 40% or more of the original ownership of the permit.
• This amendment clarifies that the 40% threshold is based on the original ownership of the permit. The amendment further would require a permit holder to notify the City Manager within 10 days of any ownership change, regardless of whether or not that ownership change results in a “change of control.”

7. Clarify the definition of ‘Gross Receipts’ (OCC Sec. 11-485(N)(9)). • The current OCC states that an administrative ruling by the tax administrator is needed to determine that non- cannabis goods can be excluded from the definition of “Gross Receipts.” • This amendment would remove this statement to clarify that an administrative ruling is not necessary to determine whether or not non-cannabis goods shall be excluded from the definition of ‘Gross Receipts’.

STRATEGIC PRIORITIES

This agenda item supports the Economic Development strategy. The purpose of the Economic Development strategy is to focus on the retention and expansion of Oxnard businesses by increasing the skills and employability of our local workforce, inviting new business investments, and target site-based redevelopment opportunities.

FINANCIAL IMPACT

Adoption of this new ordinance could enable the cannabis businesses to increase their hours of operation and could potentially lead to an increase in cannabis business tax revenue for the City.

COMMITTEE OUTCOME

This amendment is not a land use decision, therefore it did not require consideration by the Planning Commission.

The City Council set clear policy direction over the last two years at various City Council meetings regarding the subject ordinance. There are no substance changes to the ordinance, therefore this ordinance did not go back to the Community Services, Public Safety, Housing and Development Committee.

Prepared by: Kathleen Mallory, Planning & Sustainability Manager, Matthew Simpkins, Management Analyst

ATTACHMENTS

1. Proposed Ordinance in Legislative Format - Chapter 11.

2. Proposed OCC City Council Ordinance - Chapter 11

3. March 19, 2024 City Council Presentation

833

CITY COUNCIL OF THE CITY OF OXNARD
ORDINANCE NO.

AN ORDINANCE OF THE CITY COUNCIL OF THE CITY OF OXNARD
AMENDING PROVISIONS OF CHAPTER 11, ARTICLE XVII OF THE OXNARD

CITY CODE PERTAINING TO CANNABIS REGULATIONS REGARDING

CANNABIS EMPLOYEE PERMITS, CANNABIS AUDIT PROCESSES, HOURS OF

OPERATIONS, TRANSFER OF OWNERSHIP, AND A DEFINITION
CLARIFICATION.

WHEREAS, the City Council has adopted Commercial Cannabis Regulations; and WHEREAS, the City Council desires to modify the City’s Commercial Cannabis Regulations to address the issues of transfer of ownership, hours of operation, employee permits and audit requirements.

NOW THEREFORE, THE CITY COUNCIL OF THE CITY OF OXNARD DOES HEREBY ORDAIN AS FOLLOWS:

PART 1. Chapter 11, Article XVII, Sec. 11-455 of the Oxnard City Code is hereby amended as follows:
“SEC. 11-455. CANNABIS EMPLOYEE PERMIT REQUIRED.
(F) An employee work permit shall be valid for a 36-month period and must be renewed every three years. Notwithstanding this requirement, an owner may self-certify, on a form provided by the city, that an employee complies with the requirements of this Section once the initial Cannabis Employee Permit has been obtained from the city. Renewal applications shall contain all the information required in subsection (C) above including the payment of a renewal application fee in an amount to be set by resolution of the city council.” PART 2. Chapter 11, Article XVII, Sec. 11-468 of the Oxnard City Code is hereby amended as follows:
“SEC. 11-468. TRANSFER OF CANNABIS BUSINESS PERMIT.
(A) The holder of a cannabis business permit shall not transfer ownership or control of the permit to another person unless and until the transferee obtains an amendment to the permit from the city manager or his or her designee stating that the transferee is now the permittee. Such an amendment may be obtained only if the transferee files an application with the city manager or his or her designee in accordance with all provisions of this article (as though the transferee were applying for an original cannabis business permit) accompanied by a transfer fee in an amount set by resolution of the city council (or if not set, shall be the same amount as the application fee), and the city manager or his or her designee determines, after hearing, in accordance with this section that the transferee passed the background check required for permittees and meets all other requirements of this article. The decision of the city manager is final. For the purposes of 834

Page 2 ends

this subsection (A), “control” shall be deemed to be the aggregate transfer of 40% or more of the original ownership of the permit and/or the change of control of the ownership as compared to original ownership of the permit. In addition, "control" shall mean any change in the local equity ownership interest in a business that obtained its commercial cannabis business permit as a local equity applicant
(B) Commercial cannabis business permits issued through the grant of a transfer by the city manager or his or her designee shall be valid for a period of one year beginning on the day the city manager or his or her designee approves the transfer of the permit. Before the transferee’s permit expires, the transferee shall apply for a renewal permit in the manner required by this article.
(C) Changes in ownership of a permittee business structure or a substantial change in the ownership of a permittee business entity (i.e changes that result in a cumulative change of more than 40% of the original ownership) must be approved by the city manager or his or her designee through the transfer process contained in subsection (A). Failure to comply with this provision is grounds for permit revocation.
(D) A permittee may change the form of business entity without applying to the city manager or his or her designee for a transfer of permit, provided that the membership and percentage of ownership of the new business entity are identical.is substantially similar to original permit holder business entity (at least 60% of the membership is identical). The permit holder shall notify the city manager in writing of the change within ten days of the change. Failure to comply with this provision is grounds for permit revocation.”
(E) No commercial cannabis business permit may be transferred when the city manager or his or her designee has notified the permittee that the permit has been or may be suspended or revoked.
(F) Any attempt to transfer a commercial cannabis business permit either directly or indirectly in violation of this section is hereby declared void, and such a purported transfer shall be deemed a ground for revocation of the permit.
(G) Notwithstanding any language in this section to the contrary, no transfer of a local equity ownership interest in a business that obtained its commercial cannabis business permit as a local equity applicant shall be allowed if such proposed transfer would reduce the local equity interest in the commercial cannabis business to a level below that required for a local equity applicant if a change of ownership does not constitute a change in "control" as defined in subsection (A), the permit holder still shall notify the city manager in writing of any change of ownership within ten days of the change. Failure to comply with this provision is grounds for permit revocation.

PART 3. Chapter 11, Article XVII, Sec. 11-476 of the Oxnard City Code is hereby amended as follows:
“SEC. 11-476. RECORDS, AND RECORDKEEPING AND AUDITING.
(A) Each owner and operator of a commercial cannabis business shall maintain accurate books and records in an electronic format, detailing all of the revenues and expenses of the business, and all of its assets and liabilities. On no less than an annual basis (at or before the time of the 835

Page 3 ends

renewal of a commercial cannabis business permit issued pursuant to this article), or at any time upon reasonable request of the city, each commercial cannabis business shall file a sworn statement detailing the number of sales by the commercial cannabis business during the previous 12-month period (or shorter period based upon the timing of the request), provided on a per- month basis. The statement shall also include gross sales for each month, and all applicable taxes paid or due to be paid. On an annual basis, each owner and operator shall submit to the city a financial audit of the business’s operations conducted by an independent certified public accountant. Each permittee shall be subject to a regulatory compliance review and financial audit as determined by the city manager or his or her designee(s). (B) On no less than an annual basis (at or before the time of the renewal of a commercial cannabis business permit issued pursuant to this article), each owner and operator shall submit to the city a financial audit of the business’s operations. The audit shall be conducted by a certified public accountant if required by the city manager.
(C) Notwithstanding anything in subsection (B) to the contrary, if a financial audit required by this article reveals a discrepancy of 5% or less of the reported gross receipts, then thereafter the owner or operator shall submit a financial audit within 24 months of the most recent financial audit submitted for the prior 24-month reporting period. (D) If a financial audit required by this section reveals a discrepancy of greater than 5% of the reported gross receipts, then thereafter the owner or operator shall be required to submit financial audits on an annual basis for the next two years. If both of those financial audits reveal a discrepancy of 5% or less, then the owner or operator shall be subject to the requirements of subsection (C). Otherwise, the owner or operator shall continue to be required to submit audits as required by subsection (B).
(B)(E) Each owner and operator of a commercial cannabis business shall maintain a current register of the names and the contact information (including the name, address, and telephone number) of anyone owning or holding an interest in the commercial cannabis business, and separately of all the officers, managers, employees, agents and volunteers currently employed or otherwise engaged by the commercial cannabis business. The register required by this paragraph shall be provided to the city manager or his or her designee(s) upon request. (C)(F) All commercial cannabis businesses shall maintain an inventory control and reporting system that accurately documents the present location, amounts, and descriptions of all cannabis and cannabis products for all stages of the growing and production or manufacturing, laboratory testing and distribution processes. until purchase as set forth MAUCRSA. (D)(G) Each commercial cannabis business shall allow the city to have access to the businesses books, records, accounts, together with any other data or documents relevant to its permitted commercial cannabis activities, for the purpose of conducting an audit or examination. Books, records, accounts, and any and all relevant data or documents will be produced no later than 24 hours after receipt of the city's request, unless otherwise stipulated by the city. The city may require the materials to be submitted in an electronic format that is compatible with the city's software and hardware.”
836

Page 4 ends

PART 4. Chapter 11, Article XVII, Sec. 11-485 of the Oxnard City Code is hereby amended as follows:
“SEC. 11-485. OPERATING REQUIREMENTS FOR RETAIL FACILITIES. (L) Operating hours of the retailer license shall be limited to the hours of 89:00 a.m. through 109:00 p.m., seven days a week or a reduced duration as stipulated through the discretionary land use permit.”
PART 5. Chapter 11, Article XVI, Sec. 11-413 of the Oxnard City Code is hereby amended as follows:
“SEC. 11-485. DEFINITIONS.
(N) GROSS RECEIPTS - Except as otherwise specifically provided, means, whether designated a sales price, royalty, rent, commission, dividend, or other designation, the total amount (including all receipts, cash, credits, services and property of any kind or nature) received or payable for sales of goods, wares or merchandise or for the performance of any act or service of any nature for which a charge is made or credit allowed (whether such service, act or employment is done as part of or in connection with the sale of goods, wares, merchandise or not), without any deduction therefrom on account of the cost of the property sold, the cost of materials used, labor or service costs, interest paid or payable, losses or any other expense whatsoever. However, the following shall be excluded from the definition of GROSS RECEIPTS:
(1) Cash discounts where allowed and taken on sales;
(2) Any tax required by law to be included in or added to the purchase price and collected from the consumer or purchaser;
(3) Such part of the sale price of any property returned by purchasers to the seller as refunded by the seller by way of cash or credit allowances or return of refundable deposits previously included in gross receipts;
(4) Receipts derived from the occasional sale of used, obsolete or surplus trade fixtures, machinery or other equipment used by the taxpayer in the regular course of the taxpayer’s business;
(5) Cash value of sales, trades or transactions between departments or units of the same business;
(6) Whenever there are included within the gross receipts amounts which reflect sales for which credit is extended and such amount proved uncollectible in a subsequent year, those amounts may be excluded from the gross receipts in the year they prove to be uncollectible; provided, however, if the whole or portion of such amounts excluded as uncollectible are subsequently collected, they shall be included in the amount of gross receipts for the period when they are recovered;
837

Page 5 ends

(7) Receipts of refundable deposits, except that such deposits when forfeited and taken into income of the business shall not be excluded when in excess of $1; (8) Amounts collected for others where the business is acting as an agent or trustee and to the extent that such amounts are paid to those for whom collected. These agents or trustees must provide the city’s finance department with the names and the addresses of the others and the amounts paid to them. This exclusion shall not apply to any fees, percentages, or other payments retained by the agent or trustees;
(9) Retail sales of t-shirts, sweaters, hats, stickers, key chains, bags, books, posters, rolling papers, cannabis accessories such as pipes, pipe screens, vape pen batteries (without cannabis) or other personal tangible property that do not contain cannabis which the tax administrator has excluded in writing by issuing an administrative ruling per section 11-423 shall not be subject to the cannabis business tax under this article. However, any business activities not subject to this article as a result of the administrative ruling shall be subject to the appropriate business tax provision of article I of chapter 11 or any other chapter or title as determined by the tax administrator. Non-cannabis goods are not exempt from sales tax.” PART 6. SEVERABILITY
If any section, subsection, subdivision, paragraph, sentence, clause or phrase, or portion of this Ordinance is, for any reason, held to be unconstitutional or invalid or ineffective by any court of competent jurisdiction, such decision shall not affect the validity or effectiveness of the remaining portions of this Ordinance or any part thereof. The City Council hereby declares that it would have adopted this Ordinance and each section, subsection, subdivision, paragraph, sentence, clause or phrase of this Ordinance irrespective of the fact that one or more sections, subsections, subdivisions, paragraphs, sentences, clauses or phrases be declared unconstitutional or invalid or ineffective. To this end, the provisions of this Ordinance are declared to be severable.

PART 7. Pursuant to Cal. Gov. Code Section 36933(c)(1), the City Attorney was designated to prepare, and the City Clerk published, a summary of this ordinance, and a certified copy of the ordinance was posted in the Office of the City Clerk a minimum of five days before the City Council’s adoption of the ordinance.

PART 8. The City Clerk shall certify as to the adoption of this ordinance and shall cause the summary thereof to be published within fifteen (15) days of the adoption and shall post a certified copy of this ordinance, including the vote for and against the same, in the office of the City Clerk, in accordance with Government Code Section 36933.

838

CITY COUNCIL OF THE CITY OF OXNARD
ORDINANCE NO.

AN ORDINANCE OF THE CITY COUNCIL OF THE CITY OF OXNARD
AMENDING PROVISIONS OF CHAPTER 11, ARTICLE XVII OF THE OXNARD

CITY CODE PERTAINING TO CANNABIS REGULATIONS REGARDING

CANNABIS EMPLOYEE PERMITS, CANNABIS AUDIT PROCESSES, HOURS OF

OPERATIONS, TRANSFER OF OWNERSHIP, AND A DEFINITION
CLARIFICATION.

NOW THEREFORE, THE CITY COUNCIL OF THE CITY OF OXNARD DOES HEREBY ORDAIN AS FOLLOWS:

Page 2 ends

this subsection (A), “control” shall be deemed to be the aggregate transfer of 40% or more of the original ownership of the permit and/or the change of control of the ownership as compared to original ownership of the permit. In addition, "control" shall mean any change in the local equity ownership interest in a business that obtained its commercial cannabis business permit as a local equity applicant
(B) Commercial cannabis business permits issued through the grant of a transfer by the city manager or his or her designee shall be valid for a period of one year beginning on the day the city manager or his or her designee approves the transfer of the permit. Before the transferee’s permit expires, the transferee shall apply for a renewal permit in the manner required by this article.
(C) Changes in ownership of a permittee business structure or a substantial change in the ownership of a permittee business entity (i.e changes that result in a cumulative change of more than 40% of the original ownership) must be approved by the city manager or his or her designee through the transfer process contained in subsection (A). Failure to comply with this provision is grounds for permit revocation.
(D) A permittee may change the form of business entity without applying to the city manager or his or her designee for a transfer of permit, provided that the membership and percentage of ownership of the new business entity are identical. The permit holder shall notify the city manager in writing of the change within ten days of the change. Failure to comply with this provision is grounds for permit revocation.”
(E) No commercial cannabis business permit may be transferred when the city manager or his or her designee has notified the permittee that the permit has been or may be suspended or revoked. (F) Any attempt to transfer a commercial cannabis business permit either directly or indirectly in violation of this section is hereby declared void, and such a purported transfer shall be deemed a ground for revocation of the permit.
(G) Notwithstanding any language in this section to the contrary, if a change of ownership does not constitute a change in "control" as defined in subsection (A), the permit holder still shall notify the city manager in writing of any change of ownership within ten days of the change.

Failure to comply with this provision is grounds for permit revocation.

PART 3. Chapter 11, Article XVII, Sec. 11-476 of the Oxnard City Code is hereby amended as follows:
“SEC. 11-476. RECORDS, RECORDKEEPING AND AUDITING
(A) Each owner and operator of a commercial cannabis business shall maintain accurate books and records in an electronic format, detailing all of the revenues and expenses of the business, and all of its assets and liabilities. On no less than an annual basis (at or before the time of the renewal of a commercial cannabis business permit issued pursuant to this article), or at any time upon reasonable request of the city, each commercial cannabis business shall file a sworn statement detailing the number of sales by the commercial cannabis business during the previous 12-month period (or shorter period based upon the timing of the request), provided on a per- 840
Ordinance No.

Page 3 ends

month basis. The statement shall also include gross sales for each month, and all applicable taxes paid or due to be paid.
(B) On no less than an annual basis (at or before the time of the renewal of a commercial cannabis business permit issued pursuant to this article), each owner and operator shall submit to the city a financial audit of the business’s operations. The audit shall be conducted by a certified public accountant if required by the city manager.
(C) Notwithstanding anything in subsection (B) to the contrary, if a financial audit required by this article reveals a discrepancy of 5% or less of the reported gross receipts, then thereafter the owner or operator shall submit a financial audit within 24 months of the most recent financial audit submitted for the prior 24-month reporting period. (D) If a financial audit required by this section reveals a discrepancy of greater than 5% of the reported gross receipts, then thereafter the owner or operator shall be required to submit financial audits on an annual basis for the next two years. If both of those financial audits reveal a discrepancy of 5% or less, then the owner or operator shall be subject to the requirements of subsection (C). Otherwise, the owner or operator shall continue to be required to submit audits as required by subsection (B).
(E) Each owner and operator of a commercial cannabis business shall maintain a current register of the names and the contact information (including the name, address, and telephone number) of anyone owning or holding an interest in the commercial cannabis business, and separately of all the officers, managers, employees, agents and volunteers currently employed or otherwise engaged by the commercial cannabis business. The register required by this paragraph shall be provided to the city manager or his or her designee(s) upon request. (F) All commercial cannabis businesses shall maintain an inventory control and reporting system that accurately documents the present location, amounts, and descriptions of all cannabis and cannabis products for all stages of the growing and production or manufacturing, laboratory testing and distribution processes.
(G) Each commercial cannabis business shall allow the city to have access to the businesses books, records, accounts, together with any other data or documents relevant to its permitted commercial cannabis activities, for the purpose of conducting an audit or examination. Books, records, accounts, and any and all relevant data or documents will be produced no later than 24 hours after receipt of the city's request, unless otherwise stipulated by the city. The city may require the materials to be submitted in an electronic format that is compatible with the city's software and hardware.”
PART 4. Chapter 11, Article XVII, Sec. 11-485 of the Oxnard City Code is hereby amended as follows:
“SEC. 11-485. OPERATING REQUIREMENTS FOR RETAIL FACILITIES. (L) Operating hours of the retailer license shall be limited to the hours of 8:00 a.m. through 10:00 p.m., seven days a week or a reduced duration as stipulated through the discretionary land use permit.”
841
Ordinance No.

Page 4 ends

PART 5. Chapter 11, Article XVI, Sec. 11-413 of the Oxnard City Code is hereby amended as follows:
“SEC. 11-485. DEFINITIONS.
(N) GROSS RECEIPTS - Except as otherwise specifically provided, means, whether designated a sales price, royalty, rent, commission, dividend, or other designation, the total amount (including all receipts, cash, credits, services and property of any kind or nature) received or payable for sales of goods, wares or merchandise or for the performance of any act or service of any nature for which a charge is made or credit allowed (whether such service, act or employment is done as part of or in connection with the sale of goods, wares, merchandise or not), without any deduction therefrom on account of the cost of the property sold, the cost of materials used, labor or service costs, interest paid or payable, losses or any other expense whatsoever. However, the following shall be excluded from the definition of GROSS RECEIPTS:
(1) Cash discounts where allowed and taken on sales;
(2) Any tax required by law to be included in or added to the purchase price and collected from the consumer or purchaser;
(3) Such part of the sale price of any property returned by purchasers to the seller as refunded by the seller by way of cash or credit allowances or return of refundable deposits previously included in gross receipts;
(4) Receipts derived from the occasional sale of used, obsolete or surplus trade fixtures, machinery or other equipment used by the taxpayer in the regular course of the taxpayer’s business;
(5) Cash value of sales, trades or transactions between departments or units of the same business;
(6) Whenever there are included within the gross receipts amounts which reflect sales for which credit is extended and such amount proved uncollectible in a subsequent year, those amounts may be excluded from the gross receipts in the year they prove to be uncollectible; provided, however, if the whole or portion of such amounts excluded as uncollectible are subsequently collected, they shall be included in the amount of gross receipts for the period when they are recovered;
(7) Receipts of refundable deposits, except that such deposits when forfeited and taken into income of the business shall not be excluded when in excess of $1; (8) Amounts collected for others where the business is acting as an agent or trustee and to the extent that such amounts are paid to those for whom collected. These agents or trustees must provide the city’s finance department with the names and the addresses of the others and the amounts paid to them. This exclusion shall not apply to any fees, percentages, or other payments retained by the agent or trustees;
842
Ordinance No.

Page 5 ends

Oxnard City CouncilMarch 19, 2024

Oxnard City Council
March 19, 2024