Palm Springs City Council
July 8, 2026

ATTACHMENT C
CONTRACT SERVICES AGREEMENT NO. A8535

CONTRACT SERVICES AGREEMENT

PARKING MANAGEMENT SERVICES

AT PALM SPRINGS INTERNATIONAL AIRPORT
THIS CONTRACT SERVICES AGREEMENT ("Agreement') is entered into, and effective on April 1, 2020, between the CITY OF PALM SPRINGS, a California charter city and municipal corporation, (" City') and ABM AVIATION, INC., a Georgia corporation, (" Contractor"). Cityand Contractorare individuallyreferredto as" Party"and are collectively referred to as the "Parties".

RECITALS
WHEREAS, City owns and operates the Palm Springs International Airport, a public airport hereinafter referred to as "Airport", located in the City of Palm Springs, California; and
WHEREAS, City has determined that there is a need for Parking Management Services in the vicinity of the Airlines Passenger Terminal Building at the Airport Terminal") for use by the public; and
WHEREAS, City requires special professional services concerning the management of said automobile parking facilities, including but not limited to management, operation, recordkeeping, accounting, auditing, revenuecontrol, cash and credit card deposits, traffic enforcementofficer (TEO) and providing services to users of such automobile parking facilities and the public, equipment maintenance, repair and replacement to include shuttle bus operations for the holiday season (" Services"); WHEREAS, ContractorandCity desireto enter intothisAgreementto operateand manage said automobileparking facilities upon the terms and conditions herein; and in considerationof these promises and mutual obligations, covenants, and conditions, the Parties agree as follows:

AGREEMENT

1. SERVICES OF CONTRACTOR

1. 1 Scope of Services. In compliance with all terms and conditions of this.

Agreement, Contractoragrees to performthe Contractservices set forth in the Scope of Services described in Exhibit " A" ( the " Services" or " Work") , which is attached and incorporated by reference. As a material inducement to the City entering into this Agreement, Contractor represents and warrants that Contractor is a provider of first class work and Contract services and that Contractor is experienced in performing the Work and Services contemplated and, in light of such status and experience, Contractor 1 covenants that it shall follow the highest Contract standards in performing the Work and Services required in this Agreement. For purposes of this Agreement, the phrase" highest Contract standards" shall mean those standards of practice recognized as high quality among well-qualified and experiencedcontractorsperformingsimilar work under similar circumstances.

1.2 Contract Documents. The Agreement between the Parties shall consist of the following: (1) this Agreement; (2) the Scope of Services; (3) the City's Request for Proposals; and, (4) the Contractor' s signed, original proposal submitted to the City Contractor' s Proposal"), ( collectively referred to as the " Contract Documents"). The City's Requestfor Proposalsand the Contractor's Proposal, which are both attached as Exhibits "B" and "C," respectively, are incorporatedby referenceand are made a part of this Agreement. The Scope of Services shall include the Contractor' s Proposal. All provisionsofthe Scopeof Services, the City's Requestfor Proposalsandthe Contractor's Proposalshall be bindingon the Parties. Shouldany conflict or inconsistencyexist in the Contract Documents, the conflict or inconsistency shall be resolved by applying the provisions in the highest priority document, which shall be determined in the following order of priority: ( 1st) the provisions of the Scope of Services ( Exhibit " A"); ( 2nd) the provisions of the City' s Request for Proposal ( Exhibit " B"); ( 31d) the terms of this Agreement; and, (4th) the provisionsof the Contractor's Proposal (Exhibit"C").

1.3 Compliance with Law. Contractor warrants that all Services rendered shall be performedin accordancewith all applicablefederal, state, and local laws, statutes, ordinances, lawful orders, rules, and regulations.

1. 4 Licenses, Permits. Fees, and Assessments. Contractor represents and warrantsto Citythatit hasobtainedall licenses, permits, qualifications, andapprovalsof whatever naturethat are legally requiredto practiceits professionand performthe Work and Services required by this Agreement. Contractor represents and warrants to City that Contractorshall, at its sole cost and expense, keep in effect at all times during the term of this Agreement, any license, permit, qualification, or approval that is legally required for Contractor to perform the Work and Services under this Agreement.

Contractorshall have the sole obligationto pay for any fees, assessments, and taxes, plus applicable penalties and interest, which may be imposed by law and arise from or arenecessaryfortheContractor'sperformanceoftheWorkandServicesrequiredbythis Agreement. Contractorshallindemnify, defend, andholdharmlessCityagainstanysuch fees, assessments, taxes, penalties, or interestlevied, assessed, or imposedagainst City to the fullest extent permitted by law.

1.5 Familiarity with Work. By executingthis Agreement, Contractor warrants that Contractor (a) has thoroughly investigated and consideredthe Scope of Services to be performed, (b) hascarefullyconsideredhowtheServicesshouldbeperformed, and (c) fully understandsthefacilities, difficulties, andrestrictionsattendingperformanceof the Services under this Agreement. If the Services involve work upon any site, Contractor warrantsthat Contractorhas or will investigatethe site and is or will be fully acquainted 2 with the conditionsthere existing, prior to commencementof any Services. Should the Contractor discover any latent or unknown conditions that will materially affect the performanceof the Services, Contractorshallimmediatelyinformthe Cityof suchfact and shall not proceed except at Contractor's risk until written instructionsare received from the City.

1.6 Care of Work. Contractor shall adopt reasonable methods during the term of the Agreement to furnish continuous protection to the Work and the equipment, materials, papers, documents, plans, studies, and/or other components to prevent losses or damages. Contractor shall be responsible for all such damages, to persons or property, until acceptance of the Work by the City, except such losses or damages as may be caused by City' s own negligence.

1.7 Further Responsibilities of Parties. Parties agree to use reasonable care and diligenceto performtheir respectiveobligations under this Agreement. Parties agree to act in good faith to execute all instruments, prepare all documents, and take all.actions as may be reasonablynecessaryto carry out the purposesof this Agreement.

1.8 Additional Services. City shall have the right at any time during the performance of the Services, without invalidating this Agreement, to order extra work beyond that specified in the Scope of Services or make changes by altering, adding to, or.deducting' from such Work. No such extra work may be undertakenunless a written order is first given by the City to the Contractor, incorporating any adjustment in (i) the Maximum ContractAmount, as defined below, and/or (ii) the time to performthis Agreement. Any adjustments must also be approved in writing by the Contractor. Any increase in compensation of up to ten percent ( 10%) of the Maximum Contract Amount or twenty five thousanddollars ($25,000), whichever is less, may be approvedby the City Manager, or his designee, as may be needed to perform any extra work. Any greater increases, occurringeitherseparatelyor cumulatively, mustbeapprovedbythe PalmSpringsCity Council. It isexpresslyunderstoodbyContractorthattheprovisionsofthissectionshall not applyto the servicesspecificallyset forth or reasonablycontemplatedwithinthe Scope of Services.

1.9 FAA Required Provisions. Those certainprovisionsset forthwithin Exhibit"G," Federal Aviation Administration Required Provisions," attached and made part hereof, arethoseSpecificprovisionsrequiredby the FAAto beappropriatelyincludedwithinall agreements between City and all entities who use or performwork or conduct activities on City owned Airport premise's for aeronauticalor non-aeronauticalpurposes.

Contractor, by its signaturehereuntoaffixed, acknowledgesthat it is has reviewedthe aforesaid Exhibit in its entirety, and fully understandsthe meaning, purpose, and intent thereof. Contractorexpresslyagrees that, throughoutthe.life of this agreementhereof, it shallfully and faithfullycomplywith, abideby and adhereto, as applicableand appropriate, the provisions as contained within Exhibit "G." 3 2. COMPENSATION

2. 1 Maximum Contract Amount. For the Services rendered under this Agreement, Contractor shall be compensated by City in accordance with the Schedule of Compensation, which is attached as Exhibit " F" and incorporated in this Agreement by reference. Compensation shall not exceed the maximum contract amount of Four Million Two Hundred Seventy Thousand Seven Hundred Ninety Six Dollars, ($ 4, 270, 796) Maximum Contract Amount"), except as may be provided under Section 1.8. The method of compensation shall be as set forth in Exhibit" F." Compensation for necessary expenditures must be approved in advance by the Contract Officer designated under Section 4.2 and will only be approved if such expenses are also specified in the Schedule of Compensation. The Maximum Contract Amount shall include the attendance of Contractor at all Project meetings reasonably deemed necessary by the Airport.

Contractor shall not be entitled to any increase in the Maximum Contract Amount for attending these meetings. Contractor accepts the risk that the services identified in the Scope of Services may be more costly and/or time-consuming than Contractor anticipates, that Contractor shall not be entitled to additional compensation, and that the provisions of Section 1.8 shall not be applicable to the services identified in the Scope of Services. The maximum amount of City's payment obligation under this section is the amount specified in this Agreement. If the City's maximum payment obligation is reached before the Contractor' s Services under this Agreement are completed, Contractor shall complete the Work and City shall not be liable for payment beyond the Maximum Contract Amount.

2.2. Method of Payment. The City shall pay contractor the annual Management Fee in amounts specified in Exhibit F to this agreement. The annual Management Fee shall be divided into twelve ( 12) equal installments and paid monthly to the Contractor.

Contractorshall invoice the City for ManagementFees by the 15rhof each monthfor the prior month' s services.

Invoices will be supported with appropriate details of hours worked by category. There shall be a maximum of one ( 1) payment per month.

2.3 Changes in Scope. In the event any change or changes in the Scope of Services is requestedby the City, Parties shall execute a written amendmentto this Agreement, specifyingall proposedamendments, including, but not limitedto, any additionalfees. An amendment may be entered into:

A. To provide for revisions or modificationsto documents, work product, or work, when required by the enactment or revision of any subsequent law; or B. To providefor additionalservices not includedin this Agreementor not customarily furnished in accordance with generally accepted practice in Contractor' s profession. 4 2.4 Security Instrument. Concurrent with execution of this Agreement, Contractor shall furnish City with an irrevocable letter of credit, or equivalent security instrument, for Contractor's faithful performanceof this Agreementin the principalsum of Two Hundred Thousand Dollars ($ 200,000) issued by a surety company licensed to do such business in the State of California and acceptable and satisfactory to the City, ( the " Security Instrument').

The security instrument shall be maintained and kept in full force and effect by Contractor from the date of the signing of this Agreement to the termination date of this Agreement; which shall be conditioned to insure the faithful and full performance by Contractor of all covenants, terms and conditions of this Agreement and to stand as security for all payment by Contractorof valid claims by City against Contractor, along with any other security identified by City.

If at any time this Agreement terminates or is terminated, there is due and owing to City any sum payable under the terms hereof, or, if City has any claim against Contractor arising out of this Agreement, then said Security Instrumentor any part thereof shall be applied to the amount due or in settlement of the claim or claims by City against Contractor.

3. SCHEDULE OF PERFORMANCE

3. 1 Time of Essence. Time is of the essence in the performance of this Agreement.

The time for completion of the services to be performed by Contractor is an essential condition of this Agreement. Contractor shall prosecute regularly and diligently the work of this agreement according to the agreed upon Schedule of Performance.

3. 2 Schedule of Performance. Contractor shall commence the Services under this Agreement upon receipt of a written notice to proceed and shall perform all Services within the time period(s) established in the Schedule of Performance. Contractor shall install all proposed facility equipment not later than one hundred and fifty ( 150) calendar days upon commencementof service. Any extensionsto the time period(s) specifiedmay be approvedin writing by the ContractOfficer, but such extensionsshall not exceedone hundred and eighty (180) days cumulatively; however, the City shall not be obligated to grant such an extension.

3.3 Force Maieure. The time period(s) specifiedin the Scheduleof Performancefor performanceof the Services renderedunder this Agreementshall be extended because of any delays due to unforeseeablecauses beyond the control and without the fault or negligence of the Contractor ( financial inability excepted) if Contractor, within ten ( 10) days of the commencementof such delay, notifiesthe Contract Officer in writing of the causesof the delay. Unforeseeablecausesinclude, but are not limitedto, acts of God or of the public enemy, unusually severe weather, fires, earthquakes, floods, epidemics, quarantine restrictions, riots, strikes, freight embargoes, wars, and/or acts of any 5 governmentalagency, includingthe City. The City Managershall ascertainthe facts and the extent of delay, and extend the time for performing the Services for the period of the enforced delay when and if, in the judgment of the City Manager, such delay is justified.

The City Manager's determinationshall be final and conclusiveupon the Parties to this Agreement. In no event shall Contractor be entitled to recover damages against the City for any delay in the performanceof this Agreement, howevercaused, Contractor's sole remedy being extension of the Agreement under this section.

3. 4 Term. Unless earlier terminated under this Agreement, this Agreement shall commence upon the effective date of this Agreement and continue in full force and effect until completion of the Services. However, the term shall not exceed five (5) years, from the commencementdate. Any extension as described in Section 3.2 must be through mutual written agreement of the Parties.

3.5 Termination Prior to Expiration of Term. City mayterminatethis Agreementfor its convenienceat any time, without cause, in whole or in part, upon giving Contractor thirty (30) days written notice. Where termination is due to the fault of Contractor and constitutes an immediate danger to health, safety, and general welfare, the period of notice shall be such shortertime as may be determined by the City. Upon such notice, City shall pay Contractorfor Services performedthrough the date of termination. Upon receipt of such notice, Contractor shall immediately cease all work under this Agreement, unless stated otherwise in the notice or by written authorization of the Contract Officer.

After such notice, Contractor shall have no further claims against the City under this Agreement. Upon termination of the Agreement under this section, Contractor shall submit to the City an invoice for work and services performed prior to the date of termination. Contractor may terminate this Agreement, with or without cause, upon sixty 60) dayswritten noticeto the City, exceptthatwhereterminationisdueto materialdefault by the City, the period of notice may be such shorter time as the Contractor may determine.

4. COORDINATION OF WORK

4. 1 Representative of Contractor. The following principal of Contractor is designatedas being the principaland representativeof Contractorauthorizedto act in its behalf and make all decisions with respect to the Services to be performed under this Agreement: D. Scott Hutchinson, Senior Vice President. It is expressly understood that the experience, knowledge, education, capability, expertise, and reputation of the foregoing principal is a substantial inducement for City to enter into this Agreement.

Therefore, the foregoing principalshall be responsibleduringthe term of this Agreement for directingall activitiesof Contractoranddevotingsufficienttime to personallysupervise the services performed hereunder. The foregoing principal may not be changed by Contractorwithout priorwritten approval of the Contract Officer.

4.2 Contract Officer. The Contract Officer shall be .the City Manager or his/her designee (" Contract Officer"). Contractor shall be responsible for keeping the Contract 6 Officerfully informedof the progressof the performanceof the services. Contractorshall refer any decisions that must be made by Cityto the ContractOfficer. Unless otherwise specified, any approval of City shall mean the approval of the Contract Officer.

4. 3 Prohibition Against Assignments. The experience, knowledge, capability, expertise, and reputation of Contractor; its principals and employees, were a substantial inducement for City to enter into this Agreement. Therefore, Contractor shall not assign full or partial performance of this Agreement, nor any monies due, voluntarily or .by operation of law, without the prior written consent of City. Contractor shall not contract with any other entity to perform the Services required under this Agreement without the prior written consent of City. If Contractor is permitted to subcontract any part of this Agreement by City, Contractorshall be responsibleto City for the acts and omissions of its subcontractor( s) in the same manner as it is for persons directly employed. Nothing contained in this Agreement shall create any contractual relationships between any subcontractor and City. All persons engaged in the Work will be considered employees of Contractor. City will deal directly with and will make all payments to Contractor. In addition, neither this Agreement nor any interest in this Agreement may be transferred, assigned, conveyed, hypothecated, or encumbered voluntarily or by operation of law, whether for the benefit of creditors or otherwise, without the priorwritten consent of City.

Transfers restricted in this Agreement shall include the transfer to any person or group of persons acting in concert of. more than twenty five percent( 25%) of the present ownership and/or control of Contractor, taking all transfers into account on a cumulative basis. In the event of any such unapproved transfer, including any bankruptcy proceeding, this Agreement shall be void. No approved transfer shall release Contractor or any surety of Contractorfrom any liability under this Agreementwithout the expresswritten consentof city.

4.4 Independent Contractor. The legal relationship between the Parties is that of an independent contractor, and nothing shall be deemed to make Contractor a City employee.

4.4.1 During the performance of this Agreement, Contractor and its officers, employees, and agents shall act in an independent capacity and shall not act or represent themselvesas Cityofficers or employees. The personnelperformingthe Services under this Agreement on behalf of Contractor shall at all times be under Contractor' s exclusive direction and control. Neither City nor any of its officers, employees, or agents shall have control over the conduct of Contractor or any of its officers, employees, or agents, except as set forth in this Agreement. Contractor, its officers, employees, or agents shall not maintainan office or any other type of fixed businesslocationat City's offices. City shall have no voice in the selection, . discharge, supervision, or control of Contractor' s employees, servants, representatives, or agents, or infixing their number, compensation, or hours of service. Contractorshall pay all wages, salaries, and other amountsdue its employees in connection with this Agreement and shall be responsible for all reports and obligations respecting them, including, but not limited to, social security income tax withholding, unemployment compensation, workers' compensation, and other similar 7 matters. City shall not in any way or for any purpose be deemed to be a partner of Contractor in its business or otherwise a joint venture or a member of any joint enterprise with Contractor.

4.4.2 Contractor shall not have any authority to bind City in any manner. This includesthe powerto incur any debt, obligation, or liabilityagainst City.

4.4.3 No City benefits shall be available to Contractor, its officers, employees, or agentsin connectionwith any performanceunderthisAgreement. Exceptfor Contract fees paid to Contractoras providedfor in this Agreement, City shall not pay salaries, wages, or other compensation to Contractor for the performance of Services under this Agreement. City shall not be liable for compensation or indemnification to Contractor, its officers, employees, or agents, for injury or sickness arising out of performingServices. If for any reasonany court or governmentalagencydetermines that the City has financial obligations, otherthan under Section2 and Subsection 1.8 in this Agreement, of any nature relating to salary, taxes, or benefits of Contractor's officers, employees, servants, representatives, subcontractors, or agents, Contractor shall indemnify City for all such financial obligations.

5. INSURANCE

5.1 Types of Insurance. Contractorshall procureand maintain, at its sole cost and expense, the insurance described below. The insurance shall be for the duration of this Agreement and includes any extensions, unless otherwise specified in this Agreement.

The insuranceshall be procuredin aform andcontentsatisfactoryto City. The insurance shallapplyagainstclaimswhichmayarisefromthe Contractor's performanceof Work under this Agreement, includingContractor's agents, representatives, or employees. In the eventthe City Managerdeterminesthat the Work or Servicesto be performedunder this Agreement creates an increased or decreased risk of loss to the City, the Contractor agrees that the minimum limits of the insurance policies may be changed accordingly upon receipt of written notice from the City Manager or his designee. Contractor shall immediatelysubstituteany insurerwhose A.M. Best rating drops below the levels specified in this Agreement. Except as otherwise authorized below for Contract liability errors and omissions) insurance, all insurance provided under this Agreement shall be on an occurrence basis. The minimum amount of insurance required shall be as follows:

5.1.1.Workers Compensation Insurance. Contractor shall obtain and maintain, in full force and effect throughout the term of this Agreement, workers' compensation insurance in at least the minimum statutory amounts, and in compliance with all other statutoryrequirements, asrequiredbytheStateofCalifornia. Contractoragreestowaive and obtain endorsements from its workers' compensation insurer waiving subrogation rights under its workers' compensation insurance policy against the City and to require each of its subcontractors, if any, to do likewise under their workers' compensation insurancepolicies. If Contractorhasnoemployees, ContractorshallcompletetheCity's Request for Waiver of Workers' Compensation Insurance Requirement form. 8 5. 1. 2 Commercial General Liability Insurance. Contractor shall obtain and maintain, in full force and effect throughout the term of this Agreement, a policy of commercialgeneralliabilityinsurancewrittenona peroccurrencebasiswitha combined single limit of at least one million dollars ($ 1,000, 000. 00) and two million dollars 2,000,000.00) general aggregate for bodily injury and property damage including coveragesfor contractual liability, personal injury, independentcontractors, broad form property damage, products and completed operations.

5.1.3 Business Automobile Insurance. Contractor shall obtain and maintain, in full force and effect throughout the term of this Agreement, a policy of business automobile liability insurance written on a per-occurrence basis with a single limit liability in the amount of one million dollars ($ 1,000,000.00) bodily injury and property damage. The policyshall includecoveragefor owned, non-owned, leased, and hired cars.

5.1.4 Employer Liability Insurance. Contractor shall obtain and maintain, in full force and effect throughout the term of this Agreement, a policy of employer liability insurance written on a per-occurrence basis with a policy limit of at least one million dollars ($ 1,000,000. 00) for bodily injury or disease.

5.2 Deductibles and Self- Insured Retentions. Any deductibles or self-insured retentions must be declared to and approved by the City Manager or his/her designee prior to commencingany work or services under thisAgreement. Contractorguarantees payment of all deductibles and self-insured retentions. City reserves the right to reject deductiblesor self insuredretentionsin excess of ten thousanddollars ($10,000), andthe City Manageror his/herdesigneemay requireevidenceof pendingclaimsandclaims historyas well as evidenceof Contractor's abilityto pay claimsfor all deductibleamounts and self-insured retentionsproposedin excess of ten thousand dollars ($10,000).

5.3 Other Insurance Requirements. The following provisions shall apply to the insurance policies required of Contractor under this Agreement:

5.3.1 For any claimsrelatedto this Agreement, Contractor's coverageshall be primaryinsurancewith respectto the Cityand its officers, councilmembers, officials, employees, agents, and volunteers. Any insurance or self-insurance maintainedby the Cityanditsofficers, councilmembers, officials, employees, agents, andvolunteersshall be in excess of Contractor' s insurance and shall not contribute with it.

5.3.2 Any failure to complywith reportingor other provisionsof the policies, includingbreachesof warranties, shallnot affectcoverageprovidedto Cityand its officers, council members, officials, employees, agents, and volunteers.

5.3.3 All insurance coverage and limits provided by Contractor and available or applicableto this Agreement are intendedto apply to each insured, including additional 9 insureds, against whom a claim is made or suit is brought to the full extent of the policies.

Nothingcontainedin this Agreementor anyotheragreementrelatingto the Cityor its operations shall limit the application of such insurance coverage.

5.3.4 No required insurance coverages may include any limiting endorsement whichsubstantiallyimpairsthecoveragessetforthinthisAgreement (e.g., eliminationof contractual liability or reduction of discovery period), unless the endorsement has first been submitted to the City Manager and approved in writing.

5.3.5 Contractor agrees to require its insurer to modify insurance endorsements to deleteanyexculpatorywordingstatingthatfailureof the insurerto mailwrittennoticeof cancellationimposes no obligation, or that anyparty will "endeavor" (as opposedto being required) to complywith the requirementsof the endorsements. Certificatesof insurance will not be accepted in lieu of required endorsements, and submittal of certificates without required endorsements may delay commencement of the Project. It is Contractor's obligation to ensure timely compliance with all insurance submittal requirements as provided in this Agreement.

5.3.6 Contractor agrees to ensure that subcontractors, and any other parties involved with the Project who are brought onto or involved in the Project by Contractor, provide the same minimum insurance coverage required of Contractor. Contractor agrees to monitor and review all such coverage and assumes all responsibility for ensuringthat such coverageis providedin conformitywith the requirementsof this section. Contractor agrees that upon request, all agreements with subcontractors and others engaged in the Project will be submitted to the City for review.

6.3.7 Contractor acknowledges and agrees that any actual or alleged failure on the part of the City to informContractorof non-compliancewith any insurance requirementin noway imposesanyadditionalobligationson the Citynor doesit waive any rightsin this or any other regard.

5.3.8 Contractor shall provide proof that policies of insurance required in this Agreement, expiringduringthetermofthisAgreement, havebeenrenewedor replaced withotherpoliciesprovidingat leastthesamecoverage. Proofthatsuchcoveragehas been ordered shall be submitted prior to expiration. Endorsementsas required in this Agreementapplicableto the renewingor new coverageshall be providedto City no later than ten (10) days prior to expiration of the lapsing coverage.

5.3.9 Requirementsof specific insurancecoveragefeatures or limits contained in this section are not intended as limitations on coverage, limits, or other requirements, or as awaiver of any coveragenormallyprovidedby any given policy. Specificreferenceto agivencoveragefeatureisforpurposesofclarificationonlyasitpertainstoagivenissue, and is not intendedby any party or insured to be limiting or all-inclusive. 10 5. 3.10 The requirements in this section supersede all other sections and provisions of this Agreementto the extentthat any other sectionor provisionconflictswith or impair the provisions of this section.

5.3.11 Contractoragreesto provide immediatenotice to City of any claim or loss against Contractorarising out of the Work performed under this Agreement and for any other claim or loss which may reducethe insuranceavailableto pay claims arising out of this Agreement. City
assumes no obligation or liability by such notice, but has the right (but not the duty) to monitorthe handlingof anysuchclaimor claimsif they are likelyto involveCity, or to reduce or dilute insurance available for payment of potential claims.

5.3.12 Contractoragreesthat the provisionsof this sectionshall not be construed aslimitinginanywaytheextenttowhichtheContractormaybeheldresponsibleforthe paymentof damagesresultingfromthe Contractor's activitiesor the activitiesof any personor personfor which the Contractoris otherwise responsible.

5.4 Sufficiency of Insurers. Insurance required in this Agreement shall be provided byauthorizedinsurersingoodstandingwiththeStateof California. Coverageshallbe providedbyinsurersadmittedintheStateofCaliforniawithanA.M. Best's KeyRatingof B++, Class VII, or better, unless such requirements are waived in writing by the City Manager or his designee due to unique circumstances.

5.5 Verification of Coverage. Contractor shall furnish City with both certificates of insuranceandendorsements, includingadditionalinsuredendorsements, affectingallof thecoveragesrequiredbythisAgreement. Thecertificatesandendorsementsareto be signedbyapersonauthorizedbythatinsurertobindcoverageonitsbehalf. Allproofof insurance is to be received and approved by the City before work commences. City reservesthe right to require Contractor's insurersto providecomplete, certifiedcopies of all requiredinsurancepoliciesat any time. Additionalinsuredendorsementsare not required for Errors and Omissions and Workers' Compensation policies.

Verification of Insurancecoverage may be provided by: (1) an approved General and/orAutoLiabilityEndorsementFormfortheCityof PalmSpringsor(2) anacceptable Certificateof LiabilityInsuranceCoveragewith an approvedAdditionalInsured Endorsement with the following endorsements stated on the certificate:

TheCityofPalmSprings, itsofficials, employees, andagentsarenamedasanadditional insured..." (" as respects City of Palm Springs Contract No._" or " for any and all work performedwiththeCity"maybeincludedinthisstatement).

Thisinsuranceisprimaryandnon-contributoryoveranyinsuranceorselfinsurancethe City may have..." (" as respects City of Palm Springs Contract No._" or "for any and all workperformedwiththeCity' maybeincludedinthisstatement). tt
Should any of the above described policies be canceled before the expiration date thereof, the issuing company will mail 30 days' written notice to the Certificate Holder named." Language such as, "endeavor to" mail and "but failure to mail such notice shall impose no obligation or liability of any kind upon the company, its agents or representative' is not acceptable and must be crossed out.

Both the Workers' Compensation and Employers' Liability policies shall contain the insurer' s waiver of subrogation in favor of City, its elected officials, officers, employees, agents, and volunteers.

In addition to the endorsements listed above, the City of Palm Springs shall be named the certificate holder on the policies. All certificates of insurance and endorsements are to be received and approved by the City before work commences. All certificates of insurancemust be authorized by a personwith authorityto bind coverage, whether that is the authorized agent/ broker or insurance underwriter. Failure to obtain the required documentspriorto the commencementofwork shallnotwaivethe Contractor's obligation to provide them.

6. INDEMNIFICATION AND REIMBURSEMENT
To the fullest extent permitted by law, Contractorshall defend (at Contractor's sole cost and expense), indemnify, protect, and hold harmless City, its elected officials, officers, employees, agents, and volunteers ( collectively the " Indemnified Parties"), from and againstany and all liabilities, actions; suits, claims, demands, losses, costs, judgments, arbitration awards, settlements, damages, demands, orders, penalties, and expenses includinglegal costs and attorneyfees (collectively "Claims"), including but not limited to Claimsarisingfrominjuriestoor deathofpersons (Contractor's employeesincluded), for damagetoproperty, includingpropertyownedbyCity, fromanyviolationofanyfederal, state, or local law or ordinance, and from errors and omissions committed by Contractor, its officers, employees, representatives, and agents, that arise out of or relate to Contractor's performance under this Agreement. This indemnificationclause excludes Claimsarisingfrom the sole negligenceor willful misconductof the City, its elected officials, officers, employees, agents, and volunteers. Under no circumstances shall the insurance requirements and limits set -forth in this Agreement be construed to limit Contractor' s indemnification obligation or other liability under this Agreement.

Contractor' s indemnification obligation shall survive the expiration or earlier termination of this Agreement until all actions against the Indemnified Parties for such matters indemnified are fully and finally barred by the applicable statute of limitations or, if an actionistimelyfiled, untilsuchactionisfinal. Thisprovisionisintendedforthebenefitof thirdpartyIndemnifiedPartiesnototherwisea partyto thisAgreement. 12 7. REPORTS AND RECORDS

7.1 Accounting Records. Contractor shall keep complete, accurate, and detailed accounts of all time, costs, expenses„ and expenditures pertaining in any way to this Agreement. Contractor shall keep such books and records as shall be necessary to properlyperformtheServicesrequiredbythisAgreementandto enabletheContract Officerto evaluatethe performanceof suchServices. The ContractOfficershall havefull and free access to such books and records at all reasonable times, including the right to inspect, copy, audit, and make recordsandtranscriptsfrom such records.

7.2 Reports. Contractorshall periodicallyprepareand submit to the ContractOfficer suchreportsconcerningthe performanceoftheServicesrequiredbythisAgreement, or as the Contract Officer shall require. Contractor acknowledges that the City is greatly concerned about the cost of the Work and Services to be performed under this Agreement. For this reason, Contractor agrees that Contractor shall promptly notify the Contract Officer the estimated increased or decreased cost if Contractor becomes aware of any facts, circumstances, techniques, or events that may or will materiallyincreaseor decrease the cost of the contemplated Work or Services.

7.3 Daily Reports. Contractor shall prepare a Daily Operating Report and Daily RevenueReport, includingticket reconciliation, for eachtwentyfour (24)-hourperiod beginningwiththetimethedailyinventoryiscompletedorsomeothertimeasdetermined bytheContractAdministrator. Thesereportsshallbeinaformprovidedbyorapproved by the ContractAdministrator. The ContractAdministratormay changeor directthe Contractorto change the format of the reports at any time. A copy of each set of Daily Reports shall remain on-site or accessiblewithin twenty four (24) hours from a storage locationwithin twenty(20) milesof the Airport,for a periodof not lessthan three (3) years.

The DailyRevenueReportshallreflectall financialtransactionsrelatedto the parking operation for the specified period.

Contractorto provide Daily Revenue Reportfor the periodshall include, at a minimum:

A. Beginninginventoryof vehiclesinthe publicareasof ParkingFacility, takenfrom thenightlylicenseplateinventory, withseparatecountsforzonesA, B, C, andD.

B. Number of tickets issued by the ticket dispensers or any other source, based on the serial numbers of each sequence.

C. Numberof entriesrecordedby physicalcounters, if suchcountersareprovidedin the lanes.

D. Number and extended value of tickets processed and collected, including an itemized recordof all transactionsthat includesthe date and time of entry, date and time of exit, durationof stay, amountof fee charged, parkinglocation, and type of transaction. 13,
E. Number of retracted tickets, spoiled tickets, or tickets processed during equipment testing or voided for any other reason.

F. Total number of entry and exit transactions reported by the computerized revenue control system.

G. Number and discounted value of any discount or " no charge" validations.

H. Numberand value (if provided by the computerizedrevenuecontrol system) of any non- revenue transactions.

I. Number and unpaid amount of any Insufficient Funds transactions, under which customers did not have sufficient funds to pay the full parking fee due.

J. Number and amount of credit card charges or any other approved form of payment other than cash and checks.

K. Total amount of revenue reported by the computerized revenue control system.

L. Reconciliation of total ticket values, revenue reported by the computerized revenue control system, credit card charges, and the amount of cash and check deposits.

M. Attachedcopies of depositslip(s) for parking revenues, includingbut not limitedto permit sales and voided bank deposit slips.

N. Attached copies of separate depositslip(s) in the amount of any deposit made by Contractorin paymentof shortagesor depositof overages.

O. Amount and source of any other revenue received by Contractor or City, including paymentsagainst receivables, as substantiatedby copies of depositslips.

P. Combined total Gross Revenue from all sources.

Q. Combined reconciliation to actual deposits.

R. Number of voided tickets including explanations.

S. The total number of tickets accounted for.

T. Ending inventoryof vehicles in the facility.

U. Reconciliationof beginningand ending car counts to the numberof tickets issued and collected during the reporting day.

V. Summarytotalsto assisttheCityinauditingandpostinginformationpertainingto daily revenuecollectionsand other relatedinformation.
14 W. After the Daily Revenue Report has been prepared, verified and signed by the Parking Manager, a copy of the report, along with any tickets, receipts, journal tapes, copies of deposit forms, unused and spoiled tickets, shall be bundled, identified with the date of the report, and placed in a secure location, pendingaudit. The originalcopy of the DailyRevenueReport, includingdepositslips, shallbe placedin a separateenvelopeand prepared and delivered to Contract Administrator or his/her authorized representative( s) by 3 I. on the first business day following such report.

7.4 Monthly Reports. Contractor shall deliver to the Contract Administrator or his/ her authorized representative( s), by the fifth ( 5'h) calendar day of each month, a Monthly Report, in a format approved by the Contract Administrator, which shall summarize financial data by day for the month. The Monthly Report shall include reconciliation with the daily reports submitted previously and, at a minimum include:

A. Daily car counts and license plate inventory totals by area.

B. Tickets issued by day.

C. Tickets collected by day.

D. Tickets not accounted for by day.

E. Tickets not accounted for during the full month.

F. Revenue by day and by category.

G. Total revenue for the month.

H. Reconciliationof variances, if any, betweentotal on monthly reports and totals of items on the daily reports submitted for that month.

7.5 Release of Documents. All reports, records, documents, and other materials preparedby Contractorin the performanceof services underthis Agreement shall not be releasedpubliclywithout the priorwritten approvalof the ContractOfficer. All information gained by Contractor in the performance of this Agreement shall be considered confidential and shall not be released by Contractor without City's prior written authorization.

7. 6 Audit and Inspection of Records. After receipt of reasonable notice and during the regularbusiness hours of City, Contractorshall provideCity, or other agents of City, such-access to Contractor's books, records, payroll documents, and facilities as City deems necessaryto examine, copy, audit, and inspect all accounting books, records, work data, documents, and activities directly related to Contractor' s performance under this Agreement. Contractor shall maintain such books, records, data, and documents in accordancewith generally accepted accounting principles and shall clearly identify and 15 makesuchitemsreadilyaccessibletosuchpartiesduringthetermofthisAgreementand for a period of three (3) years from the date of final payment by City hereunder.

Withinonehundredandtwenty (120) daysafterthecloseof eachContractYear, ContractorshallprovideCityanauditreporton allGrossRevenuesfromoperationsat the Airport. The audit report shall coverthe precedingContract Year. The audit report shall be preparedby an independentCertifiedPublicAccountant, not a regularemployee of Contractor, in accordancewith GenerallyAcceptedAccounting Standards prescribed bytheAmericanInstituteofCertifiedPublicAccountantsoranysuccessoragencythereto as appropriate. The audit report shall include the following:

A. Schedule of all revenues by category and month, and a corresponding schedule of all deposits made to City for these revenues.

B. The audit reportshall includean opinion on the scheduleof all revenues by categoryandbymonthandthescheduleofalldepositsmadeto Cityforthese revenues.

C. The audit reportshall include, but not necessarilybe limitedto, managementfees, compensationpaidby City, and paymentreceivedby Contractorunderany insurance policies.

Delivery of an audit report containing a qualified opinion or an adverse opinion or a disclaimerof opinion, as defined by theAmerican Instituteof CertifiedPublicAccountants or anysuccessoragencythereto, shallbe deemedto be a materialbreachof this agreement. If the audit report indicatesthat the amount of revenuedeposits to City by ContractorduringsuchContactYearwerelessthanthetotalduefortheContractYear, the Contractorshall paythe differenceto City with the audit report.

7.7 Financial Liability. Contractor shall be responsiblefor any and all financial or otherliabilitycausedbyContractorsbreachof ProtectedInformationincluding, butnot limited to, credit card and debit card information. For the purpose of this Section, Protected Information" shall mean all data and information, in written or other tangible form, or in electronic or nontangibleform, whether or not designated as confidential, but treatedasconfidentialbytheCityincluding, withoutlimitation: PC[ data, includingall creditcards, debit card and accountinformationprotectedunder all relatedpaymentcard industrystandards. Suchliabilityshallincludeallcostsassociatedwiththenotificationof affectedparties, creditreportanalysisandmonitoring, anyassociatedattorneyfees, and anyapplicablecallcenterserviceandpublicrelationsexpenses. Contractorshallcomply with all applicable Federal or State privacy or data protection statutes, rules, or regulationsgoverningContractorsactivitiespursuantto thisAgreement; providedthat priortogivingnoticeunderanyapplicablereportingrequirement, Contractorshallfirst notifytheCitywithintwentyfour (24) hoursofContractor'sdiscoveryofdatabreach. In addition, Contractor shall also report to the City within twenty four (24) hours of 16 Contractor's discovery of any breaches of security or unauthorizedaccess to the facility or equipment, whether or not the breach of security or unauthorized access rise to a reportable level under any applicable reporting requirement, and whether or not the breach resulted in the loss of protected information.

7.8 Collection and Handling. Contractor shall charge and collect from all users of the Parking Lot fees and charges established by the City, in accordance with the terms of this Agreement. All fees and charges collected by the Contractor, including over charges and cashier overages, are the property of the City. Contractorshall deposit all collected fees and charges into a bank account designated by the City at a frequency established in accordance with a schedule agreed to in advance. Contractor shall replace, at its own cost, any funds that are lost, stolen, or unaccounted for, including any undercharges, within two ( 2) business days that the funds are discovered missing.

Contractor shall reimburse the City for the full amount of any undercharges to parking customers for which the Contractor is responsible.

8. ENFORCEMENT OF AGREEMENT

8. 1 California Law and Venue. This Agreement shall be construed and interpreted both as to validityand as to performanceof the Partiesin accordancewith the lawsof the State of California. Legalactions concerningany dispute, claim, or matter arising out of or in relation to this Agreement shall be instituted in the Superior Court of the County of Riverside, State of California, or any other appropriate court in such County, and Contractor covenants and agrees to submit to the personal jurisdiction of such court in the event of such action.

8.2 Interpretation. This Agreement shall be construed as a whole according to its fair language and common meaning to achieve the objectives and purposes of the Parties. The terms of this Agreement are contractual and the result of negotiation between the Parties.Accordingly, any ruleof constructionof contracts (including, withoutlimitation, California Civil Code Section 1654) that ambiguities are to be construed against the drafting party, shall not be employedin the interpretationof this Agreement. The caption headings of the various sections and paragraphs of this Agreement are for convenience and identificationpurposesonly and shall not be deemedto limit, expand, or define the contents of the respective sections or paragraphs.

8.3 Default of Contractor. Contractor' s failure to comply with any provision of this Agreement shall constitute a default.

A. If the City Manager, or his/her designee, determinesthat Contractoris in default in the performanceof any of the terms or conditionsof this Agreement, he/she shall notify Contractorinwritingofsuchdefault. Contractorshallhaveten (10) days, orsuchlonger period as City may designate, to cure the default by rendering satisfactory performance.

In the event Contractor fails to cure its default within such period of time, City shall have 17 the right, notwithstanding any other provision of this Agreement, to terminate this Agreement without further notice and without prejudice of any remedy to which City may be entitledat law, in equity, or underthisAgreement. Contractorshallbe liablefor all reasonable costs incurred by City as a result of such default. Compliance with the provisionsofthissectionshallnotconstituteawaiverof anyCityrighttotakelegalaction in the event that the dispute is not cured, providedthat nothingshall limit City's right to terminate this Agreement without cause under Section 3.5.

B. If termination is due to the failure of the Contractor to fulfill its obligations under this Agreement, City may, after compliancewith the provisionsof Section 8.3A, take over the workand prosecutethe sameto completionby contractor otherwise. The Contractor shall be liable to the extent that the total cost for completion of the Services required hereunder exceeds the Maximum Contract Amount ( provided that the City shall use reasonableefforts to mitigatesuch damages). The City may withhold any paymentsto the Contractorfor the purposeof set-off or partial paymentof the amounts owed the City aspreviouslystated. Thewithholdingorfailuretowithholdpaymentsto Contractorshall notlimitContractorsliabilityfor completionoftheServicesasprovidedinthisAgreement.

8.4 Waiver. Nowaiver of any provisionof this Agreementshall be effective unlessin writing and signed by a duly authorized representative of the Party against whom enforcementofawaiveris sought. AnywaiverbythePartiesof anydefaultorbreachof anycovenant, condition, ortermcontainedinthisAgreement, shallnotbeconstruedto be a waiver of any subsequentor other default or breach, nor shall failure by the Parties to require exact, full, and complete compliance with any of the covenants, conditions, or terms contained in this Agreement be construed as changing the terms of this Agreement in any manner or preventingthe Partiesfrom enforcingthe full provisions.

8.5 Rights and Remedies Cumulative. Except with respect to rights and remedies expresslydeclaredto beexclusivein thisAgreement, the rightsandremediesof the Partiesare cumulativeand the exercise by either Party of one or more of such rights or remediesshallnotprecludetheexercisebyit, atthesameordifferenttimes, ofanyother rightsor remediesfor the same default or any other default by the other Party.

8.6 Legal Action. In additionto any other rights or remedies, either Party may take legal action, in law or in equity, to cure, correct, remedy or recover damages for any default, to compel specific performance of this Agreement, to obtain declaratory or injunctive relief, or to obtain any other remedy consistent with the purposes of this Agreement.

8.7 Attorney Fees. Inthe event any disputebetweenthe Partieswith respect to this Agreement results in litigation or any non-judicial proceeding, the prevailing Party shall be entitled, in addition to such other relief as may be granted, to recover from the non- prevailingPartyallreasonablecostsandexpenses. Theseincludebutarenotlimitedto reasonableattorneyfees, expertContractorfees, courtcostsand all fees, costs, and 18 expenses incurred in any appeal or in collection of any judgment entered in such proceeding. To the extent authorizedby law, in the eventof a dismissal by the plaintiffor petitioner of the litigationor nonjudicialproceedingwithin thirty (30) days of the date set for trial or hearing, the other Party shall be deemed to be the prevailing Party in such litigation or proceeding.

9. CITY OFFICERS AND EMPLOYEES: NON- DISCRIMINATION

9. 1 Non- liability of City Officers and Employees. No officer or employee of the City shall be personally liableto the Contractor, or any successor-in-interest, in the event of any default or breach by the City or for any amount which may become due to the Contractor or to its successor, or for breach of any obligation of the terms of this Agreement.

9.2 Conflict of Interest. No officer or employee of the City shall have any direct or indirect financial interest in this Agreement nor shall any such officer or employee participatein any decision relatingto the Agreementwhich affects their financial interest or the financial interest of any corporation, partnership, or associationin which he/she is, directly or indirectly, interestedin violation of any state statute or regulation. Contractor warrants that Contractor has not paid or given, and will not pay or give, any third party any money or other considerationin exchangefor obtainingthis Agreement.

9.3 Covenant Against Discrimination. In connection with its performance under this Agreement, Consultant shall not discriminate against any employee or applicant for employment because of actual or perceived race, religion, color, sex, age, marital status, ancestry, national origin (i.e., place of origin, immigration status, cultural or linguistic characteristics, or ethnicity), sexual orientation, gender identity, gender expression, physical or mental disability, or medical condition ( each a " prohibited basis"). Consultant shall ensure that applicants are employed, and that employees are treated during their employment, without regard to any prohibitedbasis. As a condition precedent to City's lawful capacity to enter this Agreement, and in executing this Agreement, Consultant certifies that its actions and omissions hereunder shall not incorporate any discrimination arising from or relatedto any prohibitedbasis in any Consultantactivity, includingbut not limited to the following: employment, upgrading, demotion or transfer; recruitment or recruitmentadvertising; layoffor termination; ratesof pay or otherforms of compensation; and selectionfor training, includingapprenticeship; and further, that Consultant is in full compliance with the provisions of Palm Springs Municipal Code Section 7.09.040, includingwithout limitationthe provisionof benefits, relatingto non-discriminationin city contracting.

10. MISCELLANEOUS PROVISIONS

10. 1 Patent and Copyright Infringement. To the fullest extent permissible under law, and in lieu of any other warranty by City or Contractor against patent or copyright infringement, statutory or otherwise:
19 A. It is agreed that Contractor shall defend at its expense any claim or suit against City on account of any allegation that any item furnished under this Agreement, or the normal use or sale arising out of the performanceof this Agreement, infringes upon any presently existing U.S. letters patent or copyright and Contractorshall pay all costs and damages finally awarded in any such suit or claim, providedthat Contractoris promptly notified in writing of the suit or claim and given authority, information and assistance at Contractor' s expense for the defense of same, and provided such suit or claim arises out of, pertains to, or is related to the negligence, recklessness or willful misconduct of Contractor. However, Contractorwill not indemnify City if the suit or claim results from:
1) City's alterationof a deliverable, such that City's alterationof such deliverablecreated the infringementupon any presently existing U.S. letters patent or copyright; or (2) the use of a deliverable in combination with other material not provided by Contractor when it is such use in combination which infringes upon an existing U.S. letters patent or copyright.

B. Contractor shall have sole control of the defense of any such claim or suit and all negotiationsfor settlement in the event City fails to cooperate in the defense of any suit or claim, provided, however, that such defense shall be at Contractor' s expense.

Contractor shall not be obligated to indemnify City under any settlement that is made without Contractor' s consent, which shall not be unreasonably withheld. If the use or sale of such item is enjoined as a result of the suit or claim, Contractor, at no expense to City, shallobtainforCitytherightto useandselltheitem, orshallsubstituteanequivalentitem acceptable to City and extend this patent and copyright indemnity thereto.

10.2 Notice. Any notice, demand, request, consent, approval, or communicationthat eitherpartydesires, oris requiredto giveto theotherpartyor anyotherpersonshallbe in writing. All noticesshall be personallydelivered, sent by pre-paid FirstClass U.S. Mail, registeredor certifiedmail, postageprepaid, returnreceiptrequested, or deliveredor sent by facsimilewith attachedevidenceof completedtransmission. All noticesshall be deemed received upon the earlier of ( i) the date of delivery to the address of the person to receive such notice if delivered personally or by messenger or overnight courier; (ii) five (5) businessdays after the date of postingby the UnitedStates Post Office if by mail; or (iii) when sent if given by facsimile. Any notice, request, demand, direction, or other communicationsent by facsimile must be confirmedwithin forty eight (48) hours by letter mailed or delivered. Other forms of electronic transmission such as e- mails, text messages, and instant messages are not acceptable manners of notice required hereunder. Notices or other communications shall be addressed as follows:

To City: City of Palm Springs
Attention: City Manager
3200 E. Tahquitz Canyon Way
Palm Springs, California 92262
Telephone: ( 760) 323- 8204
20 Palm Springs International
Airport
3400 E. Tahquitz Canyon Way
Palm Springs, California 92262
Telephone: ( 760) 318- 3808
To ABM Aviation, Inc.

Contractor:
4151 Ashford Dunwood Rd.

Suite 600
Atlanta, Georgia 30319
Attention: D. Scott Hutchinson
Senior Vice President
Telephone: ( 404) 926- 4200

10. 3 Integrated Agreement. This Agreement constitutes the entire agreement between the Parties and supersedes all prior negotiations, arrangements, agreements, representations, and understandings, if any, made by or among the Parties with respect to the subject matter in this Agreement.

10. 4 Amendment. No amendments or other modifications of this Agreement shall be binding unless through written agreement by all Parties.

10.5 Severability. Whenever possible, each provision of this Agreement shall be interpreted in such a manner as to be effective and valid under applicable law. If any provisionof this Agreementshallbe determinedto be invalidby a finaljudgment or decree of a court of competentjurisdiction, such provisionshall be ineffectiveonly to the extent of such prohibition or invalidity, without invalidating the reminder of that provision, or the remainingprovisionsof this Agreement unlessthe invalid provisionis so materialthat its invalidity deprives either Party of the basic benefit of their bargain or renders this Agreement meaningless.

10.6 Successors in Interest. This Agreement shall be binding upon and inure to the benefit of the Parties' successors and assignees.

10. 7 Third Party Beneficiary. Except as may be expressly provided for in this Agreement, nothing contained in this Agreement is intended to confer, nor shall this Agreement be construed as conferring, any rights, including, without limitation, any rights as a third-party beneficiary or otherwise, upon any entity or person not a party to this Agreement.
21 10. 8 Recitals. The above- referenced Recitals are hereby incorporated into the Agreementas though fully set forth in this Agreementand each Partyacknowledgesand agreesthat such Partyis bound, for purposesof this Agreement, by the same.

10.9 Corporate Authority. Each of the undersigned represents and warrants that ( i) thePartyforwhichheorsheisexecutingthisAgreementisdulyauthorizedandexisting, ii) he or she is duly authorizedto execute and deliver this Agreement on behalf of the Partyforwhichheor sheissigning, (iii) bysoexecutingthisAgreement, thePartyfor whichheorsheis signingisformallyboundtotheprovisionsof thisAgreement, and (iv) the entering into this Agreement does not violate any provisionof any other Agreement to which the Partyfor which he or she is signingis bound.

SIGNATURE PAGE FOLLOWS)
22 IN WITNESS WHEREOF, the Parties have executed this Agreement effective as of the date first written above.

CITY"
City of Palm Springs
By:

David H. Ready,
City Manager
APPROVED AS TO FORM: ATTEST
By = / T iti By:

J ffre S. Balling r A ony Mejia
City Attorney City Clerk
A PROVEDBy CrFYCOLJNCIL
L2Zz7 15 P
CONTRACTOR"
ABM Aviation, Inc., a Georgia corporation
Corporations require two notarized signatures: One from each of the following:

A. Chairmanof Board, President, or any Vice President: AND B. Secretary,AssistantSecretary, Treasurer,AssistantTreasurer, or ChiefFinancialOfficer. g By:

Signature ( notarized) Signature,/ ( notarized)
Name: T iflifr` c/ Name: V,, A J?, c
Title:
23 CALWORRIA ALL- PURPOSE ACKNOWLEDGMENT CML CODE§ 11gg A rotary pubfe or aduw dFis t7 thb corffcao wfta only dw idwmq of dw i6idd wtc c4W dw docvnw towlnd die eeriY. tt. o otcrlw0. andnmdw md* kw== ovary. arvaidty cf Ma domnot State of Caffamic
County of
On before mo.

Date Here IrmortName and Tide of the Officer
pm- n3W appeared
Nww( rJo7So moo)
who proved to me on the b= of nafefoetory evidence to be the Ira^- an(a who^-e tea) Lvore arWcm'bed to the witlir icburn d anudacimowtedgedto rue that hdahwMy exocutedthe came n hm4wAhwau tf= wd capaoly( we). and that byh= lh wAh&ff=QnDftrra(a)cn the uctrurterd Re poraon(a). or the entity upon behalf of which tho por= 4.) acted• executed the inmbru t I c&-* under PENALTY OF PERJURY wider gm bvra
of the Stale of Cofdomin Mal the foregoing paragaph
is bre and correct
WRNESS my land orvdofficial coal.

Sigahes
SV alma of Afo& T Pubfic
Place Notary Seal Above

OPTIONAL
Though Mb coctiar is cpffmxd corrrplaWV Mc ivbonrabon can defer aRavnticn of the downed or haudvlbrd veatfochrrerd of tfia farm to an urirvfwxWf doaenent Deaaiplim of Attoated Doetprent
Tilfe or Type of Document Document Date:

Numbor of Pagea: Signw( c) Other Than Named Abovo:

Copaeity( ies) Clairned by Signer( a)
Sigwo Name: Sigriwo Name:

Corporate Officer— Tdk*): O Corporate Offioa— Tdle( a):
p Parbnw— Limited Gwmd O Parbwr— O UffftDd O General
Indvxw Attomey in Fact brdvidni Attorney in Fact Trucdne O Guardian or Color oTnctee Guardian or Cormarvator Oren: Other.

Signer13 Roprooenbng: Signer b Roptacardig:

O2gl4 N3bur' d emtayA= mo n;.,• wwwNNMaaMtwy. ag• 1-80D- ts NOTARY(1-SM-67e4ea27) team/ S W 24 PARKING MANAGEMENT CONTRACT AT PALM SPRINGS INTERNATIONAL AIRPORT

EXH IBIT A
EXHIBIT " A"

SCOPE OF SERVICES
General Overview
Contractor must provide all personnel, personnel bonds, personnel uniforms, materials, equipment, radios, vehicles, supervision and other items necessary to:

1. Operate and manage Airport public parking lots.

2. Collect all parking lot fees and charges (including the secure processing of credit card and debit card charges) legally due, and provide bookkeeping, accounting, and audit services with respect thereto. Daily deposit of funds, with all necessary supporting documentation made directly to the City Finance Department.

3. Contractor shall operate, service, maintain, and repair all parkinglot equipmentincluding parking lot revenue control and accessequipmentas part of the managementfee.

4. Report and arrange for improperlyparked or abandonedvehiclesto be removedfrom the parking lots.

5. Perform nightly license plate inventory of all vehicles parked in parking lots. This information must be logged into a database that is accessible to Airport management.

6. Provide and/ or arrange for basic vehicle emergency services ( i.e. jump- starts, keys locked in vehicles, and towing).

7. Keep parking lots safe and secure, in a clean, litter-free condition. Report all concerns.

8. Provide a designated number of traffic enforcement officers ( TEO, see Attachment" H" of the RFP and incorporatedherein in Exhibit "F") performingin an orderly, diplomatic, and courteous manner. Ensure the safe movement of vehicular and pedestrian traffic on the Airport roadways in front of the terminal and in the parking lots, and other areas as may be required.

9. Provide a designated number of taxi control officers to ensure the safe and efficient movement of commercial vehicles and taxi queuing ( see Attachment " H" of the RFP and incorporated herein in Exhibit" F").

10. Assure adherence to airport parking and grounds transportation procedures/ regulations.

Observe and report any discrepancies.

11. Provide various daily and monthly reports, accounting records, and other statistical data requested by the City.

12. Perform Airport shuttle bus operations to and from the overflow parking lot or designated location on the airport propertyduring all periodsthat capacityin the parking lot exceeds ninety percent ( 90%), as part of the base management services.

13. Provide shuttle bus dispatching serviceswhen the overflowlot is operational. 69 t
0 14. Ensurethat personnelutilizedfor each componentof the Agreementreceive the appropriatelevel of training prior to assignmentso that they may exercisetheir duties in an exemplarymanner. ,Maintaincurrentpersonnelmanual.

15. Implementa proposed Parking Facility Revenue Control System Investmentconsistent with each component of the Agreement asprovided ( Exhibit " E"). All equipment must be compliantwith paymentcard industry (PCI) standards. All parkingequipmentwill be a fully integrated system.

Facility Description, Reporting Requirements and Equipment The automobileparkingfacilitiesto be managedand operatedby Contractorconsist of the following, includingsix (6) entrylanes, eachwitha ticketdispenser, andone (1) toll plazawith two (2) exit booths, one (1) express exit lane with one (1) additional express exit on booth #1, andone (1) pay-on-footstationlocatedwithintheTerminal. It will be necessaryto add revenue control equipmentat the overflow parking entry prior to October 1, 2016. All equipment to be compliantwith paymentcard industry (PCI) standards. These locationsshallbe referredto collectively as the" Airport Parking Facilities":

A. Public Parking Lot.

Thepublicparkinglot is locatedgenerallywestoftheTerminal, asshownonExhibit"D," attached hereto and .incorporated by reference herein. At the time of execution of this Agreement, said lot has parking capacity for approximately nine hundredand thirty six 936) vehicles in the parking area.

B. Public Overflow Parking Lot.

The overflowparkinglot is locatedgenerallysouthof the Terminal, on Kirk Douglas Drive, as shown on Exhibit " D" of the RFP. At the time of execution of this Agreement, this lot hasthe capacity for approximatelyone thousand (1,000) vehicles.

C. ADA Parking.

Thereare currentlythirty one (31) ADA parkingspots locatedwithinthe publicparking lot. The spots are located nearest the passenger terminal.

D. Employee Parking Lot.

TheEmployeeParkingLot is managedand permittedby airportstaff. TheContractors employeeswill be issued permitsto park their personalvehicles in this lotwhile on duty, currentlythereis no chargefor thefirstpermitto the employee. Lostpermitsaresubject to replacementcost charges. No personalvehicles of the Contractor are to park in the publicparking lots while on duty.

E. Future Parking Facilities.

Cityshallhavethe right, at any timeduringthe term of this Agreement, includingany extensions thereto, to improve, expand, replace, or modify any or all of the Airport Parking Facilities, and/or any equipment or appurtenances thereto. City reserves the 70 o i
right to constructadditionalparking facilitiesto serve the Terminal. Uponthirty (30) days written notificationby the City to the Contractor, any such modified, expanded, or additionalparking facilities shall be includedwithinthe Airport Parking Facilitiesand shall be subject to this Agreement.

F. Management.

Providehighly qualified on-site manager. The contractorwill provide an Assistant Managerduringthe absenceor unavailabilityof the ParkingManager, to representand actfor ParkingManagerwith likeauthority. The Manageror AssistantManagerwill be available seven ( 7) days a week. The Parking Manager shall not be concurrently assignedor employedin any capacitywiththe managementor operationof any other automobileparkingfacilityor enterprisewhatsoeverduringthe tenureof such Parking Manager at the Airport.

G. Traffic Enforcement Officer ( TEO).

TEO' s are responsible for compliance with Federal regulations, regarding vehicle and traffic standards. They providecustomer serviceby answeringpassengerquestions and summoningskycaps. Theyreportunattendedluggageandvehicles, issuecitationsand monitor for unauthorized commercial ground vehicle operators.

H. Taxi Starter.

Taxi Startersprovidepassengerassistancewith formingan orderlyqueueline before beingdirectedto the next availableride and insureadequatecabs are availablefor customerdemand. Verifycompliancewith PublicUtilityCommission (PUC) and other local regulations. These include, but are not limited to, dress codes, waybills, Transportation Commercial Permit ( TCP) numbers displayed properly, commercial vehiclelicenseplatechecks, andPSPissuedtransponders. TheTaxiStarteris to check vehicle credentials and monitor for compliance.

I. Parking Attendants.

Contractor shall be responsible for hiring, training and supervising an adequate number of supervisoryandoperatingpersonnelwithappropriateskillsto ensurefullperformance of Contractor' s management and operation services.
71 A
0 J. Shuttle Service.

Shuttleservicefor holidayparking (Thanksgiving, Christmas, andNewYear) should be considered as part of the base managementfee, at such time as the public parking lot exceeds ninety percent ( 90%) capacity. Holiday shuttle service provides passenger pick- ups every ten ( 10) — fifteen ( 15) minutes. ( For the 2014 holiday season, the Contractorprovidedservicefor a combinedtwentythree (23) days, as part of the management fee.) Additional shuttle services, as may be required from time to time, shouldbe providedas a separatehourlychargeandwouldbe approvedin additionto services provided in the base management fee. The managementfee will consider a maximum of twenty five (25) days of shuttle service annually, up to, but not to exceed twenty ( 20) hours per day.

Additional,shuttlehourlyservicechargeto beapprovedseparately (Exhibit "I"').

K. Hours of Operation.

Contractorshall keepthe AirportParkingFacilitiesopenfor use by the .public and by authorized employees a minimum of ninety (90) minutes prior to the first commercial aircraft departure and a minimum of one ( 1) hour after the last commercial aircraft arrival, to include delayed flights. In the event of irregular operations, the airport control centerwill notifythe parkingattendantwith the requiredscheduleto operatethe exit booth. This will includeseven (7) days a week, includingall weekends and holidays.

L. Supervision of Vehicular Movement and Parking:

Contractor shall maintain adequate supervision and control over vehicular entrances, exits and movement lanes so as to maintain at all times the safe, orderly, efficient and timely flow of traffic throughthe Airport ParkingFacilities.

2. The scope of this section particularly refers to the requirement for Contractor to staff and operate an adequate number of additional exit lanes to accommodate varying volumes of exit traffic, without unreasonable delays. Unreasonable delays are considered to be any delay in excess of six (6) minutes.

2. Contractor shall maintain on file with , Contract Administrator a current written schedule showingthe daily hours of operationof each exit lane. Contract Administrator may require an expansion or reduction to the schedule as appropriate to accommodate exiting vehicle volumes and patterns.

M. Daily Inspection of Facilities.

Throughout the term of this Agreement, Contractor shall, on a daily basis, conduct a thorough and detailedinspection of Airport Parking Facilities, to determineif any unclean or potentiallyhazardousconditionto the publicexists. The resultsof eachsuch inspectionshallberecordedinwritingupona reportformandsubmittedduringthe same business day.
72 1
0 O
N. Capital Investment.

Contractor shall be responsible for all capital investment to upgrade the existing revenue control equipment and add all equipment necessary to accommodate a fully functional system that will be ninety nine percent ( 99%) reliable, accurate and operational during all weather conditions ( e.g., rain, wind, dust, heat, etc.) throughout the term of this agreement. The revenue control equipment upgrades shall be completed no later than July 1, 2016.

The Contractor' s capital investment shall also include any vehicles and equipment that will be necessary to perform the day-to-day functions for the services required.

O. Equipment Maintenance.

Contractor shall have responsibility for maintaining and operating all parking equipment and vehicles necessary to meet the project scope requirements. Contractor shall be responsible for all revenue control equipment maintenance and repair upon the date of contract commencement. Contractor shall neither have nor allow access to parking lot transaction counting devices associated with exit gates, except in the presence of the City authorized representative. Additionally, Contractors personnel shall witness all access to such parking lot transaction counting devices.

Contractor shall notify City when maintenance is needed on any City-owned equipment.

Contractor shall provide City with access to such devices, upon request. Contractor shall give the Contract Administrator immediate oral notice of any malfunction or breakdown of any parking lot equipment supplying audit data or affecting parking lot ingress or egress, and shall give the Contract Administrator notice of the date and time such malfunction or breakdown is corrected and repaired. Contractor shall transmit written confirmation on all such information to the Contract Administrator, within twenty- four( 24) hours.

P. Tickets.

Contractor shall provide all tickets necessary for use in the Parking Lots that are subject to this agreement and shall issue, collect and retain such tickets in accordance with terms of this Agreement. Such tickets shall be sequentially pre- numbered, accurately dated, and accurately time- stamped as to the time each vehicle enters and exits such parking lot. Tickets issued for use shall be collected at the time of vehicle exiting the public parking lots.

On- site Manager: Contractor shall provide an On-site Manager for day-to-day operations and who will also act as the local point of contact. Manager will provide reports as needed, respond to complaints, training needs, will track working hours, and supervise the contract personnel.

Any disciplinary action will be the responsibility of On-site Manager and Contractor. The On-site Manager shall meet with the Contract Administrator or designee weekly to discuss any complaints or violations of the Performance Standards that may be reported by the public or observed by the City.
73 6 j
0 0
Complaints to the City regarding contract employees: Contractor' s assigned On- site Manager shall investigate and report any complaints regarding their employeesreceived from thepublicor the Citywithintwentyfour (24) hoursof the report. TheCityshallreservethe right to contactthe reporting party and Contractoremployee as neededto resolve the complaint to the City's satisfaction, withthe understandingthat unprofessionalor discourteoustreatmentof the public will not be tolerated.

City's Rights: Cityreservesthe rightto establish, modify, addordeletehoursofmanagement.

Cityfurtherreservesthe rightto approveor denyContractor's personnel. The Cityretainsthe right to review and direct modificationof any Contract employee training program. The City's rights under this provisionmay be exercisedby the City Manageror the City Manager's designee.

PARKING OPERATIONS EQUIPMENT, SERVICES AND SUPPLIES TO BE PROVIDED BY CONTRACTOR:

Contractor Employee Uniforms:

All personnelshall wear uniformswhile on duty.

Contractor shall be responsiblefor providing personnelwith proper, complete, and acceptable uniforms.

Uniform shall include a name badge or tag. Uniforms and identifying badges shall be distinct enough from those used by Peace Officers or other sworn personnel so that the general public will not mistaketraffic enforcementpersonnel (TEO) for Peace Officers.

Contractorshall not issue any.uniformor identifying badge without the prior written approval by the City..

Contractemployees will not be allowedto work unless attired in completeapproveduniform.

Contractorshall provideuniformsfor eachcontractemployeeat no expenseto the employee, except in cases of negligence or abuse of the uniform by the contract employee. 74 PARKING MANAGEMENT CONTRACTAT PALM SPRINGSINTERNATIONALAIRPORT

EXHIBIT B
I

CITY OF PALM SPRINGS, CA
NOTICE INVITING PROPOSALS FOR RFP # 06- 20

PARKING MANAGEMENT SERVICES AT PALM SPRINGS INTERNATIONAL AIRPORT NOTICE IS HEREBY GIVEN that the City of Palm Springs is requesting proposals from highly motivated and qualified firms to provide the City with parking management services at the Palm Springs International Airport under a multi-year contract.

PROJECT LOCATION: Palm Springs International Airport public parking lots, City of Palm Springs, California.

SCOPE OF SERVICES: The scope of work will generally consist of operating and managing the Airport public parking lots, provide traffic enforcement officers ( TEOs) to ensure the safe movement of vehicular traffic on the Airport drive, and provide an appropriate number of taxi control officers to ensure the safe and. efficient movement of commercial vehicles and taxi queuing. The scope of services is more fully defined within the RFP document.

PRE-PROPOSAL CONFERENCE AND SITE VISIT: Al interested proposers are encouraged to attend a Pre-Proposal Conference and visit the site to become familiar with the site conditions. The NON-MANDATORY Pre Proposal Conference will be held promptly at 10:00 A.M., LOCAL TIME, ON MONDAY, NOVEMBER 18, 2019 at the Palm Springs International Airport, 3400 E. Tahquitz Canyon Way, Palm Springs, California, in the 2ndFloor Conference Room. A tour of the site will occurfor interestedproposers, immediatelyfollowingthe conclusionof the Pre-ProposalConference.

Failure of a Proposer to attend the Pre-Proposal conference shall constitute acceptance of all pre- existing conditions and shall constitute a waiver of any and all future claims relating to said conditions.

OBTAINING RFP DOCUMENTS AND ADDENDA: The RFP document may be downloaded via the internet at https:// www. loalmspringsca. gov/ government/ departments/ procurement- contracting/ bids- proposals ( Procurement, Open Bids & Proposals) or by calling the Office of Procurement and Contracting, ( 760) 322- 8368. Upon, downloading the RFP via the internet, contact Craig Gladders, Procurement and Contracting Manager via email at craig.gladders( o paimsprinasca. gov to be placed on the interested vendor list for this project, providing your company name, contact person, contact email address, office address, office phone and office fax. Failure to be placed on the interested vendor list as stated above may result in not receiving Addenda to the RFP. Failing to acknowledge Addenda may result in your proposal being non- responsive, or may negatively impact the evaluation of your proposal. We strongly advise that you follow the instructions above if you are interested in submitting a proposal.

EVALUATION OF PROPOSALS AND AWARD OF CONTRACT: This solicitation has been developed in the Request for Proposals ( RFP) format. Accordingly, firms should take note that multiple factors as identified in the RFP will be considered by the Evaluation Committee to determine which proposal best meets the requirements set forth in the RFP document. PRICE ALONE WILL NOT BE THE SOLE DETERMINING CRITERIA. The City reserves the right to negotiate the terms and conditions of any resulting contract. Final contract award, if any, will be made by the Palm Springs City Council. The selected firm will be required to comply with all insurance and license requirements of the City.

DEADLINE: All proposals must be received in the Procurementand ContractingOff ice, 3200 E. Tahquitz Canyon Way, Palm Springs, CA, 92262 by 3:00 P.M., LOCAL TIME, TUESDAY, DECEMBER 10,2019. The receivingtime in the ProcurementOfficewill be the governing time for acceptability of Proposals. Telegraphic and telephonic Proposals will not be accepted.

Reference the RFP document for additional dates and deadlines. Late proposals will not be accepted and shall be returned unopened.

PROPOSALS TO REMAIN OPEN: The Proposer shall guarantee that all contents of their proposalshall be valid for a period of 120 calendardaysfrom the due date of proposals.

Craig L. Gladders, C.P.M.

Procurementand ContractingManager
November 7, 2019
2 0

CITY OF PALM SPRINGS, CA
NOTICE INVITING PROPOSALS FOR RFP # 06- 20

PARKING MANAGEMENT SERVICES AT PALM SPRINGS INTERNATIONAL AIRPORT NOTICE IS HEREBY GIVEN that the City of Palm Springs is requestingproposalsfrom highly motivated and qualifiedfirms to providethe City with parking managementservicesat the Palm Springs International Airport under a multi-year contract.

PROJECT LOCATION: Palm Springs International Airport public parking lots, City of Palm Springs, California.

SCOPE OF SERVICES: The scope of work will generally consist of operating and managing the Airport public parking lots, provide traffic enforcement officers ( TEOs) to ensure the safe movement of vehicular traffic on the Airport drive, and provide an appropriate number of taxi control officers to ensure the safe and efficient movement of commercial vehicles and taxi queuing. The scope of servicesis more fully definedwithin the RFP document.

PRE-PROPOSAL CONFERENCE AND SITE VISIT: All interested proposers are encouraged to attend a Pre-Proposal Conference and visit the site to become familiar with the site conditions. The NON-MANDATORYPre ProposalConferencewill be held promptlyat 10:00 A.M., LOCAL TIME, ON MONDAY, NOVEMBER 18, 2019 at the Palm Springs International Airport, 3400 E. Tahquitz Canyon Way, Palm Springs, California, in the 2ntlFloor Conference Room. A tour of the site will occur for interested proposers, immediately following the conclusion of the Pre-Proposal Conference.

Failureof a Proposerto attendthe Pre-Proposalconferenceshall constituteacceptanceof all pre- existing conditions and shall constitute a waiver of any and all future claims relating to said conditions.

OBTAINING RFP DOCUMENTSAND ADDENDA: The RFP document may be downloaded via the intemet at https:// www. palmsr) ringsca. goy/ government/ departments/ procurement- contracting/ bids- proposals ( Procurement, Open Bids & Proposals) or by calling the Office of Procurement and Contracting, ( 760) 322- 8368. Upon downloading the RFP via the intemet, contact Craig Gladders, Procurement and Contracting Manager via email at craig.gladdersapalmspringsca. goy to be placed on the interested vendor list for this project, providing your company name, contact person, contact email address, office address, office phone and office fax. Failure to be placed on the interestedvendor list as stated above may result in not receiving Addenda to the RFP. Failing to acknowledge Addenda may result in your proposal being non-responsive, or may negatively impact the evaluation of your, proposal. We strongly advise that you follow the instructions above if you are interested in submitting a proposal.

EVALUATION OF PROPOSALS AND AWARD OF CONTRACT: This solicitation has been developed in the Request for Proposals.( RFP) format. Accordingly, firms should take note that multiple factors as identified in the RFP will be considered by the Evaluation Committee to determine which proposal best meets the requirements set forth in the RFP document. ' PRICE ALONE WILL NOT BE THE SOLE DETERMINING CRITERIA. The City reserves the right to negotiate the terms and conditions of any resulting contract. Final contract award, if any, will be made by the Palm Springs City Council. The selected firm will be required to comply with all insurance and license requirements of the City.
t
at:.

DEADLINE: All proposals must be received in the Procurementand ContractingOffice, 3200 E. Tahquitz Canyon Way, Palm Springs, CA, 92262 by 3:00 P.M., LOCAL TIME,'TU ESDAY, DECEMBER 10, 2019. The receiving time in the Procurement Office will be the governing time for acceptability of Proposals. Telegraphic and telephonic Proposals will not be accepted.

Reference the RFP document for additional dates and deadlines. Late proposals will not be accepted and shall be returned unopened.

PROPOSALS TO REMAIN OPEN: The Proposer shall guarantee that all contents of their proposalshall bevalid for a periodof 120calendardays from the due date of proposals_ Craig L. Gladders, C.P.M.

Procurement and Contracting Manager
November 7, 2019
2 0

CITY OF PALM SPRINGS, CA
REQUEST FOR PROPOSALS ( RFP)# 06- 20

PARKING MANAGEMENT SERVICES AT PALM SPRINGS INTERNATIONAL AIRPORT Requests for Proposals ( RFP #06-20), for Parking Management Services at Palm Springs International Airport for the City of Palm Springs, CA, (hereinafter the 'RFP") will be received at the Office of Procurement & Contracting, 3200 East Tahquitz Canyon Way, Palm Springs, California, until 3: 00 P. M. LOCAL TIME, TUESDAY, DECEMBER 10, 2019. It is the responsibility of the respondent to see that any proposal sent through the mail, or by any other delivery method, shall have sufficient time to be received by this specified date and time. The receiving time in the Procurement Office will be the governing time for acceptability of proposals. Telegraphic, telephonic, faxed or emailed proposals will not be accepted. Late proposals will be returned unopened. Failure to register as a Proposer to this RFP process per the instructions in the Notice Inviting Requests for Proposals ( under " Obtaining RFP Documents") may result in not receiving Addenda or other important information pertaining to this process. Failure to acknowledge Addenda may render a proposal as being non-responsive or negatively impact the evaluation of a proposal. We strongly advise that interested firms officially register per the instructions in the Notice.

1. PURPOSE AND SCHEDULE: The City of Palm Springs is requesting proposals from qualified firms to provide the City with operating and managing the Palm Springs International Airport public parking lots, as more fully set-forth in the Scope of Services contained herein.

SCHEDULE:

Notice requesting Proposals posted and issued ............................................. November 7, 2019 Pre- Proposal Conference ......................................... Monday, November 18, 2010, 10:00 A.M.

Deadline for receipt of Questions................................ Tuesday, December 3, 2019, 3:00 P.M.

Deadline for receipt of Proposals...................... TUESDAY, DECEMBER, 10, 2019, 3: 00 P. M.

Short List/ Interviews/, * if desired by City .......................:................................. to be determined Contract awarded by City Council..................................:.................................. to be determined NOTE: * Dates above are subject to change.

KEY" TO RFP ATTACHMENTS:

ATTACHMENT " A"- Signature Authorization Form, including Addenda acknowledgment.

Must be completed and included in Management Plan envelope.

ATTACHMENT " B" — Non Collusion Affidavit Form. * Must be completed and notarized and included in Management Plan envelope.

ATTACHMENT" C" — Management Fee Proposal Form. * Must be completed and included in a separately sealed envelope — do NOT include this with your Management Plan Proposal.
3 0
ATTACHMENT " D" — No Conflict of Interest and Non- Discrimination Form. * Must be completed and included with Management Plan envelope.

ATTACHMENT" E" — Business Disclosure Form. * Must be completed and included with Management Plan envelope.

ATTACHMENT " F"— Current Parking Equipment Details
ATTACHMENT" G"— Airport Parking Monthly Revenue and Enplaned Passengers ATTACHMENT " H" — Seasonal Airline Flight Activity
ATTACHMENT " I"— Minimum Hours Required/Draft Parking Personnel Schedule ATTACHMENT " J" — Current Parking Gross- Revenue, TEO, and Taxi Starter Management Expenses
ATTACHMENT" K" — Sample boilerplate Contract Services Agreement and Exhibits

2. BACKGROUND: The Cityof PalmSprings, Californiais locatedin the CoachellaValley in the SouthernCaliforniadesertapproximatelyonehundredandtwenty (120) mileseast of Los Angeles. With a year round populationof approximatelyforty eight thousand (48,000) residents, the City is a popular resort destination during the winter and spring months, filling our local hotels and businesses with visitors from all over the world.

The PalmSpringsInternationalAirportis ownedandoperatedbythe Cityof PalmSprings, and located two and a half( 2.5) miles east of the central business district. The Airport serves as the major transportationcenter for the entire CoachellaValley. Ending fiscal year, June 2019, the Airport served over two million four hundred and fifty seven thousand (2,457,000) commercial passengers. There are eleven ( 11) air carriers that serve the Airport. In addition to the resort destinationstatus, the airportservicesnineincorporatedCitiesin the CoachellaValley with a combined population in excess of five hundred thousand ( 500,000) residents.

The firm awarded the contract and all of its personnel will have demonstrated an exceptional familiarity with parking management at an airport and the additional services required. As tourism is the driving force of the Palm Springs economy, the selected firm, and all of its personnel, must have a documented and superior understandingof public relations, customer service practices and conflict mitigationtechniques. The City requires managementservices be providedin a courteous, professionalmannerthatfacilitatespositiverelationshipswiththe City's residentialandbusinesscommunitiesandwiththe manyvisitorsthat cometo enjoythe Cityof Palm Springs.

The currentemployeesof the incumbentcontractorare not representedbya union. The current and draft contract does not fall under a cost of living ordinance. The current and draft contract does not include any City or Airport vehicles provided as part of the agreement. The current revenue control system is barcode based, and will remain at the end of the existing contract January 31, 2020), with necessary upgradesto be proposedas.part of the RFPsubmittal.

A copy of the current contract and all amendments is available online with the RFP document and is posted as five (5) separate pdf documents ( due to size) :
https:// www. paimsi) rinosca.govkoovernment/ departments/ procurement- contracting/ bids- oroposals
The existinglayoutofthe parkingfacilityallowsfor a totalof 936vehiclesinthe primaryparking area. Parking control equipment currently consists of a fully integrated and PCI compatible parking system, eleven ( 11) barrier gate arms, seven .( 7) ticket dispensers, two ( 2) ticket 4 rtx
collection booths with fee computers with parking control software (currently Skidata), one ( 1) unmanned credit card only exit station and one (1) pay-on-foot ticket machine in the main airport terminal. The collection ticket booth is currently manned approximatelytwenty (20) hours per day from 5:00 am until 1:00 am. These hours are modified to adjustfor delayedflights. Current parkingrates are $2.00 pertwenty (20) minuteperiodwith a $20.00 per day maximum. All parkingratesforthegeneralpublicaresetandapprovedbytheCityof PalmSprings.

The existingoverflowparkinglot accommodatesapproximatelyeight hundred (800) vehicles andthe parkingrate is $18.00 per day. In the past, shuttlebusoperationsfromthis lot have been conducted to handle overflow parking during the Thanksgiving and Christmas holiday seasons. Last year during the Thanksgiving holiday, the overflowlot shuttle operated for three 3) days prior to and includingthe holiday during the hours of 4:30 am and.8:30 pm and for five 5) days following the Thanksgivingholiday during the hours of 8:30 am until 8:30 pm ( or last flight). Lastyearduringthe Christmasholiday, the overflowlotshuttleoperatedforfive (5) days duringthe hoursof 5:00 amand9:00 pm priorto and includingthe Christmasholidayandten 10) days duringthe hours of 8:30 am and 1:00 am followingthe Christmasholiday. The financialproposalwill includeupto a combinedtwentyseven (27) daysof annualservicefor the overflow parking lot operationand shuttle service. The Airport Managementreservesthe rightto shift the minimum number of monthly hours proposed for this contract, to allow for shifts in service demands. Any overall increased hours required would be subject to the hourly rate proposedin Attachment "C" , part 3 of 3 (ManagementFee).

3. SCOPE OF WORK, SERVICES, OBJECTIVES AND. SPECIFICATIONS:

Generally, the scope of work consists of, but is not limited to: Contractor must provide all personnel, personnel bonds, personnel uniforms, materials, equipment, radios, vehicles, supervision and other items necessary to:

1. Operate and manage Airport public parking lots.

2. Collect all parking lot fees and charges (includingthe secureprocessingof credit card and debitcardcharges) legallydue, andprovidebookkeeping, accounting, and auditserviceswith respect thereto. The safety and security of the funds are the responsibility of the Contractor.

The funds are to be deposited at the city's bank, currently Bank of America. Armored car services are desired in the new contract and should be included in the management fee.

Deposit slips and credit card reports are provided to the City cashier.

3. Collect all baggage- cart machine fees and charges legally due. Provide accounting reports as requested, operate equipment and report the need for any necessary equipment repairs to the Airport.

4. Operate, service, maintain, and repair all parking lot equipment including parking lot revenue control and access equipment as part of the management fee.

5. Report and arrange for improperly parked or abandonedvehicles to be removed from the parking lots.

6. Perform nightly license plate inventoryof all vehicles parked in parking lots. This information must be logged into a database that is accessibleto Airport management. There is currently1 hand held Motorolaunitto performthe vehicleinventorythat is providedby the 5 G 0
operator. The daily vehicle inventory is performed by the existing staff, within the allocated hours or by the management of the contractor.

7. Provide and/ or arrange for basic vehicle emergency services ( i.e., jump- starts, keys locked in vehicles, and towing).

8. Keep parking lots secure and report any unsafe condition. The parking lots are to be kept in a clean, litter-free condition. Landscaping and litter pick-up is currently the responsibility of airport staff. Airport Police have the responsibility for security on Airport property.

9. Provide a designated number of traffic enforcement officers ( TEO, see Attachment ° I") performing in an orderly, diplomatic, and courteous manner. Ensure the safe movement of vehicular and pedestrian traffic on the Airport roadways in front of the terminal and in the parking lots, and other areas as may be required.

10. Provide a designated number of taxi control officers to ensure the safe and efficient movement of commercial vehicles and taxi queuing ( Attachment" I").

11. Assure adherence to airport parking and ground transportation procedures/ regulations.

Observe and report any discrepancies.

12. Provide various daily and monthly reports, accounting records, and other statistical data requested by the City.

13. Perform Airport shuttle bus operations to and from the overflow parking lot or designated location on the airport property during all periods capacity in the parking lot exceeds ninety percent ( 90%), as part of the base management services.

14. Provide shuttle bus dispatching services, when the overflow lot is operational. There is currently one (1) 9-passenger shuttle, with pick-ups every 15 minutes, operatingfor the holiday Thanksgiving & Christmas) period, not expected to exceed 27 days. The shuttle is owned by the current operator.

15. Ensure that personnel utilized for each component of the Agreement receive the appropriate level of training prior to assignment so that they may exercise their duties in an exemplary manner. Maintain current personnel manual.

16. Service and maintain all parking equipment for a fully integrated system.

Facility Description, Reporting Requirements and Equipment The automobile parking facilities to be managed and operated by Contractor consist of the following, including seven (7) entry lanes, each with a ticket dispenser, and one (1) toll plaza with two ( 2) exit booths, one ( 1) express exit lane with one ( 1) additional express exit on booth 1, and one (1) pay-on-foot station locatedwithin the Terminal. All equipmentto be compliant with payment card industry (PCI) standards. These locationsshall be referredto collectivelyas the "Airport Parking Facilities":

A. Public Parking Lot.

The public parking lot is located generally west of the Terminal, as shown in Attachment "K", SampleAgreement) see Exhibit°D," as a part of attached hereto and incorporatedby reference 6 herein. At the time of execution of this Agreement, said lot has parking capacity for approximately nine hundred and thirty six (936) vehicles in the parking area.

B. Public Overflow Parking Lot.

The overflow parking lot is located generally south of the Terminal, on Kirk Douglas Drive, as shown in Attachment" K" ( Sample Agreement) see Exhibit " D". At the time of execution of this Agreement, this lot has the capacity for approximately eight hundred ( 800) vehicles.

C. ADA Parking.

There are thirty ADA parking spots located within the public parking lot at the time this agreement commences. The spots are located nearest the passenger terminal.

D. Employee Parking Lot.

The Employee Parking Lot is managed and permitted by airport staff. The Contractors employees will be issued permits to park their personal vehicles in this lot while on duty, currently there is no charge for the first permit to the employee. Lost permits are subject to replacement cost charges. No personal vehicles of the Contractor are to park in the public parking lots while on duty.

E. Future Parking Facilities.

City shall havethe right, at any time during the term of this Agreement, includingany extensions thereto, to improve, expand, replace, or modify any or all of the Airport Parking Facilities, and/or any equipment or appurtenancesthereto. City reservesthe right to constructadditional parking facilities to serve the Terminal. Upon thirty ( 30) days written notification by the City to the Contractor, any such modified, expanded, or additionalparking facilities shall be included within the Airport Parking Facilities and shall be subject to this Agreement.

F. Management.

Provide highly qualified on-site manager. The contractor will provide an Assistant Manager Supervisor) during the absence or unavailabilityof the Parking Manager, to represent and act- for Parking Manager with like authority. The Manager or Assistant Manager will be available seven (7) days a week. The ParkingManager shall not be concurrentlyassigned or employed in any capacity with the management or operation of any other automobile parking facility or enterprise whatsoever during the tenure of such Parking Manager at the Airport.

G. Traffic Enforcement Officer ( TEO).

TEO' s are responsible for compliance with Federal regulations, regarding vehicle and traffic standards. They provide customer service by answering passenger questionsand summoning skycaps. They report unattendedluggageand vehicles, issue citationsand monitor for unauthorized commercial ground vehicle operators.

H. Taxi Starter.

Taxi Starters provide passenger assistance with forming an orderly queue line before being directed to the next available ride and insure adequate cabs are available for customer demand.

Verify compliance with Public Utility Commission (PUC) and other local regulations. These include, but are not limited to, dress codes, waybills, Transportation Commercial Permit (TCP) numbers displayed properly, commercial vehicle license plate checks, and PSP issued transponders. The Taxi Starter is to check vehicle credentials and monitor for compliance.

I. Parking Attendants.
7 0
Contractor shall be responsible for hiring, training and supervising an adequate number of supervisory and operating personnel with appropriate skills to ensure full performance of Contractor' s management and operation services.

J. Shuttle Service.

Shuttle service for holiday parking ( Thanksgiving, Christmas, and New Year) should be considered as part of the base management fee, at such time as the public parking lot exceeds ninety percent ( 90%) capacity. Holiday shuttle service provides passenger pick-ups every ten 10) — fifteen ( 15) minutes. ( For the 2018 holiday season, the Contractor provided service for a combined twenty five ( 25) days, as part of the management fee.) Additional shuttle services, as may be required from time to time, should be provided as a separate hourly charge and would be approved in addition to services provided in the base management fee. The management fee will consider a maximum of twenty seven ( 27) days of shuttle service annually, up to, but not to exceed twenty ( 20) hours per day.

Additional shuttle hourly service charge to be approved separately as per rates proposed Attachment" C", part 3 of 3, Management Fee).

K. Hours of Operation.

Contractor shall keep the Airport Parking Facilities open for use by the public and by authorized employees a minimum of ninety ( 90) minutes prior to the first commercial aircraft departure and a minimum of one ( 1) hour after the last commercial aircraft arrival, to include delayed flights. In the event of irregular operations, the airport control center will notify the parking attendant with the required schedule to operate the exit booth. This will include seven .( 7) days a week, including all weekends and holidays.

L. Supervision of Vehicular Movement and Parking.

Contractor shall maintain adequate supervision and control over vehicular entrances, exits and movement lanes so as to maintain at all times the safe, orderly, efficient and timely flow of traffic through the Airport Parking Facilities.

1. The scope of this, section particularly refers to the requirement for Contractor to staff and operate an adequate number of additional exit lanes to accommodate varying volumes of exit traffic, without unreasonable delays. Unreasonable delays are considered to be any delay in excess of six ( 6) minutes.

2. Contractor shall maintain on file with Contract Administrator a current written schedule showing the daily hours of operation of each exit lane. Contract Administrator may require an expansion or reduction to the schedule as appropriate to accommodate exiting vehicle volumes and patterns.

M. Daily Inspection of Facilities.

Throughout the term of this Agreement, Contractor shall, on a daily basis, conduct a thorough and detailed inspection of Airport Parking Facilities, to determine if any unclean or potentially hazardous condition to the public exists. The results of each such inspection shall be recorded in writing upon a report form and submitted during the same business day.

N. Capital Investment.

Contractor shall be responsible for all capital investment to maintain the existing revenue control equipment and add all equipment necessary to accommodate a fully functional system that will be ninety nine percent ( 99%) reliable, accurate and operational during all weather conditions e.g., rain, wind, dust, heat, etc.) throughout the term of this agreement. 8 0 0
The Contractor' s capital investment shall also include any vehicles and equipment that will be necessary to perform the day- today functions for the services required.

O. Equipment Maintenance.

Contractor shall have responsibility for maintaining and operating all parking equipment and vehicles necessary to meet the project scope requirements. Contractor shall be responsible for all revenue control equipment maintenance and repair upon the date of contract commencement. Contractor shall neither have nor allow access to parking lot transaction counting devices associated with exit gates, except in the presence of the City authorized representative. Additionally, Contractor' s personnel shall witness all access to such parking lot transaction counting devices.

Contractor shall notify City when maintenance is needed on any City-owned equipment.

Contractor shall provide City with access to such devices, upon request. Contractor shall give the Contract Administrator immediate oral notice of any malfunction or breakdown of any parking lot equipment supplying audit data or affecting parking lot ingress or egress, and shall give the Contract Administrator notice of the date and time such malfunction or breakdown is corrected and repaired. Contractor shall transmit written confirmation on all such information to the Contract Administrator, within twenty- four ( 24) hours.

P. Tickets.

Contractor shall provide all tickets necessary for use in the Parking Lots that are subject to this agreement and shall issue, collect and retain such tickets in accordance with terms of this Agreement. Such tickets shall be sequentially pre- numbered, accurately dated, and accurately time- stamped as to the time each vehicle enters and exits such parking lot. Tickets issued for use shall be collected at the time of vehicle exiting the public parking lots.

On-site Manager: Contractor shall provide an On-site Manager for day-to-day operations and who will also act as the local point of contact. Manager will provide reports as needed, respond to complaints, training needs, will track working hours, and supervise the contract personnel.

Any disciplinaryactionwill be the responsibilityof On-site Managerand Contractor. The On-site Manager shall meet with the Contract Administrator or designee weekly to discuss any complaints or violations of the Performance Standards that may be reported by the public or observed by the City.

Complaints to the City regarding contract employees: Contractor' s assigned On- site Manager shall investigate and report any complaints regarding their employees received from the public or the City within twenty four ( 24) hours of the report. The City shall reserve the right to contact the reporting party and Contractor employee as needed to resolve the complaint to the City's satisfaction, with the understandingthat unprofessionalor discourteoustreatment of the public will not be tolerated.

City's Rights: City reserves the right to establish, modify, add or delete hours of management.

City further reserves the right to approve or deny Contractor's personnel. The City retains the right to review and direct modification of any Contract employee training program. The City's rights under this provision may be exercised by the City Manager or the City Manager's . designee.
9 0

PARKING OPERATIONS EQUIPMENT, SERVICES AND SUPPLIES TO BE PROVIDED BY CONTRACTOR:

Contractor Employee Uniforms:

All personnel shall wear uniforms while on duty.

Contractor shall be responsible for providing personnel with proper, complete, and acceptable uniforms.

Uniform shall include a name badge or tag. Uniforms and identifying badges shall be distinct enough from those used by Peace Officers or other sworn personnel so that the general public will not mistake traffic enforcement personnel ( TEO) for Peace Officers.

Contractorshall not issue any uniform or identifyingbadge without the prior written approval by the City. I
Contract employees will not be allowed to work unless attired in complete approved uniform.

Contractor shall provide uniforms for each contract employee at no expense to the employee, except in cases of negligence or abuse of the uniform by the contract employee.

CONTRACT TERM: The City is contemplating a contract with an initial five ( 5) year term. Any renewal is at the sole discretion of the City Manager.

The current Parking Gross Revenue, TEO, and Taxi Starter and Management Expenses are listed in Attachment" J".

Insurance:

City policy for insurance and endorsements require each insurance carrier to provide 30 day written notice of cancellation.

Insurance Requirements are defined in Section 5 of the sample agreement( Attachment K") and are required.

Insurance Requirement Section 5.3. 11, of sample agreement ( Attachment" K") if claims are made during the course of the policy term, reducing the total aggregate annual available, the City must be notified in writing if the per-occurrence insurance requirement drops below the required contract amount.

4. PROPOSAL REQUIREMENTS:

The firm' s proposal should describe the methodology to be used to accomplish each of the project tasks. The proposal should also describe the work which shall be necessary in order to satisfactorily complete the task requirements.

Please note: this RFP cannot identify each specific, individual task required to successfully and completely implement this project. The City of Palm Springs relies on the professionalism and competence of the selected firm to be knowledgeable of the general areas identified in the scope of work and to include in its proposal all required tasks and subtasks, personnel commitments, man-hours, direct and indirect costs, etc. The City of Palm Springs will not approve addenda to the selected firm' s agreement which do not involve a substantial change from the general scope of work identified in this RFP.

5. SELECTION PROCESS: This solicitation has been developed in the Request for Proposals ( RFP) format. Accordingly, proposers should take note that multiple factors as identified in the RFP will be considered by the Evaluation Committee to determine which 10 0
proposal best meets the requirementsset forth in the RFP document. PRICE ALONE WILL NOT BE THE SOLE DETERMINING CRITERIA. The City shall review the proposals submitted in reply to this RFP, and a limited number of firms may be invitedto make a formal presentation at a future date if desired by the City. The format, selection criteria and date of the presentation will be established at the time of short listing, if conducted.

6. PROPOSAL EVALUATION CRITERIA: An Evaluation Committee, using the following evaluation criteria for this RFP, will evaluate all responsive proposals to this RFP. Firms are requested to submit their proposals so that they correspond to and are identified with the following specific evaluation criteria ( 100 total points possible):

Minimum Qualifications for Proposers:

To be qualified as a proposer for this RFP, each proposer must meet or exceed the following minimum qualifications by no later than the proposal deadline:

The proposer must have a minimum of five (5) continuousyears of airport experience in the past ten ( 10) years in operating and managing commercial parking lot operations using a computerized parking lot access revenue control system. At least one ( 1) location used to demonstrate the above identified operating and managing experience, must have had at least 1,500 parking stalls and annual revenues in excess of $3,000,000. Also, the proposer must have had responsibility for collection and accounting of parking lot revenue as well as responsibilityfor operatingand maintainingthe parking lot revenuecontrol equipment.

The proposer must demonstrateand prove that it has a minimum of three (3) continuous years of experience in the past ten (10) years in operating and managing a public use shuttle bus operation. The shuttle bus operation must have had the following: 1) a seating capacity of no less than 20 passengers; 2) air-brakes; and 3) ADA- approved equipment to accommodate disabled passengers. The proposer must detail plans for operating a shuttle operation on a seasonal basis based upon passenger traffic and airline schedules.

The proposer must demonstrate and prove that it has experience in the past ten (10) years in providing parking curb control operations or qualified staff with parking and traffic control operations experience at airports or similar facilities.

The proposer must demonstrateand prove that it has a minimum of three (3) continuousyears of experience inthe past ten (10) years in implementinginfrastructureimprovementprograms.

Eachproposalmustclearlydemonstratethatthe ProposermeetstheMinimumQualificationsas detailed above. Proposals that do not meet the Minimum Qualifications will not be subject to further evaluation.

Proposers whose proposalsfail to complywith, or take exceptionto, the Scope of Services as defined by the City herein may be considered nonresponsiveand dropped from the evaluation process.

The Evaluation Committee will evaluate the proposals on the following criteria:

MANAGEMENTPLAN:

A. Qualifications, Experience, and Operational References 20 points B. Financial Resources and Financial References 15 points ll
0 C. Operating Plan for Palm Springs International Airport 25 points D. Management Fee, Facility Investment, Rates 40 points 100 points total
NOTE'. - DISADVANTAGE BUSINESS ENTERPRISE ( DBE) PROGRAM: The Management Plan should reference how the Contractor will achieve the current Airport Concession Disadvantaged Business Enterprise ( ACDBE) goal as identified within the Attachment " K", Sample Contract Exhibit " C". Please provide clearly how your company will adhere to this goal.

The ACDBE Program, is to provide additional opportunities for small businesses to participate in contracting at Palm Springs International Airport. The Small Business Program operates in a race and gender- neutral manner. The program will not be used to discriminate against any company or group of companies. It is designedto includeall segmentsof businessand is open to participation without regard to race, color, sex, religion, national or ethnic origin, age or disability. The Program is open to businesses regardless of location. This evaluation will not consider points for local preference. As the Small Business Program outlines, there will be no geographic preference or limitation imposed on a small businesses participating. The managementplan descriptionwill clearly list the firm's cash handlingpolicies, and how it relates to the Palm Springs International Airport' s operation. Describe complete operational plan.

PRIOR CITY WORK If your firm has prior experience working with the City DO NOT assume this prior work is known to all members of the evaluation committee. All firms are evaluated on the information contained in their proposal, information obtained from references ( including the city and past performance if applicable), and presentations if requested. All proposals should be prepared as if the evaluation committee members have no knowledge of the firm, their qualifications or past projects.

7. PROPOSAL CONTENTS: Firms are requested to format their proposals so that responses correspond directly to, and are identified with, the specific evaluation criteria stated in Section 6 above. The proposals must be in an 8 % X 11 format, minimum 1Opt font size, minimum %" margins, and may be no more than a total of forty ( 40) sheets of paper, which may be double-sided, including cover letters, organization charts, staff resumes, appendices, and any exceptionsto the language in the sample agreement, or to the insurance requirements. NOTE: Front and Back Covers, Dividers, Attachments " A", " B", " D", " E", and Addenda acknowledgments, and the Management Fee (' in a separate sealed envelope) do NOT count toward the limit (everything else does). Interested firms shall submit SIX (6) copies one marked " Original" plus five ( 5) copies) of your Management Plan and one marked Original" and five ( 5) copies of your Management Fee, and one (1) Thumb Drive or CD of the entire proposal ( including the Management Fee), by the deadline. ' Note that the page limit will NOT be increased.

All ,proposals shall be sealed within one package and be clearly marked, "RFP # 06-20,

REQUESTS FOR PROPOSALS FOR PARKING MANAGEMENT SERVICES AT PALM SPRINGS INTERNATIONAL AIRPORT". Within the sealed proposal package, the Management Fee shall be separately sealed from the Management Plan. Proposals not meeting the above criteria may be found to be non- responsive.

EACH PROPOSAL PACKAGE MUST INCLUDE TWO ( 2) SEPARATELY SEALED ENVELOPES:

Envelope# 1, clearly marked " Management Plan", shall include the following items:

Completed Signature authorization and Addenda Acknowledgment ( see Attachment A) 12 Completed, and notarized, Affidavit of Non- Collusion ( see Attachment B) CompletedNo Conflict of Interestand Non-DiscriminationForm (AttachmentD) Completed Business Disclosure Form ( Attachment E)
In addition to the items above, at a minimum, firms must provide the information identified below. All such information shall be presented in a format that directly corresponds to the numbering scheme identified here.

MANAGEMENT PLAN:

SECTION A:

FIRMICOMPANY QUALIFICATIONS AND EXPERIENCE ( including any subcontractors)

MEETING OR EXCEEDING THE MINIMUM QUALIFICATIONS
A. 1 Follow the instructions and properly complete and execute Attachments " A", " B", " D" and " E" that are provided in the RFP and include them here in your proposal. Note that Attachment " B" must be Notarized.

A. 2 State your firm's completename, address, telephone/fax numbers, website; type of ownership (sole proprietor, partnership, corporation, joint venture, etc.); andyearsin business underpresentname. Alsoincludethe primarycontactpersonrepresentingyourfirmduringthis RFP processand their contact information, includingemail address.

A. 3 Carefullyaddresseachof the itemsidentifiedin the "MinimumQualifications" required above and how your firm meets, or exceeds, each.

A. 4 Addresshow your firm will achievethe AirportConcessionDisadvantagedBusiness Enterprise (ACDBE) goalas identifiedaboveandwithinthesampleagreement, Attachment "K", contract Exhibit" C".

A. 5 List at least three ( 3), but no more than ( 10) parking lots ( preferably at airports) that your firm has managed/ operated and include the location of the lot, owner of lot, number of spaces, currentphonenumber, emailaddressand nameof referencecontactperson, datesoperated, type of revenue control system used, method and amountof reimbursement/managementfee,, and owner' s annual parking lot gross revenue.

A. 6 List at least three (3), but no more than ten (10) locations of airport shuttle bus operationsthatyourfirmhasmanaged/operatedandincludethe locationof operation, operated on behalf of, currentphone number, email addressand nameof referencecontactperson, dates operated, number of buses with 20 seats or more, and the method/ amount of reimbursement (for operatingcosts and managementfees).

A. 7 List at least three ( 3), but no more than ten ( 10) locations where your firm has managed traffic control operations and include location of operation, operated on behalf of, current phone number, email address and name of reference contact person, dates operated, number of traffic control officers, and the method/amount of reimbursement (for operating costs and management fees).

A. 8 List qualificationsof personnelassignedto this project. Provide resumesfor key individualsandthe projectmanagerassignedto the project. Describethetechnicalabilitiesand 13 specificexperienceof personnelassignedto thisproject. Statethe availabilityof keyindividuals and team members and the Proposer' s commitment to ensure the on- going availability, responsivenessand support of key individualsto completethe scope of work.

SECTION B:

FINANCIAL RESOURCES AND FINANCIAL REFERENCES
B. 1 Submit financial statements, including profit and loss statements, for the two ( 2) most recentlycompletedfiscal yearsfor the purposeof establishinga clear pictureof your firm's comparativefinancial capabilityand currentfiscal operating position. Each such statement must either bear the certification of the independent Certified Public Accountant who originally audited and certified such statements or the signature of the firm' s Chief Financial Officer if such statements are unaudited. The financial resources information should provide evidence of the firm's financialability to providethe necessarycapital investment.

B. 2 Submit a list of at least three persons or firms (to include address and current phone numbers and email addresses), with whom the proposer has conductedfinancial transactions and expense reporting crucial to its parkinglot and/or shuttle bus operationduringthe past two yearsandwhomaybecontactedbytheCity. If firmsareused, givethenameofthedepartment and/or personwhomwe may contact. Important: Proposersare to attacha letterof reference from each of the persons or firms listed.

B. 3 Submit references ( to include bank name, branch, address, contact person, phone number and email address) indicating your firm's credit standing and ability to undertake the operationof the proposedAgreement. Important: Proposersareto attacha letterof reference from each bank reference. At least one ( 1) bank reference and letter shall be submitted.

B. 4 If your firm has ever beenadjudgedbankrupt (Chapter7), or petitionedthe courtfor relief under the Bankruptcy Code or Act for either business reorganization (Chapter 11) or the Wage Earner' s Plan ( Chapter 13), state the date the petition was filed, the case number and jurisdiction, theamountofliabilitiesanddebts, thedateofdischargeorsuccessfulcompletionof reorganization or wage earner' s plan and current status.

B. 5 If your firm has ever receivedan unfavorableaudit of its financialperformancein conjunction with contractual agreements ( unfavorable here is defined as an error in tracking of expensesor billingequalto or in excessof twopercent) pleasestatethe nameof business, the location of business, the date of audit and an explanation of the audit discrepancy.

Important Note: In the event the proposer requeststhat the City of Palm Springs receive and maintainanyof the abovefinancialinformationin confidence, theproposerunderstandsthatthe City will be requiredto disclosesuch informationunder the CaliforniaPublicRecordsAct Government Code Sections 6250, et seq., if applicable). Please carefully review Section 8, General and Special Conditions, Public Records" in this RFP.

SECTION C:

OPERATING PLAN FOR PSP
CA Submit an OperatingPlan that supportsthe' requirementsof the sample .contract services- agreement (Attachment "K") and the scope of services as defined herein for the 14 0
Parking Management Services at Palm Springs International Airport (PSP) that shall at minimum include, but is not limited to, the following:

Identification of vehicles proposer intends to use in order to perform .the Shuttle Bus services at the Airport. If the proposer intends to use its own fleet of buses, then detail the number and type of bus, the passenger capacity, the type of fuel the vehicles use, the number of buses that are ADA- compliant, ordinary and preventative maintenance schedule and site for servicing vehicles, if proposer intends to perform the service on the vehicles or if this function will be provided by an outside contractor, the proposer' s plan for ensuring that an adequate number of buses are available at the Airport to maintain customer service levels and service intervals, vehicle replacement schedule and any other distinguishing characteristicsthat will be helpful in evaluatingthe proposed fleet of buses.

Coordinating operations with the shuttle bus operator ( if different than parking lot operator).

Collecting all' Parking Lot fees and charges (including the secure processing of credit card charges) legally due, and providing bookkeeping and accounting services with respect thereto.

Operating and maintaining the Parking Lot revenue control equipment.

Removingimproperlyparked or abandonedvehiclesfrom Parking Lots.

Performingnightly license plate inventoryof all vehicles in Airport Parking Lots.

Maintainingthe Parking Lots so thatthey are clean and free of litter, report discrepancies to Airport Operations.

Providing Parking Lot customers with reasonable emergency vehicle assistance.

Establishing and maintaining a high level of customer service.

Number of proposed traffic enforcementofficers proposer intendsto use to perform the scope of services, for peak and non-peak months, to include training standards and proposed schedule. The Contractor must provide a training programfor all new hires to develop their knowledge, skills and abilitiesfor achievingqualitywork performance. The program should involve classroom and field instruction, and encourage student participation.

Proposer' s local and off-site management team, including individual experience and qualifications. It is expectedthat the on-site management team will include at least one 1) manager and one ( 1) assistant manager ( supervisor) for 24 hour, 7 day a week coverage.

Identification of local and off- site management duties and responsibilities, by individual position, as they relate to operations at the Airport.

Organizational chart, local and corporate level.
15 0
Proposer's transition plan for commencement of operations following award of Agreement and effective start date of February 1, 2020.

Accounting methods including handling of non-revenue and lost tickets, abandoned vehicles and lien sale vehicles.

Cashier and supervisor procedures for cash handling.

Use of automated payment systems.

Ability of Airport to remotely access, via the internet, read-only statistical information regarding daily operations.

Detailed preliminary and secondary auditing procedures.

Customer Service policy and training program.

Personnel policies such as employee duties, qualifications, recruitment, hiring, pay scale, training evaluation, background check procedures, bonding procedures, advancement and dismissal.

Equal employment opportunity policy.

Sexual harassment policy.

Safety policy and procedures.

The Management Fee ( Envelope # 2) shall be SIGNED and clearly marked in a separately sealed envelope and shall include Section D below:

SECTION D:

MANAGEMENT FEE (* see Attachment " C" parts t through 3)

PROPOSERS MUST USE THE MANAGEMENT FEE PROPOSAL FORM, THERE ARE THREE ( 3) PARTS, ATTACHMENT " C", AS PROVIDED BY THE CITY IN THE RFP DOCUMENTS. Failure to use the Management Fee Proposal form ( Attachment " C") as provided by the City WILL be cause for rejection of a proposal. Do NOT include Attachments A" , " B", " D", or " E" in the Management Fee Proposal, Envelope # 2. They are to be included in Envelope # 1, " Management Plan". BE SURE THAT THE MANAGEMENT FEE FORMS (ATTACHMENT " C") ARE PROPERLY SIGNED and that you include one copy marked " Original", plus 5 additional copies in the separately sealed envelope.

The Management Fee proposal will include a summary of labor compensation by year, an itemized list identifying the total of the facility investment for the revenue control system, hourly rates as may be applicable, and an Annual and a Grand Total Management Fee inclusive of all labor, equipment investment and all other reimbursable expenses necessary to operate through the five ( 5) year term of the agreement. Vendors are to familiarize themselves with, and take into consideration, current California Legislation affecting Minimum Wage requirements through 16 0 0
2022.

Note: The management fee proposal SHALL include a payment to be made to the City of Palm Springs for$ 79,405. 00 by the successful bidder, no later than January 31, 2020. This payment will fund the remaining balance owed for the existing revenue control system. . The successful bidder will be responsible, to maintain the Skidata system, software licensing, repairs, parts, maintenanceand all others costs to operatethe fully operational, PC[ compliant revenue control equipment through the term of the agreement.

8. GENERAL AND SPECIAL CONDITIONS:

DEADLINE FOR SUBMISSION OF PROPOSALS: Proposals will be received in the City of Palm Springs, Office of Procurement and Contracting until 3: 00 P. M., LOCAL TIME, TUESDAY, DECEMBER 10, 2019. Proof of receipt before the deadline is a City of Palm Springs, Office of Procurement and Contracting time/date stamp. It is the responsibility of the firms replying to this RFP to see that any proposal sent through the mail, or via any other delivery method, shall have sufficienttime to be received by the ProcurementOffice prior to the proposal due date and time. Late proposalswill be returnedto the firm unopened. Proposals shall be clearly marked and identified and must be submitted to:

City of Palm Springs
Procurement and Contracting Department
3200 E. Tahquitz Canyon Way
Palm Springs, CA 92262
Attn: Craig Gladdens, C.P.M., Procurement& Contracting Manager QUESTIONS: Firms, their representatives, agents or anyone else acting on their behalf are specifically directed NOT to contact any city employee, commission member, committee member, council member, or other agency employee or associate for any purpose related to this, RFP other than as directed below. Contact with anyone other than as directed below WILL be cause for rejection of a proposal.

Any questions, technicalor otherwise; pertainingto thisRFPmust be submitted INWRITING and directed ONLY to:

Craig Gladders, C.P.M.

Procurement& Contracting Manager
3200 East Tahquitz Canyon Way
Palm Springs, CA 92262
via FAX ( 760) 323- 8238
or via EMAIL: Craig. Gladders0palmspringsca. gov
Interpretations or clarifications considered necessary in response to such questions will be resolvedby the issuanceof formalAddendato the RFP. The deadline for all questions is 3: 00 P. M., Local Time, Tuesday, December 3, 2019. Questions received after this date and timemay notbe answered. OnlyquestionsthathavebeenresolvedbyformalwrittenAddenda via the Division of Procurementand Contractingwill be binding. Oral and other interpretations or clarifications will be without legal or contractual effect. 17 0
SECURITY INSTRUMENT: Concurrent with execution of this Agreement, the successful Contractor shall furnish the City of Palm Springs with an irrevocable letter of credit, or equivalent security instrument, for Contractor' s faithful performance of this Agreement in the principal sum of two hundred thousand and 00/ 100 dollars ($ 200,000. 00) issued by a surety company licensed to do such business in the State of California and acceptable and satisfactory to the City. Said instrument shall be maintained and kept in full force and effect by Contractor from the date of the signing of the Agreement to the termination of the Agreement.

FORM OF AGREEMENT: The selected firm will be required to enter into a contractual agreement, inclusive of insurance requirements, with the City of Palm Springs in accordance with the standard Contract Services Agreement ( see Attachment " K"). Please note that the Exhibits are intentionally not complete in the attached sample standard document. These exhibits will be negotiated with the selected firm, and will appear in the final Contract Services Agreement executed between the parties.

We specifically draw your attention to the language in the sections of the sample contractual agreement attached entitled " Conflict of Interest" and " Covenants Against Discrimination" and recommend all firms carefully consider these contractual requirements prior to submitting a proposal in response to this RFP. Firms that submit a proposal in response to this RFP shall certify the following:
a) Conflict of Interest. Consultant acknowledges that no officer or employee of the City has or shall have any direct or indirect financial interest in this Agreement nor shall Consultant enter into any agreement of any kind with any such officer or employee during the term of this Agreement and for one year thereafter. Consultant warrants that Consultant has not paid or given, and will not pay or give, any third party any money or other consideration in exchange for obtaining this Agreement. b) Covenant Against Discrimination . In connection with its performance under this Agreement, Contractor shall not discriminate against any employee or applicant for employment because of actual or perceived race, religion, color, sex, age, marital status, ancestry, national origin ( i.e., place of origin, immigration status, cultural or linguistic characteristics, or ethnicity), sexual orientation, gender identity, gender expression, physical or mental disability, or medical condition ( each a "prohibited basis"). Contractor shall ensure that applicants are employed, and that employees are treated during their employment, without regard to any prohibited basis. As a condition precedent to City's lawful capacity to enter this Agreement, and in executing this Agreement, Contractor certifies that its actions and omissions hereunder shall not incorporate any discrimination arising from or related to any prohibited basis in any Contractor activity, including but not limited to the following: employment, upgrading, demotion or transfer; recruitment or recruitment advertising; layoff or termination; rates of pay or other forms of compensation; and selection for training, including apprenticeship; and further, that Contractor is in full compliance with the provisions of Palm Springs Municipal Code Section 7.09.040, including without limitation the provision of benefits, relating to non- discrimination in city contracting.

Failure or refusal to enter into an Agreement as herein provided or to conform to any of the stipulated requirements in connection therewith shall be just cause for an annulment of the award. If the highest ranked Proposer refuses or fails to execute the Agreement, or 18 4
negotiations are not successful, or the agreement is terminated, the City may, at its sole discretion, enter negotiations with and award the Contract to the second highest ranked Proposer, and so on.

AWARD OF CONTRACT: It is the City's intent to award a contractto the firm that can provide all of the scope of work, equipment and services identified in the RFP document. However, the City reserves the right to award a contract, or to make no award, whichever is in the best interest of the City. It is anticipated that award of the contract will occur at the next regularly scheduled City Council meeting after the evaluation committee has made its final selection of the firm to be recommended for award and a contract has been negotiated and agendized for consideration. The decision of the City Councilwill be final.

RIGHT TO ACCEPT OR REJECT PROPOSALS: The City of Palm Springs reserves the right to waive any informality or technical defect in a proposal and to accept or reject, in whole or in part, any or all proposals and to cancel all or part of this RFP and seek new proposals, as best serves the interests of the City. The City furthermore reserves the right to contract separately with others certain tasks if deemed in the best interest of the City.

INSURANCE: Insurance provisions are contained in the Standard Contract Services sample agreement included in the RFP. The successful Proposer will be required to comply with these provisions. It is recommended that Proposers have their insurance provider review the insurance provisions BEFORE they submit their proposal.

RESPONSIBILITY OF PROPOSER: All firms responding to this RFP shall be responsible. If it is found that a firm is irresponsible ( e.g., has not paid taxes, is not a legal entity, submitted an RFP without an authorized signature, falsified any information in the proposal package, etc.), the proposal shall be rejected.

PUBLIC RECORD: All documents submitted in response to this solicitation will become the propertyoftheCityof PalmSpringsandaresubjectto theCaliforniaCodeSection6250at seq., commonly known as the Public RecordsAct. Information contained iri the documents, or any other materials associated with the solicitation, pursuant to CA Government Code 6255 during the negotiation process, may be made public after the City's negotiations are completed, and staff has agendized the recommendation to the City Council for the award of a contract to a specific firm, but before final action is taken by the City Council to award the contract.

Although the California Public Records Act (" CPRA") recognizes that certain confidential trade secret information may be protected from disclosure, the City may not be in a position to establish that the information submitted in a proposal is a trade secret. If a request is made for information marked " Confidential," " Trade Secret," Proprietary," or any other similar designation, the Citywill providethe partysubmittingsuchinformationwith reasonablenoticeto allowthe party to seek protection from disclosure by a court of competent jurisdiction.

If a submitting party contends that a portion of the proposal is confidential even under the CPRA, the party: 1) must clearly label each document and/or page deemed a confidential document 2) the legal rationale supporting such contention including specific references to applicable provisions of the Public Records laws of the State 3) must actively defend against any request for disclosure of information which the party has determined should not be released, and 4) must indemnify and hold harmless the City from any loss, claim or suit, including attorneys' fees, brought by a person challenging the City's refusal to release the 19 0
documents. The City will not, under any circumstances, incur any expenses, or be responsible for any damages or losses incurred by a party submitting a proposal or any other person or entity, because of the release of such information. The City will not return the original or any copies of the proposal or other information or documents submitted to the City as part of this RFP process. NOTE THAT THE CITY MAY NOT RECOGNIZE PROPOSALS WHERE ALL

OF THE INFORMATION, VIA A BLANKET STATEMENT, IS SUBMITTED AS PROPRIETARY INFORMATION OR A TRADE SECRET. SUCH PROPOSALS MAY BE FOUND NON- RESPONSIVE.

COST RELATED TO PROPOSAL PREPARATION: The City will. NOT be responsible for any costs incurred by any firm responding to this RFP in the preparation of their proposal or participationin any presentation if requested, or any other aspects of the entire RFP process.

COMPLIANCE WITH LAW: Proposer warrants that all Services rendered shall be performed in accordance with all applicable federal, state, and local laws, statutes, ordinances lawful orders, rules, and regulations.

LICENSES, PERMITS, FEES, AND ASSESSMENTS: Proposer represents and warrants to City that it will obtain all licenses, permits, qualifications, and approvals of whatever nature that are legally required to practice its profession and perform the Work and Services requested in this RFP. Proposer represents and warrants to City that Proposer shall, at its sole cost and expense, keep in effect at all times during the term of the Agreement if so awarded, any license, permit, qualification, or approval that is legally required for Proposer to perform the Work and Services under the Agreement if so awarded. Proposer shall have the sole obligation to pay for any fees, assessments, and taxes,. plus applicable penalties and interest, which may be imposed by law and arise from or are necessary for the Proposer' s performance of the Work and Services required under the Agreement if so awarded. Proposer shall indemnify, defend, and hold harmless City against any such fees, assessments, taxes penalties, or interest levied, assessed, or imposed against City to the fullest extent permitted by law.

BUSINESS LICENSE:- The selected firm will be required to be licensed in accordance with the City of Palm Springs Business License Ordinance, Municipal Code Chapter 3.40 through 3.96, entitled " Business Tax".

INVESTIGATIONS: The City reserves the right to make such investigations as it deems necessary to determine the ability of the firms responding to this RFP to perform the Work and the firm shall furnish to the City all such information and data for this purpose as the City may request. The City reserves the right to reject any proposal if the evidence submitted by or investigationof such firm fails to satisfy the City that such firm is properly qualifiedto carry out the obligations of the Contract and to complete the Work contemplated therein.

NONCOLLUSION: The undersigned, by submission of this Proposal Form, hereby declares that this Proposal is made without collusion with any other business making any other Proposal, or which otherwise would make a Proposal. Proposer must execute an Affidavit of Non- Collusion provided as.Attachment " B" in the RFP and include it with their proposal and must be Notarized.

PROPOSALS TO REMAIN OPEN: The Proposer shall guarantee that- all contents of their proposal shall be valid for a period of 120calendardaysfrom the due date of proposals. 20 OTHER PUBLIC AGENCY " PIGGYBACK" CLAUSE": It is intended that any other public agency, at the mutual consent of both parties and consistentwith the public agency's policies and procedures, be permittedto purchaseunder the terms submittedin responseto this procurement. Any participatingagencyshalltake sole responsibilityfor the placingof orders, arrangingfor deliveryandor services, andmakingpaymentsto the vendor, contractor, or consultant. The City of Palm Springs will not be liable or responsible for any obligations, including but not limited to financial responsibility, in connectionwith the participation by other public agencies.

SIGNEDPROPOSAL AND EXCEPTIONS: Submissionof a signed proposalwill be interpreted to meanthatthefirmrespondingto thisRFPhasherebyagreedto allthe termsandconditions set forth in all of the sheets which make up this Request for Proposals, and any attached sample agreement. Exceptions to any of the language in either the RFP documents or attached sample agreement, including the insurance requirements, must be included in the proposal and clearly defined. Exceptions to the City's RFP document or standard boilerplate language, insurance requirements, terms or conditions may be considered in the evaluation process; however,the Citymakesnoguaranteethatanyexceptionswillbeapproved. 21 0
ATTACHMENT " A"

THIS FORM MUST BE COMPLETED AND SUBMITTED WITH YOUR MANANGEMENT PLAN Envelope# 1r
REQUESTS FOR PROPOSALS ( RFP)# 06- 20

PARKING MANAGEMENT SERVICES AT PALM SPRINGS INTERNATIONAL AIRPORT

SIGNATURE AUTHORIZATION
NAME OF COMPANY( PROPOSER):

BUSINESS
ADDRESS:

TELEPHONE: CELL PHONE FAX

CONTACTPERSON EMAIL ADDRESS
A. I hereby certify that I have the authority to submit this Proposal to the City of Palm Springs for the above listed individual or company. I certify that I have the authority to bind myself/this companyin a contractshould I be successfulin my proposal.

PRINTED NAME AND TITLE

SIGNATURE AND DATE
B. Thefollowinginformationrelatesto the legalcontractorlistedabove, whetheran individual or a company. Place check marks as appropriate:

1. If successful, the contractlanguageshouldreferto me/mycompanyas:

An individual;
A partnership, Partners' names:

A company;
A corporation If a corporation, organized in the state of:

2. My tax identification number is:

ADDENDA ACKNOWLEDGMENT:

Acknowledgmentof Receiptof any Addendaissuedby the Cityfor this RFPis requiredby includingthe acknowledgment with your proposal. Failure to acknowledge the Addenda issued may result in your proposal being deemed non-responsive.

In the space provided below, please acknowledge receipt of each Addenda:

Addendum( s)# islare hereby acknowledged.
22 ATTACHMENT " B"
THIS FORM MUST BE COMPLETED AND SUBMITTED WITH YOUR MANAGEMENT PLAN( Envelope# 1)•

NON- COLLUSION AFFIDAVIT TO BE EXECUTED BY BIDDER AND NOTARIZED

AND SUBMITTED WITH BID
STATE OF CALIFORNIA) ss

COUNTY OF RIVERSIDE)
The-undersigned, being first duly sworn, deposesand saysthat he or she is of the party making the foregoing
Proposal. That the Proposal is not made in the interests of, or on the behalf of, any undisclosed person, partnership, company, association, organization, or corporation; that the Proposal is genuine and not collusive or sham; that the Proposer has not directly or indirectly induced or solicited any other Proposerto put in a false or sham Proposal, and has not directly or indirectly colluded, conspired, connived, or agreedwith any Proposeror anyoneelseto put in asham Proposal, or that anyoneshall refrain from Proposing; that the Proposerhas not in any manner, directly or indirectly, sought by agreement, communication, or conference with anyone to fix the Proposal price of the Proposer or any other Proposer, or to fix any overhead, profit, or element of the Proposal price, or of that of any other.Proposer, or to secureany advantageagainstthe public body awarding the contract of anyone interestedin the proposedcontract,that all statementscontainedin the Proposalaretrue; and,further, that the Proposerhasnot, directly or indirectly, submittedhis or her Proposalprice or anybreakdown thereof, or the contents thereof, or divulged information or data relative thereof, or paid, and will not pay, any feeto any corporation, partnership, company, association, organization, Proposaldepository, or anyother memberor agentthereofto effectuateacollusiveor shamProposal.

By,
Title:

Subscribed and sworn to before me this day of 2019.
23 ATTACHMENT " C" Part 1 of 3

MANAGEMENT FEE PROPOSAL

THIS FORM MUST BE COMPLETED, SIGNED AND SUBMITTED IN A SEPARATELY SEALED ENVELOPE # 2 " Management Fee", NOTwith Envelope# 1, Management Plan*) REQUEST FOR PROPOSAL ( RFP# 06- 20)

PARKING MANAGEMENT SERVICES AT PALM SPRINGS INTERNATIONAL AIRPORT Responding to Request for Proposal No. 06-20 for Parking Management Services at Palm Springs International Airport, UWE will accept as full payment the following fees for providing all labor, supervision, services, materials, equipment, supplies, training, and any other miscellaneous items required to perform the Parking Management Services. The undersigned, Proposer proposes and agrees to provide all work and services necessary to deliver the Parking Management Services as defined in the Scope of Work herein.

Contractor is expected to follow all applicable Federal and State Employment laws, rules and regulations. Invoices shall be submitted to the City on a Monthly Basis for actual services rendered, not in advance or anticipation of services " to be rendered" and are payable by the City within thirty( 30) days.

Management Fee( labor only*) Schedule for Five ( 5) Years:

Currently the employees do not need to be badged. Employees do not pay to park in the designated employee parking lot. Vendors are to familiarize themselves with, and take into consideration, current California legislation affecting Minimum Wage requirements through 2022.

Management Fees ( labor only, note ANNUAL COST
minimum hours in Attachment H*):

On- site Manager& Assist.

Mgr.( Supervisor)
Parking Attendant
TEO( s) Off- Season
Taxi Starter( s) approx. 21
weeks
TEO( s) Peak
Taxi Starter( s) Season
approx. 31
weeks
ANNUAL COST: Year 1 (February 1,
2020— January 31, 2021
Year 2 ( February 1, 2021 — January 31, 2022) $
Year 3 ( February 1, 2022— January 31, 2023) $'
Year 4 ( February 1, 2023— January 31, 2024) $
Year 5 (February 1, 2024,— January 31, 2025) $
Five ( 5) Year Grand Total:
24 0
ATTACHMENT " C"
Part 2 of 3
Proposed equipment replacement or upgrades necessary for the contract term The equipment maintenance will be the responsibility of the Contractor over the term of this agreement, the cost should be included in the management fee. The Airport does not have details for the historical maintenance of the equipment.

The cost for all miscellaneous supplies/ equipment such as radios, hand held unit for daily vehicle inventories, phone lines, data lines, tickets, receipts, equipment maintenance, signage and uniforms.

Cleaning the parking offices and all parking booths is the responsibility of the contractor.

Major grounds and parking lot clean- up is the resppnsibility of the Airport staff.

Holiday overflow parking, the cost of the 27 days at 20 hours daily should be included into the management fee. The hourly quote should be for hours in excess of the base amount. The hourly cost is to Include all costs of the shuttle operation.

Credit card fees will be the responsibility of the City and should NOT be included in the management fee.

The list provided will include all approved equipment to be amortized over the five ( 5) year contract term. To be included in the management fee.

Equipment Location Make I Model
Other Equipment
25 6_
D
ATTACHMENT" C"
Part 3 of 3
HOURLY RATES:

Shuttle Operation, Hourly Charge ............$ hour.

Hourly Charge for Cashier. .....................$ hour.

Hourly Charge for TEO, for special events.........$ hour.

To be approved by the City when applicable in addition to the total management fee. ( This would be for special events or service provided in addition to charges as listed in the Scope of Services, item L).

TOTAL PROPOSED ANNUAL MANAGEMENT FEE
Nate: The management fee proposal SHALL include a payment to' be made to the City of Palm Springs for$ 79,405.00 by the successfulbidder, no later than January31, 2020. This payment will fund the remaining balance owed for the existing revenue control system. The successful bidder will be responsible to maintain the Skidata system, software licensing, repairs, parts, maintenance and all others costs to operate the fully operational, PC[ compliant revenue control equipment through the term of the agreement.

Inclusive of ALL labor, payroll, materials, equipment, operating expenses and facility investment To be amortized over five ( 5) years:

Year 1 (February 1, 2020— January 31, 2021) $
Year 2 (February 1, 2021 — January 31, 2022) $
Year 3 (February 1, 2022— January 31, 2023) $
Year 4 ( February 1, 2023— January 31, 2024) $
Year 5 ( February 1, 2024— January 31, 2025) $
Grand Total Management Fee for five ( 5) Years $
write the Grand Total amount in words online above)
NAME OF FIRM:

AUTHORIZED
SIGNATURE:

PRINTED NAME:

TITLE:
26 ATTACHMENT " D"
THIS FORM MUST BE COMPLETED AND SUBMITTED WITH YOUR MANAGEMENT PLAN( Envelope# 1)*

CITY OF PALM SPRINGS, CA

CONFLICT, OF INTEREST AND NON- DISCRIMINATION

CERTIFICATION
Conflict of Interest. Consultant. acknowledges that no officer or employee of the City has or shall have any direct or indirect financial interest in this Agreement nor shall Consultantenter into any agreementof anykindwithanysuchofficeror employeeduringthetermof thisAgreementandfor oneyearthereafter. ConsultantwarrantsthatConsultanthasnotpaidor given, andwill not payor give, anythirdpartyanymoneyor otherconsiderationin exchangeforobtainingthisAgreement.

Covenant Against Discrimination. In connection with its performance under this Agreement, Consultant shall not discriminate against any employee or applicant for employment because of actualor perceivedrace, religion, color, sex, age, maritalstatus, ancestry, nationalorigin ( i.e., place of origin, immigration status, cultural or linguistic characteristics, or ethnicity), sexual orientation, genderidentity, genderexpression, physicalor mentaldisability, or"medicalcondition each a " prohibited basis"). Consultant shall ensure that applicants are employed, and that employees are treated during their employment, without regard to any prohibited basis. As a condition precedent to City's lawful capacity to enter this Agreement, and in executing this Agreement, Consultant certifies that its actions and omissions hereunder shall not incorporate any discriminationarisingfromor relatedto anyprohibitedbasisin anyConsultantactivity, includingbut not limited to the following: employment, upgrading, demotion or transfer; recruitmentor recruitment advertising; layoffor termination; ratesof pay or otherformsof compensation; andselectionfor training, includingapprenticeship; and further, that Consultantis in full compliancewith the provisionsof Palm Springs MunicipalCode Section 7.09.040, includingwithoutlimitationthe provisionof benefits, relating to non-discriminationin city contracting.

NAME OF CONSULTANTNENDOR:

NAME and TITLE of Authorized Representative:

Print)
Signature and Date of Authorized Representative:

Sign) Date)
27 V
0 ATTACHMENT " E" ( 6 pages)
PHIS FORM MUST BE COMPLETED AND SUBMITTED WITH YOUR MANAGEMENT PLAN( Envelope# 1)'

CITY OF PALM SPRINGS

PUBLIC INTEGRITY DISCLOSURE

INSTRUCTIONS FOR APPLICANTS)
Who Must File?
Applicants that are NOT a natural person or group of natural people that will be identified on the application, and seek a City approval determined by a vote of City officials.

Examples include corporations, limited liability companies, trusts, etc. that seek a City Council approval, or an approval by one of the City's board or commissions.

Why Must I File?
The City of Palm Springs Public Integrity Ordinance advances transparency in municipal government and assists public officials in avoiding conflicts of interest. The City' s Public Integrity Ordinance, codified in Chapter 2.60 of the municipal code, reflects the City's interest in ensuring that companies (and other legal entities that are not natural people) doing business in the community are transparent and make disclosure as to their ownership and management, and further that those companies disclose the identity of any person, with an ownership interest worth two thousand dollars ($ 2,000) or more, who has a material financial relationship with any elected or appointed voting City official, or with the City Manager or City Attorney.

Note: A material financial relationship is a relationship between someone who is an owner investor in the applicant entity and a voting official ( or the City Manager or City Attorney), which relationship includes any of the following:
1) the ownerinvestor and the official have done business together during the year prior to the application;
2) the official has earned income from the ownerrnvestor during the year prior to the filing of the application;
3) the ownerlinvestor has given the official gifts worth fifty dollars ($ 50) or more during the year prior to the filing of the application; or
4) the official might reasonably be anticipatedto gain or lose money or a thing of value, based upon the ownerrnvestors interest in the applicant entity, in relation to the application' s outcome.

When Must I File?
You must file this form with the Office of the City Clerk at the same time when you file your application for a City approval determined by a vote of City officials, whether elected or appointed.

What Must I Disclose?
A. The names of all natural persons who are officers, directors, members, managers, 28 k 0
trustees, and other fiduciaries serving trusts or other types of organizations attorneys, accountants, etc.).

Note: ( 1) only trusts or other organizations that are not the fiduciaries, ( 2) if a second entity that is not a natural person serves the applicant entity( e.g., as a member of an applicant LLQ, then all officers, directors, members, managers, trustees, etc., of the second entity must be disclosed).

B. The names of persons owning an interest with a value of two thousand dollars ($ 2, 000) or more who have a material financial relationship with an elected or appointed City official who will vote on the applicant's application, or with the City Manager or City Attorney.

What if 1 Have Questions?

PENALTIES
Falsification of information or failure to report information required to be reported may subject you to administrative action by the City.

There are some additional supplementary instructions with an example following the form should you need further clarification.

Youonly need to rill out and return the next 2 gapes of this Attachment with your proposal
29 Q
du" S

PUBLIC INTEGRITY DISCLOSURE

APPLICANT DISCLOSURE FORM
UFo0.NP'

1. Name of Entity

2. Address of Entity( Principle Place of Business)

3. Local or California Address( if different than# 2)

4. State where Entity is Registered with Secretary of State If other than California, is the Entity also registered in California? Yes No

5. Type of Entity
Corporation Limited Liability Company Partnership Trust Other( please specify)

6. Officers, Directors, Members, Managers, Trustees, Other Fiduciaries ( please specify) Note: ff any response Is not a natural person, please identify aff officers, directors, members,. managers and other fiduciaries for the member, manager, trust or other entity
Officer Director Member Manager
name]
General Partner Limited Partner
Other
Officer Director Member Manager
name]
General Partner Limited Partner
Other
Officer Director Member Manager
name]
General Partner Limited Partner
Other
30 v
0 7. Owners/ Investors with a 5% beneficial interest in the Applicant Entity ora related entity

EXAMPLE
JANE DOE 50% ABC COMPANY, Inc.
name of owner/ investor] percentage of beneficial interest in entity and name of entit
A.
name of owner/ investor] percentage of beneficial interest in entity and name of entity]
B.
name of owner/ investor] percentage of beneficial interest in entity and name of entity]
C.
name of ownerlinvestor] percentage of beneficial Interest in entity and name of entity]
D.
name of owner/ investor] percentage of beneficial interest in entity and name of entity]
E.
name of owner/ investor] percentage of beneficial interest in entity and name of entity]

I DECLARE UNDER PENALTY OF PERJURY UNDER THE LAWS OF THE STATE OF
CALIFORNIA THAT THE FOREGOING IS TRUE AND CORRECT.

Signature of Disclosing Party, Printed Name, Title Date 31 0
City of Palm Springs, CA.

Business Disclosure Supplementary Instructions
In an effort to ensure we capture the required business entity information in accordance with the attached instructions, we provide you these supplementary instructions to clearly identify the required information, and the format the information should be provided.

If you, as the applicant, are a business entity ( i.e. a corporation or limited liability company), and it is also comprised of other business entities as its members or having a financial interest, all other such business entities must also be disclosed, including those entities other business entities, if any.

Ultimately, the City' s disclosure document ( attached) requires a listing identifying all natural persons having any financial interest over 5% of the business entities (and any other business entities comprising your business entity).

As an example, Applicant is: Acme Brothers, Inc., a California corporation, whose officers are:

John Doe, Jill Doe, and Jay Doe, which is owned 50% by Acme Brothers, LLC, a California limited liability company, and John Doe ( 25% interest) and Jill Doe ( 25% interest). Acme Brothers, LLC, is managed by Acme Brothers 2, Inc., a California corporation, whose officers are: George Doe, Bill Doe, and Jane Doe, which is owned 100% by Acme Brothers 2, LLC, a California limited liability company, which is managed by George Doe, with George Doe and .

Jane Doe having 50% interest each.

The full business entity disclosure in this example would resemble the following:

1. Acme Brothers, Inc., a California corporation
a. Officers: John Doe, Jill Doe, and Jay Doe
b. Ownership:
i. 50% Acme Brothers, LLC, a California limited liability company ii. 25% John Doe
iii. 25% Jill Doe

2. Acme Brothers, LLC, a California limited liability company a. Managers: Acme Brothers 2, Inc., a California corporation b. Ownership: 100% Acme Brothers 2, Inc., a California corporation

3. Acme Brothers 2, Inc., a California corporation
a. Officers: George Doe, Bill Doe, and Jane Doe
b. Ownership: 100% Acme Brothers 2, LLC, a California limited liability company

4. Acme Brothers 2, LLC, a California limited liability company a. Managers: George Doe
b. Ownership:

L 50%
End of Attachment" E"'
32 ATTACHMENT" F"
For Reference Only

CURRENT PARKING EQUIPMENT DETAILS
There are currently two safes is the office/ exit booths, that will remain. There are eight ( 8) existingcameraswiththeDVRrecorder. Anyadditionalcamerasorrecordingequipmentwould bethe responsibilityof the contractor.

At the main parking lot there are 6 entry gate locationsand 3 exit locations. At the remote parking lot there is 1 entry I gate and 1 exit gate. Below is the list of equipment on site:
a2079 Imagfl491.pnp
Ap
mo{
Parkirlg.La>c
OI
Sv* e Pack C ( 03/ 16117)
Facfty PatinSpringsA# ort( 1751049)
System 0evke SERVER( 1751049- 01)
a
Ttb cwwer prcgamisprotededbycVydgh• Anywised use,
hbAkn, reprpwctionm transSdionestates 5abu'ty for advdactionand mayOveraiseto aimnaiprosemtm.
fy
r
33 0
r
10 5/ 201 SR0005431 24SVSC V DVD LOCK60K 21R21X8 1
S/ 10/ 2016 SRC005431 945824642 WSERVEMARKING. LOGIUSOINersion2 1 511 16 SP0005431 945803002 LVP' s for Additional Devices 146 5/ 10/ 2016 SPM05431 945803194 SW- EPI License 10
31212016 SADM431 Oe71000. 82EA License. 5 antes Endpoint, 3 r, 1- 24 5 S126/ 2016 SACUS431 SR2SU0 Tripp Lite 24U Rack Server Cabinet 1 5/ 26/ 2016 SR0005431 SMARTIOOORM2U Smart UPS 1000va, Rack Mount 1 5/ 26
D
16 SAD005431A B4U36AT Memory, HP, 4 GB, DIMM 2 in DOR3 18 S/ 2612016 SROOM31 K6Q79UA4ABA HP RPS910" 570S SOCGB 4G8 W' 8P 3 5 6 SRD016 005431 K6Q79UA. 7ABA HP RP58206. 4570S 500684GB W' 8P 2 S/ 26/ 2016 SRDOOS431 OKS54AT Hard Drive HP SOO GB S1TA- 600 5 016 SA000543 FQC48289 MS OEM WInPto7 SPl x64 ENG 1 k 4
5/ 26/ 2016 SR0005431 P73- 06451 Microsoft Server 2008 R2 Std wjSPi I 61W036 SR0005431 901- 7731- Ml 2nnetlex 7731 Ruckus SridPe slnRle unit 6 6/ 2/ 2016 SR0005431 SR25UB TrippUte 24U Rack Server Cabinet 1 6/ 7/ 2M6 SRDOG5431 SRWISU5 Rack Enclosure, Wall Mint. wl00or 6 Sides I 6 8 16 SRCODS431 6C22FS- CPAR- GY• 9 Cable, 22a 6UNPt/ Sh?eided Belden 2, 000. D0 6/ B/ 2D16 SR0005431 4C28FS- CMft;qY-2 Cable. Belden 18aw 4LMPL/ 5hielded 2. 000, 00 2016 SROODS431 V196WLB MONITOR ACER 19" WIDE 2
6/ 8/ 2016 SRC005431 PSTRIP Power Strip. 6- Outlet 1
6 6 SR0005431 SE- 041` 24- 81( 41'- E5S Cat Se Ethernet cable- Outdoor 10,= D 6/ 13/ 2016 SRWW431 Ce7ICzFO- E11EALicense, Syrnantec Endpoint, l r, 1- 24 1 611412016 SRCD05431 102 MS Cash Drawer- Skidata 1
6/ 14/ 2016 SR0005431 1326LGWV Card, HID Proxcard II 5td 100 6/ 14/ 2016 SRD005431 25369758 Heayy Outy Rolling Caster Kit 41 1 6/ 14/ 2016 SR0005431 6065BGBCO Reader, HID ProrPoint Pius, Gray 4 EitI412016 SR0005431 93WI220 Ucerue, S012014 SRV• CAL 2 6/ 24/ 2016 SROWS431 9421M10 Cable for Cash Drawer 1
5/ 1 2016 SRD005431 945010456 Power Gate lock Keyed the same 10 4 16 SR006543 1 945021020LCO cult clip 246 charw/ LED backke 1 6/ 14/ 2016 SP4005431 945100083 SD582w Powers ply
I 6/ 14/ 20161SROWS431946000118Basic Unit Easy. CashV. 3 1 6/ 24/ 2016 SROD0543194601=0 Coder UnlimitedBase Unit 4 6114 O26 SRWA31 945010052 Feeder*for Coder Unlimited
4 6/ 14/ 2016 SFMM31 946010052Coder Basic urdt w/ Ther. Pmtr 7 6/ 24/ 2016 SR0005431 946010056Feederfor Coder Basic 1 7 6/ 14IM16 SRD005431 S46010201 Banknote Reader wlstack,F2. Cash I 6J1412016 SR0005431 946MO324 HoDpersetfor US
1 6/ 14/ 2016 SROOOS431 946020510 Crosswise Barcade Reader 15 W14/ 2016 SRM05432 9460205261x2 TrackISO Mae- Stripe Reader 5 6 14/ 2016 5RM05432 946020709Base, ADA, E . Cash POF 1 6/ 14/ W16 SR0005431 946100000Desktop Coder Unlimited 1 6A412016 SROD05431 M620OD20Power,Gate- ENTRY
7 6/ 14/ 2016 SR0005431 946200100Power. Gate- EXIT
3 iinqM16 SRODO% 31 946200324Power Gate Intercom analog 10 6/ 24/ 2016 SF0005431 946200334Power. Gate Interface extension Large 10 4654 16 SR003- 946200400Power. GattiUte GraphicDisplay 7` 7 6/ 14/ 2016 SRODOWS43946200412Power. Qte- Can hic Displaywith touch 3 I6 SR0005431 946200442Power ate centaur sUi illuminated 30 14 016 SR000S43 9462004801Power.Gate User Interface Illuminated 10 0
14 21116 SR0005431 9465= 0 Saofer. Gate Basic Unh US 11 6/ 14/ 2016 SROOVA31 946500412 Barrier. Gate AC. Loop Detector 11 14 6 SROODS431 946SOD424 Barr( er. Gate fable Loop Detector 11 14/ 2016 SRM% 431 946521012 Arm. Bamler. Gate Yellow LED 9. 84 11 6/ 24/ 2016 SR0005431 ACK- SOlOUS Keyboard, Mint w/ mlterball. 81. 1 id I6 SROODSUI 823SODN Printer, Dell 236ODN Network Laser 1 6/ 14/ 2036 SROODS431 BKSOO APC BACK- UPS SOOVA 1
6/ 1412016 SR0005431 E06. 2WA- M- ST- T Swkcb, 4 ortttO/ 1008aseT . Unmanag 5 6/ 14/ 20161SR00054313 EE417G Master Station w d a . Gray 1 611II 16 5ROWS43 - EM- 3115F512T Fan- Lock Box 2
6/ 14/ 2016 SHOWS43 ET901- A IP- Box Ind. network switch 7 6/ 14/ 2016 SROOOWI ET- 901- HSH35 Din Rail Fastner for ET901 7 6 16 2016 SR000543 G3- GETd0 Subscriber Card, 4- wire GE300 3 6114 016 SRG00543 G3TEL GE300 Tele hone interface 1
6 4 2016 5 S431 GCS1732 IOGEAR 2PORT USB KV1, 1 1
6/ 14/ 2016 SR0005431 L3- GET- 4P Upgmde G3- GET49. to G3- GET- 4P 1 6114 2016 SR0005431 GE300CA Compact IP- Intercom Server 1 6/ 14/ 2016 SR0005431 MS- ST121A 12VOC LAMP Power Supply 7 6/ 14 16 5R000543 RISER- COVER- COLU Riser Base Set- Power. Gate 2015 SO 611412016 SR0005431 RISER- COVER- GATE Riser Base Set- Barrier. Gate. 2015 11 4 016 SRD005431 RS- 1215- RA Tr1FpLite POWerS RadrmOunt 1 6/ 14/ 2016 SROW5431 SENTROWCLEANKIT Sentrys460 Cleaning Kit 1 6/ 24 016 SADDO543 SG300- 28PP- K% HA Cisco 28Port G! PO& Managed 1 6114 16 SROWS431 SL82 VCR Lockbox 1
6/ 14/ 2016 SROWS431 SRW208- K9- NA Sm Bus SF300- N SW 8 ports, Man, Dktoo S 6/ 14/ 2016 SROM431 TOOLKIT460 Tool Kit for Coder 460 1 61141= 6 SR0005431 UPA- 102 Pourer Supply, Commend Extemal ET- 901 7 16 SROOM43 CBL- POWEKT Cable, AC Pourer Cord 3
6/ 16 16 SRODDS431 ELK- 924 1.2124 lamp Relays 1
6/ 16P016 SRDD0543 NAGELS- TK460 NAGELS Thermal Tickets 460 9 6/ 21/ 2016 SPODDS431 WK UNMANAGED KIT Web Hosting Softwe- UNMANAGED 1 2 6 SROD05431 681000 Connection Board S0681 1
212016 SR000343L 1D087- 007 EMV Mount Plate, Power. Gate Terminal Only 3 6/ 22/ 2016 SPOCOW1 945010468 WebKey lFrent.Door) Easy/Credit/ Power 1 6 3/ 2026 SROOOS431 945803WI LVP' s for Additional Devices 30 6/ 24/ 2016 SROOGS431 QK554AT Hard Orive, HP 500 G9,. SATA- 6W 2 6/ 24/ 2016 SADOO643 SRW2W8P- K9- NA Cisco Managed Sw, 8 pOrt7WmtM2G SFP I 6/ 28120L6 SR0005431 CtS- ASA5505- BUN- K9 Cisco ASA 550510 user Bundle 1 7/ 5 16 SROOGS431 54UM429 SOS"- SO8491SD8661en h: 60 crn Pwr W05 1 7/ 5/ 2016 SRW05431 R- 946010066 Feeder for Basic 1
7181M6 SR0005431 SRW2008P- K9. HA Cisco MamaRedSW, B port, 10omb42G( SFP 1 7/ 11/ 2016 SR0005431 94601= 0 Coder Unlimited Base Unit 1 71111201 SROCOS431 94MI0510 Crosswise 8arcode Reader i
7 11/ 2016 SRODOS431 - 946010526 lx2 Truk ISO Ma - Stripe Reader 1 7/ 11/ 2016 SR0005431 K6Q79UA1IABA HP RP581015AS705 S00G04GB W8P 3 7AV20161SRWO5431 84 136AT Memory. HP, 4 GB, DIMM 24D- in, OOR3 I 9 7/ 11/ 2016 SFXOS432 QK554AT Hard Drive. HP 500 GB SATA- 6W 4 7 15 16 SR0005431 946010066 Feeder for Coder Basic 1 1
7/ 19/ 2016 SR= 5431 L34P- 0P Ucense 8 subscribers. Feature Level P 1 7 19 16 P5ubsSROD05431 W- W-4B G31criber Board 1
7/ 21/ 2016 SR000543121 K6479UA4ABA HP RPS830 L5- 4570S SWG8 4GB WSP 1 35 7/ 21/ 2016 SROODS43U K6079UADABA HP RPS8301549M SOOGS 4G8 W BP 1 7121IM6 SR00D5431 K6079UAMADA HP RPS810 1545705 50DG84GS WBP 1 7/ 21/ 2016 SROOOS431 84U36AT Memory, HP, 468, DIMM 2 in, DDR3 9 7/ 21POIG SR000543 QK554AT Hard Drive, HP SOO GO, SATA- 6W 3 4 616 SR0005431 9465OM20 earder. Gate Basic Unit US 2
9/ 2016 SRDOG543 G3- IP48 63 IP Subscriber Board I
30 15 SROWS4312 SCR2WE- RM- M4 Payment Express Unattended CC Tetminal 4 6/ 10 2D16 SRC0054311 UPT2W- L Payment Express UPT Converter 4 6 3 16 56000543 IPP350 Pa . e2 Ex ress Deskto Terminal, Pin d 1 9 16 SR0005431 AF- SCR P ent Express Activation Fee- SCR 4 9/ 3/ 20155R= 543 AF- IPP Payment Upress Activation Fee- IPP I 10115/ 201d SPMOS431 546WOM Front Panel POH Power Gate 1 10/ 15/ 201 SRW0543 901• P30D- USOI Ruckus ZaneFlec P300 Brfd e- Gl E 2 10/ 1512010SR0005431 946020074 CO Unlimited RFIDJSD805. 1 1 15/ 203 SRM05431 946DID526 Sr2 Track KO Ma - Stri a Reader 1 10/ 17 1 SRWW411 ELK-92412124 lam Re 1
1 17/ I01 SR0005431 546521135 Sheer Batt. Skidata Barrier. Gate 20 17 201 SROOOS431ASENTRY460CLEANKFT Senrtrys 460 Cleaning Kit 1 10 17/ 203 SR0005431 IOD37. 007 EMV Mount Pfate, Power. Gate Terminal Only 1 1 17 201 SROU05431A SRW2008• KS•NA Clam SG300- 1010 Port. GO Managed Switch 1 1D/ 17/ 201 IRMS431 946200823 Power. Gate Coolirt t- RETRO 2 1OJ17/ 201 SItW0543 L3- IP- BB Upgrade G3- IP4B to G3- IP48 1 10/ 171WIJSRW05431 64U36AT Mennery, HP, 4 GB, DIMM 240. in DDR3 3 10/ 37/ 201 5RCW 5431 W54AT Hard Drtve, HP 500 GB, SATA- 600 10 17/ 201 SRM0543I 902- 0162- USW Ruckus PoE Ada ter- PoE Injector 2 1 2S/ 203 SR= 5431 10347. 001 Ticket Bin 1
10 25/ 201 SR00D543 946500020 Barrier. Gate Basic Unit US 2 10/ 251201 SRWOSQIA 946500424 Barrier. Gate Cable Loop Detector 2 lIV25/ 2010SRM05431 9465CO412 ACBarder Gate OFT 2
10 / 201 SRW05431 GCS1732 IOGEAR 2PORT USB KVM I
lOY35/ 207 SR0005431 RS• 1215• RA Trip Ute PowerStrip Rackmcunt 1 10 7/ ZOl SR0005431 EDS20WA- ST- T Switch4 orts10/ 10 weT , Unmans 5 II/ 2/ 2016 SROW5431 EM- 3115f512T Fan- Lock Box 2
11/ 9 6 SWOOS43 RISER- COVER- GATE Riwr ease Set- Barrler. Gate, 2015 2 11/ 21120161SRCOUS431 9460100SO Coder Unlimited Base Unit 1 11/ 21/ 201 SROWS431 - 946010526 Ix2 Track LSO MaR- Stripe Reader 1 11/ 21/ 20161SMW5431Z 946010510 Crosswise Barcode Header 1 10/ 17/ 201 SR000543 V296WLS MON ACER 19" WIDE I
9/ 14/ 20161SRMS4314 Oe7lOcFD. EISEA License, Symantec Endpoint. I r, 1. 241 1 9/ I6/ 2016 5RCW5431 - 04SE03194 SW- EPI/ License 1 9 24 6 5ROW5431A AFJPP Payment bcpmsActivatinn Fee- IPP 1 JZOIE
03 5R000S43 102 M5 Cash Drawer- Skidata i
01 SRCW5431 942IMBID Cable For Cash Drawer 1
03 5RC005431 945021020 LCD cult disp 2x16 char w/ LED backlitc 1 0 SRWOS43 946010510 Crosswise Bareede Reader 1
01 SR0005431 9461000W Desktop Coder Unlimited 1
0 SROGGS43 U4U36AT Me , HP, 4 G8, DIMM 240- in
DDR301SROD05431 IPP350 P ment ress Deskto Terminal, Phi d 1 02 SR0005411 K6Q79UA4A9A HP RPSSIO IS4570S SOWS 4GB WSP I 1 SROOOWI M54AT Hard Orfve, HP SW GB SATA- EW 1
201 SR0005431 FCLC-09S25 Dip U g 5 Lang Win Pro 10 NI L1 a
6 SROOW 131 945603OD2 ILVP's for Additional Devices B
11/ Z/ 2016 W= 0543 U554AT Hard D Ne, HP 500 GB, SATA- 600 I 1 6 SRW0543 B4U36AT W . HP, 4 GB, DIMM2 P, DOR3 3
1 6 SRWOSW KGQ79UA8ASA HPRPS83015d570550pG64GB yV8P 1
36 0
ATTACHMENT" G"
For Reference Only

AIRPORT PARKING
5 YEAR MONTHLY PARKING REVENUE AND ENPLANED PASSENGERS

HISTORY
Month/ Year Gross Revenue Enplaned Passengers
January 2015 246, 051 103, 394
February 2015 270, 542 118, 122
March 2015 300, 342 148, 128
April 2015 257, 482 120, 831
May 2015 248, 581 74, 278
June 2015 181, 564 37, 533
July 2015 181, 416 32, 867
August 2015 209, 011 34, 809
September 2015 186, 137 38, 724
October 2015 213, 399 63, 108
November 2015 273, 220 87, 827
December 2015 310, 181 85, 004
Total 2, 877, 926 944, 625
Month/ Year Gross Revenue Enplaned Passengers
January 2016 274, 572 101, 034
February 2016 295, 364 125, 244
March 2016 330, 141 151, 460
April 2016 285, 200 122, 083
May 2016 257, 387 75, 765
June 2016 193, 010 41, 533
July 2016 201, 701 37, 234
August 2016 205, 693 38, 463
September 2016 183, 610 43, 369
October 2016 209, 190 71, 168
November 2016 255, 073 101, 464
December 2016 289, 796 93, 154
Total 2, 776, 007 1, 001, 971
37 Month/ Year Gross Revenue Enplaned Passengers
January 2017 259, 188 109, 149
February 2017 254, 306 123, 926
March 2017 268, 186 157, 808
April 2017 235, 968 131. 143
May 2017 211, 077 77, 075
June 2017 188, 538 44, 845
July 2017 219, 297 38, 007
August 2017 228, 897 37, 865
September 2017 218, 203 45, 254
October 2017 268, 862 75, 698
November 2017 324, 543 109, 740
December 2017 358, 923 104, 256
Total 3, 359, 588 1, 054, 766
MonthNear Gross Revenue Enplaned Passengers
January 2018 327, 798 117, 179
February 2018 314, 988 132, 238
March 2018 343, 622 170, 949
April 2018 307, 766 144, 608
May 2018 289. 006 88, 714
June 2018 235, 400 48, 620
July 2018 224, 581 45, 758
August 2018 235, 721 41, 838
September 2018 224, 248 50, 586
October 2018 253, 087 79, 568
November 2018 336, 922 122, 254
December 2018 370, 732 121, 995
Total 3, 781, 347 1, 164, 307
Month/ Year Gross Revenue Enplaned Passengers
January 2019 388, 297 140,696
February 2019 388, 059 156, 486
March 2019 420, 613 201, 350
April 2019 381, 065 160, 462
May 2019 314, 163 99, 027
June. 2019 243, 859 55, 385
Total 2, 136, 056 813, 596
38 0
ATTACHMENT " H"
For Reference Only

SEASONAL AIRLINE FLIGHT ACTIVITY
see next 4 pages
39 a
AIR CANADA NON STOP FLIGHTS FROM PSP TO ALL DESTINATIONS- DECEMBER 2019

AIRUNE DESTINATION DEPFROMPSP I ARV AT OEST FUGHTSPERWEEK JPERMCWH AC Vancouver, BC, CA 1330 1628
AC Vancouver. BC, CA 1345 1643 7
AC Vancouver, BC. CA 1410 1708
AC Toronto, ON, CA 1150 1907 3
1- + rn-. 10
ALASKA AIRLINES NON STOP FLIGHTS FROM PSP TO ALL DESTINATIONS- DECEMBER 2019

AIRLINE DESTINATION DEP FROM PSP ARV AT DEST FLIGHTS PER WEEK AS San Francisco, CA US 0620 0750 7
AS Seattle, WA, US 0640 0938 7
AS San Francisco, CA. US 0940 1110 3
AS Portland. OR. US 1110 1340 7
AS San Francisco. CA. US 1210 1340 7
AS Seattle. WA, US 1345 1643 7
AS San Francisco, CA, US 1505 1636 7
AS Everett, WA US 1616 1905 7
AS San Francisco. CA, US 1720 1850 2
AS Seattle. WA US 1735 2030 6
AS Portland, OR, US 1900 2130 7
AS Seattle, WA. US 1930 2225 7
AS San Francisco. CA, US 2020 2160 7
61 ALLEGIANT' AIRLINES NON STOP, FLIGHTS FROM PSP TO ALL DESTINATIONS- DECEMBER 2019

AIRLINE DESTINATION DEPFROMPSP ARV AT DEST FLIGHTS PER WEEK PER MONTH G4 Bellingham, WA US 112G 1414 4
G4 Bellingham. WA. US 1124 1416 1
G4 Bellingham. WA US 1151 1447 4
G4 Bellingham. WA US 1260 1544 1
G4 Bellingham, WA US 1804 2056 1
F * Y' r
40 a
Q
AMERICANAIRLINESNONSTOPFLIGHTSFROMPSPTOALLDESTINATIONS-DECEMBER2019 - - AIRLINE DESTINATION DEPFROMPSP ARV AT DEST FLIGHTSPERWEEK PERMONTH.

AA Dallas/ Fort Worth, TX. US 0610 1056 1AA Dallas/ Fort Worth, TX, US 0634 1123 F 7 AA Dallas/ Fort Worth, TX. US 0634 1124 J
AA Phoenix, AZ, US 0645 0856 7
AA Phoenix, AZ, US 0930 1137
AA Phoenix, AZ. US 0936 j142 7
AA Phoenix, AZ, US 1009 1214
AA Dallas/ Fort Worth, TX, US 1055 1544 7
AA Phoenix, AZ, US 1153 1403
AA Phoenix. AZ, US 1155 1401 7
AA Phoenix. AZ, US 1200 1408
AA Chicago- O' Hare, L. US 1313 1911 1AA Chicago- O' Hare, L. US 1319 1916 F 7 AA Chicago- 0' Hare, L. US 1333 1931 J
AA Dallas/ Fort Worth, TX, US 1431 1920 7
AA Phoenix AZ. US 1507 1711
AA Phoenix AZ, US 1509 1718 7
AA Phoenix, AZ, US 1510 1717
AA Chicago- 01Hare, IL, US 1630 2124 5
AA Dallas/ Fort Worth, TX, US 1835 2322 1
AA Phoenix, AZ, US 1840 2050 3
AA Dallas/ Fort Worth, TX. US 1900 2347 1
AA Phoenix AZ, US 1953 2204 7
CONTOURAIRLINESNON STOPFLIGHTSFROM PSPTO ALL DESTINATIONS-DECEMBER2019

AIRLINE DESTINATION DEP FROM PSP ARVATDEST I FLIGHTSPERWEEK PERMOMH LF Sacramento. CA, US 1300 1430 7
DELTAAIRLINES NONSTOP FLIGHTSFROMPSPTO ALLDESTINATIONS- DECEMBER2019 .

AIRLINE DESTINATION DEP FROM PSP ARVATDEST FUGHTSPERWEEK PERMONTH DL Salt Lake City, UT, US 0600 0847 7
DL Seattle, WA. US 1104 1404 7
DL Salt Lake City. UT, US 1115 1411 3
DL Salt Lake City. UT, US 1222 1518 6
DL Atlanta, GA, US 1224 1919 8
DL Salt Lake City, UT, US 1230 1621
DL Salt Lake City, UT, US 1300 1557 7
DL Salt Lake City, UT. US 1330 1626
OL Minneapciis/ St. Paul, MN. US 1402 1928 7
DL Salt Lake City, UT, US 1625 1921
DL Salt Lake City, UT, US 1628 1922 6
DL Salt Lake City, UT, US 1648 1939
DL Seattle. WA US 1840 2144 7
43 15
41 FRONTIER AIRLINES NONSTOP FLIGHTS FROM PSP TO ALL DESTINATIONS- DECEMBER 2019

AIRUNE DESTINATION DEPFROMPSP ARV AT DEST FLIGHTS PER WEEK PER MONTH F9 Denver, CO, US 1919 2233
F9 Denver, CO, US 1924 2231 3
F9 Denver, CO, US 1951 2258
x
3 JETBLUE AIRLINES NONSTOP FLIGHTS FROM PSP TO ALL DESTINATIONS- DECEMBER 2019

AIRUNE DESTINATION - DEP FROM PSP I ARV AT DEST FLIGHTS PER WEEK PER MONTH B6 New York- JFK NY, US 1400 2200
B6 New York- JFK NY. US 2119 0512
B6 _ New York- JFK, NY, US 2157 0550 7
B6 New York- JFK, NY, US 2159 0552
B6 New York- JFK. NY. US 2254 0647
SUN COUNTRY- AIRLINES NON STOP FLIGHTS FROM PSP TO ALL DESTINATIONS- DECEMBER 2019

AIRLINE DESTINATION DEP FROM PSP ARV AT DEST FUGHTS PER WEEK PER MOUTH SY Minneapoll9St. Paul, MN, US 0930 1443
BY Minneapolis/ St. Paul, MN, US 1010 1623
SY Minneapolis/ St. Paul, MN, US 1755 23D8
SY Minneapolis/ St. Paul. MN, US 1815 2324
SY Minnespolis/ St. Paul, MN, US 1825 2334 4
SY Minneapolis/ St. Paul, MN. US 1835 2344
BY Minneepolls/ St. Paul, MN, US 1835 2348
SY Minneapolis/ St. Paul, MN, US 1840 2353
SY Minneapolis/ 51. Paul. MN, US 1845 2354
SY Minneapolis/ St. Paul, MN, US 1850 2359
SY San Francisco, CA, US 1735 1915
SY San. Francisco, CA, US 1745 1925 4
SY San Francisco, CA, US 1930 2110
4 4
WESTJETAIRUNES NONSTOP FLIGHTS FROM PSP TO ALL DESTINATIONS- DECEMBER 2019 -

AIRUNE DESTINATION DEP FROM PSP ARV AT DEST FUGHTSPER WEEK PER MONTH WS Vancouver, BC, CA 0830 1130 1
WS, Calgary. AB, CA 0900 1305 7
WS Winnipeg, MB, CA 1035 1600 1
WS Edmonton, AB, CA 1055 1521 6
WS Calgary, AB, CA 1305 1713 6
WS Vancouver. BC, CA 1310 1614 7
WS Vancouver, BC, CA 1610 1914 7
WE Calgary, AB, CA 1730 2138 7
WS Edmonton, AB. CA HIM 0001 1
43 42
4 UNITED AIRLINES NON STOP FLIGHTS FROM PSP TO ALL DESTINATIONS- DECEMBER 2019 AIRLINE DESTINANON DEP FROM PSP . ARV AT DEST FUGHTSPLRWEEK PER MOMM UA Houston- Interco linentel, TX, US 0030 0535 3
UA Houston- lnlemmoental, TX, US 0059 0609
UA Houston- Intercontinental. TX US 0600 1104 7
UA San Francisco, CA. US 0615 0800 7
UA Denver, CO. US 0645 0958 7
UA Los Angeles, CA. US 0728 0633
7 UA Los Angeles, CA US MIS 0924
UA San Francisco; CA. US 0730 0914
UA San Francisco, CA, US 0745 0929
7 UA San Francisco, CA, US 0800 0944
UA San Francisco. CA, US 0808 0955
UA San Francisco, CA, US 0903 1045 1
UA San Francisco, CA, US 0950 1132 6
UA San Francisco, CA, US 1011 1200 1
UA San Francisco, CA. US 1021 1208
UA San Francisco, CA, US 1049 1228
UA San Francisco, CA, US 1049 1230 7
UA San. Francisco, CA. US 1054 1233
UA Sam Francisco, CA, US 1059 1238
UA Chicago- 0' Hare. IL, US 1100 1659 - 1 4
UA Chicago- O' Hare, IL, US 1115 1704
UA Denver, CO, US 1140 1443
7 UA Denver, CO, US 1145 1454
UA Houston- Inleroo linental, TX, US 1204 1713
7 UA Houston- Interconootal, T4 US 1219 1724
UA San Francisco, CA US 1354 1529
UA San Francisco, CA, US 1410 1551
7 UA San Francisco, CA. US 1411 1552
UA San Francisco, CA, US 1418 1563
UA Chicago- O' Hare, IL. US 1423 2010 6
UA San Fancisco, CA, US 1437 1612 1
UA Denver, CO, US 1610 1924 7
UA Denver. CO, US 1621 1940
UA San Francisco, CA, US 1743 1932
11 UA San Francisco, CA US 1744 1931
UA Denver, CO. US 1750 2058 5
UA San Francisco, CA, US 1801 1950 2
UA Denver, CO, US 1805 2119 2
UA San Frncsco, CA. US 1846 2021
UA San Francisco, CA, US 1850 2025
UA San Francisco, CA, US 1904 2043 7
UA San Francisco, CA, US 1907 2054
UA San Francisco, CA, US 1916 2051
UA Denver, CO, US 2009 2317 1
UA NewarR, NJ, US 2347 0729 l 13
UA Newark, NJ. US 2369 0741 J
43 k
0 y. ii
ATTACHMENT ' S"
MinimumHoursRequiredfor coverageof the following Service PARKING PERSONNEL SCHEDULE - to include Management
W NpAAAI : aa a aaa ; g=
s " 2 „
s -- - - - - "^
9x x' ftRRARce -
a ° a a 9 ° a a ° - & 9 m 2 z4 s - " a a s a s _ s
i
8 ° s a °
6 9 ° sass ass ° va ° x ° asas j a
a sagas ° as seas fla gas eaa i eaa e as
s ° MMM as sass
ssa ° aaa ° e5V
9599 _ a H5999999 as a9 _ _
393 39ya 897 _ 7
99 _ 3 7 7 7
93Y S -
p _ 77_ _ . 1 -
995 _ S9 ' _ 59999 89999595 ' _ _ _ . 99 H99S 99 ^ A ' SY 7 W
S '
n y9993S9 8953339 y95 y « «
S9 9y '
49s3 993
AY , 7, 759
8Y553Y99 '
A9595995 9993999 .,
99397 R-
e _ _ _
Y- - _ _ flyY79999
7 ., y
a
p
S « s X - 9y5935Y
tl...
99 = . i
tl
3353 7 « y -
99993 _ _
y « « « s
933y99 _ pa959 3 _ _ _
s9y Syy9S « 9a 9959399 ' a9 _ _ _ _ B « « «« 9y - y7 13 9 a _ _ _
MMAMM
R « y «° ySS
9 sn
SX . - .. «« Sy « Y ^ s 3Y39 " 99 '
n -
HS 99 _ 933
759 - a « SyS - tt
Yy9 7 _ _
r9 _ ± 359 '
n ay S « BSS « 7i7
u a99y y955Y ,. 5 _ _ A 9a y29Y3993
9 _ ea
q ., 559 9 ' A55955 8a 088 °
9 yy5 aS _ _ M Z >
9a 9a aaa a3
9yy3 _ _- _ i
a aaaaa a as a5a 59 999 '
3 s99959 A9S9997 M
a8 ° a ° 29
cn
99 . _ 99393 _ _ aaa aaaaa a y99y99y ^
599339 _ aaas a9a « a ° 99 L
yaI
I `° I I '° a a a3 _ _ - gy
gas saes ° gassed gs saaaa ° as sass ° - gaasaaas ° g Ht '4 ? ei` a
44 g
0 ATTACHMENT " J"
For Reference Only

CURRENT AIRPORT PARKING, TEO, AND TAXI STARTER MANAGEMENT EXPENSES City Fiscal Year
Gross Parking Revenue Management Expense
July 2019 306, 837. 00 63, 030. 75
August 2019 294, 426. 00 63, 030. 75
September 2019 274, 522. 01 63, 030. 75 -
October 2019 63, 030. 75 *
November 2019 63, 030. 75
December 2019 63, 030. 75 -
January 2020 63, 030. 75
Total 875, 785. 01 441, 215. 25
City Fiscal Year
Gross Parking Revenue Management Expense
July 2018 224, 581. 00 55, 450. 91
August 2018 235, 721. 00 55, 450. 91
September 2018 224, 248. 00 55, 450. 91
October 2018 253, 087. 00 55, 450. 91
November 2018 336, 922. 04 55, 450. 91
December 2018 370, 732. 00 55, 450. 91
January 2019 388, 297. 00 55, 450. 91
February 2019 388, 059. 02 57, 864. 08
March 2019 420, 613. 00 57, 864. 08
Apol2019 381, 065. 00 57, 864. 08
May 2019 314, 163. 00 57, 864. 08
June 2019 243, 859. 00 57, 864. 08
Total 3, 781, 347. 06 677, 476. 77
45 e
3r
City Fiscal Year
Gross Parking Revenue Management Expense
July 2017 219, 297. 00 55, 206. 83
August 2017 228, 897. 00 55, 206. 83
September 2017 218, 203. 00 55, 206. 83
October 2017 268, 862. 00 55, 206. 83
November 2017 324, 543. 00 55, 206. 83
December 2017 358, 923. 00 55, 206. 83
January 2018 327, 798. 00 55, 206. 83
February 2018 314, 988. 00 55, 450. 92
March 2018 343, 622. 00 55, 450. 92
April 2018 307, 766. 00 55, 450. 92
May 2018 289, 006. 00 55, 450. 92
June 2018 235, 400. 00 55, 450. 92
Total 3, 437, 305. 00 663, 702. 41
City Fiscal Year
Gross Parking Revenue Management Expense
July 2016 201, 701. 01 55, 006. 67
August 2016 205, 692. 90 55, 006. 67
September 2016 209, 352. 24 55, 006. 67
October 2016 209, 190. 35 55, 006. 67
November 2016 255, 073. 00 55, 006. 67
December 2016 309, 781. 93 55, 006. 67
January 2017 259, 188. 00 55, 006. 67
February 2017 254, 306. 00 55, 206. 84
March 2017 268, 185. 75 55, 206. 84
April 2017 235, 968. 00 55, 206. 84
May 2017 211, 077. 00 55, 206. 84
June 2017 188, 538. 00 55, 206. 84
Total 3, 228, 337. 23 661, 080. 89
46 0
City Fiscal Year
Gross Parking Revenue Management Expense
July 2015 181, 416. 00 62, 232. 23
August 2015 209, 010. 97 62, 232. 23
September 2015 186, 137. 00 62, 232. 23
October 2015 213, 399. 00 62, 232. 23
November 2015 273, 219. 99 62, 232. 23
December 2015 310, 180. 70 62, 232. 23
January 2016 274, 672. 35 62, 232. 23
February 2016 295, 364. 00 55, 006. 66
March 2016 330, 141. 00 55, 006. 66
April 2016 285, 200. 00 55, 006. 66
May 2016 257, 387. 00 55, 006. 66
June 2016 193, 010. 00 55, 006. 66
Total 3, 009, 138. 01 710, 658. 91
City Fiscal Year
Gross Parking Revenue Management Expense
July 2014 184, 696. 00 61, 534. 20
August 2014 193, 909. 00 61, 534. 20
September 2014 203, 290. 00 61, 534. 20
October 2014 221, 147. 00 61, 534. 20
November 2014 251, 665. 00 61, 534. 20
December 2014 316, 306. 00 61,534.20
January 2015 246, 051. 00 61, 534. 20
February 2015 270, 542. 00 61, 768. 73
March 2015 300, 342. 00 61, 768. 73
April 2015 257, 482. 00 61, 768. 73
May 2015 246, 581. 00 61, 768. 73
June 2015 181, 564. 00 61, 768. 73
Total 2, 875, 565. 00 739, 583. 05
Estimated management expense
47 0
EXHIBIT " B"
CopyofsuccessfulContractor'sProposalinresponsetotheRFPwillbeinsertedherefollowing award)
75 0
EXHIBIT " C"

AIRPORT CONCESSION DISADVANTAGED BUSINESS

ENTERPRISE ( ACDBE) PROGRAM
In accordance with the Code of Federal Regulations, 49 CFR parts 23, the City will carry out applicable federal requirements in the award and administration of any contract awarded hereunder. The City's current 2018through 2021 goal for non-car rental concessionscontracts is 4. 6%. Non-DBEproposerswhoare unableto achievethatgoalmustsubmitdocumentation of the Good Faith Effort that was usedto include DBEparticipationin their proposalin efforts to achievethe goal. The Concessionoperatorshallnot discriminateon the basisof race, color, nationalorigin, or sex'in the performanceof this contract. DBEswill beaffordedfull opportunity to submit responses to this RFP.

TheContractorshallkeepsuchrecordsasarenecessaryto showcompliancewiththe City's ACDBE Program and, on the request of the City, shall make such records available on a quarterly basis for review by the City.

DBE Firms listedin the proposals, must be certified at the time of submission.

Detailsand questions regardingthe CVCP programs at the Caltranswebsite:
www, dot. ca. gov/ hq/ bep/ find certified. html.
76 EXHIBIT" D"

AIRPORT SITE PLAN
41 i c
al ti '
i rijrt
r
its t i '. 7 7 z P a i+
Overflow Parking
X1 '
ki{
S' lr 7.

Yt'
d M'
k ae^rey3i
t
zNiIt V]
R
From center terminal curbside to the economy lot Is approximately. 6 mile and takes about 1 minute 40 seconds. To get back from the lot to the center terminal curbside is approximately. 4 mile and takes about 1 minute. The whole loop in total takes about 2 minutes 40 seconds fora grand total of approximately 1 mile in distance. If the shuttle makes i trip every 15 minutes over the 20 hours, would equate to about 80 trips. Also take into consideration engine idle time and trips off site for fueling and maintenance.
77 PALWSPRINGSINTERNATIONAL- ATRPORT"'.__._—_--_

PARKING LOT LAYOUT

EQUIPMENT DETAILS ATTACHED
FOR ENTRY GATES 1- 6 AND EXIT
v
EQUIPMENT A- D m
PAY- ON- FOOT TICKET m

MACHINE- STATION D
TEO OFFICE SPACE( 8. 5' X 11. 51 OVERFLOW PARKING LOT c

TERMINAL
E
D o
ENTRYGATES 3 AND 1,
O_
O
S
o p
a
420
r.
aco
CRA
B E7T N I 6 a m
I 3
PARKING LOT CONSISTS OF 956LPARKING SPACES ES
O
S
Rt

EXIT GATES A/ OFFICE,
ENTRY GATES ENTRY GATES I AND B AND C ENTRY GATE m
c

C '
EXHIBIT" E"

FACILITY INVESTMENT
FacilityInvestmentfromRFP, Attachment "C" part2of 3 fromthesuccessfulfirmto be tobe inserted here)
79 EXHIBIT " F"

COMPENSATION

TOTAL MANAGEMENT FEE
from RFP, Attachment " C, part 3 of 3, of the successful company to be inserted here) 80 4ALMS
y
yv,\ q

CITY OF PALM SPRINGS, CA
REQUEST FOR PROPOSALS ( RFP) 06- 20

PARKING MANAGEMENT SERVICES AT PALM SPRINGS INTERNATIONAL

AIRPORT
ADDENDUM NO. 1
ThisAddendumisbeingissuedforthefollowingchangesandinformationalitems:

THE FOLLOWING REVISIONS AND/OR ADDITIONS TO THE RFP DOCUMENT

AND INSTRUCTIONS ARE TO BE INCLUDED AND SHALL TAKE

PRECEDENCE OVER ANYTHING CONTRARY ON THE PREVIOUSLY ISSUED

SPECIFICATIONS AND INSTRUCTIONS AND SHALL BE REFERRED TO HEREINAFTER AS PART OF THE CONTRACT DOCUMENTS.

The City has received the following questions and is hereby providing answers thereto:

Q 1: Whatis the LicensingrequiredbytheCityto operateparking? A 9: Please refer to page 20 of the RFP document, " Business License".

Q 2: Who is the currentArmored Car service company?
A 2: Any decision to use such a service is at the discretion of the parking management firm. The City does not provide this service.

Q 3: Do you have a maintenance agreement for the current PARCS System? Who is the vendor?
What is the yearly cost? Is the cost based on time and material? A 3: Currently held by ACE, the maintenance and expenses of the equipment are the responsibility of the parking management operator. Skidata is the vendor. The fees are handled by the current operator, we do not see a separate charge.

Expenses are part of the total cost.

Q 4: Will the airport authorityreimbursementthe $79,405.00 for the final capital investmentof the PARCS system? What is the repaymentschedulefor the $79,405.00? A 4: No. This will be the responsibility of all proposers to include in the total fee proposal, the amount will not be reimbursed.

Q5: Dothe parkingratesincludesalestaxandparkingtax?
A 5: Yes
Q 6: Has there been any talk about Unions?
A 6: Not to the best of our knowledge.

Q 7: Areyourshuttledriversrequiredto havea CDLlicense?
A 7: Not with the current size of the shuttle van. It is the Contractor' s responsibility to comply with all California Dept. of Transportationregulations while operating their shuttle vehicles.

Q 8: What is the current Motorola LPI hardware used?
A 8: Model # CRD5504000E
Q9: Areyouanticipatinga ParkingGuidanceSystempurchaseinthenext.fewyears? A 9: No.

Q 10: Wouldan emailbe a validform of notificationprocessforequipmentrepairs? Or is a formal letter required?
A 10: We expect the contractor to use whatever means of communications necessarytomakecertainthatairportstaffis awareofequipmentbreakdownsand repair.

Q 11: Pleaseprovidetheschedulefor theMaintenancefortheParkingArea All: Maintenancedetailsarecoordinatedonaprojectbyprojectbasis.

Q 12: Pleaseprovidetheschedulefor theManager, AssistanceMangerandany additional supervisor or lead personnel you have
A 12: Theexperience with the current contractor has been, the Managerworks MondaythroughFriday7:30to4:OOpm:theAssistantworkstheafternoonshiftfrom 3:30 to 11:30pm, with a lead working alternatingschedules. As stated in the RFP page9, itemP, on-sitemanager, "Contractorshallprovideon-sitemanagerforday to day operations".

Q 13: Do you have the schedule for last year's Shuttle service? A 13: See attached.

THE CITY HAS RECEIVED ADDITIONAL QUESTIONS THAT WE ARE WORKING ON AND THEY WILL BE ANSWERED IN THE NEXT ADDENDA.

BY ORDER OF THE CITY OF PALM SPRINGS, CALIFORNIA
Craig L. Gladders, C.P.M.

Procurement & Contracting Manager
DATE: November 20, 2019
ADDENDUM ACKNOWLEDGMENT:

Proposer Firm Name:

Authorized Signature: Date:

Acknowledgment of Receipt of Addendum 1 is required by signing and including the acknowledgment with your submittal, or you may also acknowledge the Addenda on the bottom of Attachment A. Failure to acknowledge this Addendum may result in your submittal being deemed non- responsive.

Q
Lookingat thepastinformationofthepreviousyears,Tuesdaythe26`hwill bethe opening of the Economy lot.

Holiday Lot hours of operation during Thanksgiving week:

Shuttle run times ( outbound travelers)
Tuesday 11/ 26: 8:30am— last arrival
Wednesday 11/ 27: 4: 15am— last arrival
Thursday 11/28: 4:15am— last arrival
Depending on traffic, the main parking lot may close Tuesday, 11/ 26— 11/ 28 due to full occupancy.

Themain parking lot will remainopenfor short term travelerspicking up or dropping off during this holiday period.

Onlythe main entrances(2& 3 by the office)will remain opento better control the flow of traffic through the lot.

Shuttle run times ( Inbound travelers)
Friday, 11/29: 8:30am— lastarrival
Saturday, 11/30: 8:30am— last arrival
Sunday, 12/ 1: 8:30am— last arrival
Monday, 12/ 2: 8:30am— last arrival
Tuesday, 12/ 3: 8:30am— last arrival
Shuttle service may continue as needed.

OF ?AL.k 9
c` Z
iS, FGft P

CITY OF PALM SPRINGS, CA
REQUEST FOR PROPOSALS ( RFP) 06- 20

PARKING MANAGEMENT SERVICES AT PALM SPRINGS INTERNATIONAL

AIRPORT
ADDENDUM NO. 2
This Addendum is being issued for the following changesand informationalitems:

THE.FOLLOWING REVISIONS AND/ OR ADDITIONS TO THE RFP DOCUMENT

AND INSTRUCTIONS ARE TO BE INCLUDED AND SHALL TAKE

PRECEDENCE OVER ANYTHING CONTRARY ON THE PREVIOUSLY ISSUED

SPECIFICATIONS AND INSTRUCTIONS AND SHALL BE REFERRED TO HEREINAFTER AS PART OF THE CONTRACT DOCUMENTS.

The City has received the following questions and is hereby providing answers thereto:

Q 1: PerSection3, #2 on page5 ofthe RFP, doestheCitywantthe operatorto process all credit cards with its own processerand merchant identificationnumbers? If yes, how oftendoesthe Cityexpectthe operatorto sweepthe creditcardrevenueintothe city's bank?
A 1: Yes, with the City Merchant ID number ( to be provided) and merchant identification numbers. Revenue sweep shall be daily, to be scheduled between 2am and 4am'
Q 2: PerSection3, #6, on page5, doesthe operatorhaveto providethe licenseplate inventory system and if so, is it a reimbursable expense or included in the management fee?
A, 2: It is to be included in the management fee.

Q 3: Please provide a two- year history of all employee work hours and wages within the four segments ( parking, shuttle services, traffic enforcement, and taxi control).

A 3: The airport has not retained a two year history of hours, the minimum required hours schedule is provided as Exhibit , A-1" to this Addenda( attached for the current contract period.
0 Q 4: Please provide a two-year historyof all expensesreimbursedto operatorwithin the four service segments (parking, traffic enforcement, taxi starter, and shuttle services) by the Airport/ City.

A 4: All expenses were part of the Management expense, a summary of that expense is included in the RFP as Exhibit " J".

Q 5: Please provide a copy of the existing parking, shuttle, traffic enforcement, and taxi control budgets.

A& The airport does not ask for annual budgets from the operator for this expense.

The total paid to the existing operator is included in the monthly management expense.

Q 6: Per Section 3, #14, on page6 of the RFP, is the new operatorrequiredto provide a shuttle bus and is it reimbursable or a component of the management fee? A 6: The new operator is required to provide a shuttle bus and the cost of the shuttle bus is a component of the management fee.

Q 7: Per Section O on page 9 of the RFP, please clarify who is responsible for maintenance of the PARCS and if the costs for such maintenance are to be included in the managed fee, paid directly by the Airport, or paid by the operator with reimbursement by the Airport.

A 7., The total cost of operation, maintenance and repairs are included in the management expense. The Airport has no additional cost for parts or repairs.

Q 8: Per the section on DBE on page 12 of the RFP and Exhibit C of the draft agreement, please confirm the City's objective for the outsourced services will be 4.6% A 8: Correct. Yes.

Q 9: How will the ACDBE participation be evaluated in the total scoring of the proposals per section 6, page 11 of the RFP?
A 9: All proposals are expected to either achieve the percentage, or provide explicit details and evidence of the " good faith effort" made to achieve the goal. Failure to respond will result in a non-compliant proposal.

Q 10: Recognizing the RFP questions/ clarifications are due on 12/3 and proposals are due oneweek later on 12/10,would PSPconsidermovingthe duedate for proposalsback one week to 12/ 17? The reason being PSP' s answers to the RFP questions will likely be material to the operator' s proposals and previous experience with other airport RFP's has shown that it often takes airports a week or two to answer questions. With the proposal due date of 12/ 10, this may not give operators the appropriate time to reflect PSP's answers in the proposals.

A 10: The due date of the proposals has been extended to Tuesday, December 170, by 3: OOpm Pacific Time.
0 Q 11: Is a budget required to be submitted with the proposal? A 11: No.

Q 12: Will the City accept annually renewable bonds?
A 12: Yes, provided that at no time will a bond expire without being First replaced.

Q 13: Please provide a copy of the Skidata service contract for the past two years and provide a history of preventative and corrective maintenance.

A 13: The airport does not hold the contract.

Q 14: Is the Airport or the current operator paying for the Skidata service contract? A 14: The current operator.

Q 15: If the current operator is paying for the Skidata service contract, is this a reimbursable expense or is it to be included in the management fee? A 15: It is to be included in the management fee.

Q 16: The RFPasks for the proposersto recommendadditionalPARCSequipment. How will the cost of that investment be reimbursed to the Operator? A 16: The current system is fully operational, if there are parts or necessary equipment to operate the existing system, those should be included in the total management fee. If there is additional equipment that would enhance the customer experience or add to efficiency, that additional equipment should be listed separately. The airport will consider that as optional equipment to be considered in addition to the current total management expense.

Q 17: Please provide the year and details of the. last software/ hardware updates to the Skidata system.

A 17. Exhibit " F" of the RFP includes the most current details that the airport has on file. Sentry Control Systems maintains the PSP equipment, however the airport has no other records to.provide.

Q 18: On Attachment J, is the management expense listed on pages 45 thru 47 inclusive of all expenses ( including labor, insurance, ticket stock, phones, radios, profit, etc) for parking operations, shuttle services, Traffic Enforcement, and Taxi Starter? A 18. Yes.

Q 19: Referringto question 18 above, does the managementexpenseinclude reimbursable expenses for capital equipment such as new PARCS, shuttles, or service vehicles?
A 19: The management expense is all inclusive, including capital equipment.

Q 20: Referring to question 18 above, please provide a history of the costs related to shuttle operations.
0 A 20: The airport does not track separate shuttle costs, that expense is included in the total management expense.

Q 21: Regardingthe paymentof the $79,405 required by the successfulproposer, is the purposeof thispaymentto reimbursethe currentoperatorfortheirfundingofthecurrent Skidata PARCS?
A 21: ALL proposers, including the current operator, need to include this cost 79,405) in the proposed management fee for their proposal in response to this RFP. Funds will be used to retire the existing equipment obligation.

Q 22: Does the Proposer' s financials statements and the forms required in the RFP count toward the page total?
A 22: No.

BY ORDER OF THE CITY OF PALM SPRINGS, CALIFORNIA
Craig L. Gladders, C.P.M.

Procurement& Contracting Manager
DATE: November 21, 2019
ADDENDUM ACKNOWLEDGMENT:

Proposer Firm Name:

Authorized Signature: Date:

Acknowledgment of Receiptof Addendum2 is requiredby signing and including the acknowledgment with your submittal, or you may also acknowledge the Addenda on the bottom of Attachment A. Failure to acknowledge this Addendum may result in your submittal being deemed non- responsive. f
s .
r
r
TEO& Tad Starter
Off+ Season June 1•Sept 30( 4 mo)
Sam Gam 7am gem %. JNm Item Ihm JIM 2pm 3pm AM Spm Om 7pm Opera9pm llpm Ilpm 12pm Iam Orfimrl 5.,190
Olfi¢ r2 1:30• SShours mmkinedhnurswithtaal parer
Of0ar3 8. 3.U0
OMmf4 i Iboo= "
Tul Starter Oat mue itHShoun comhinedhwadl3O Mhounweekiy Peak; 4amn„•_. .. Oet l- May3kt i19weeksj
Sam Gam 7am gam gam 1Wm Ilam Ihm 1pm. 7pm 3pm Apm Spm Gem 7pm Bpm 9pm lOpm llpm 12pm lam a Oficerl 5-1:30
Officer 2. 10: 30 M O
Offuer3 9- S.30 X D
officer 3: 30- 1103 i Z Z
Oflu" s 7. 3: 30 C) O
lav kartzr 930- 11: 30 19 Aours 420houas 3aweei D D ftl Z }(
XS
Q7
m D - 4
9 X
rn
m D
fn
n n
v . o
Parkin & Management C C
Annual m Sn
Parking 241ewaperday-rmthange 168Jr.perweek
A 5- 190
8 9•4:30
C 3pm• 1L•30
Manager AOhpunweek
Artie Mga 40huunweek
Naaadumng Off-Season 612a18weekso 9,756
8ouaduriPgSeason 668a34weeks• 24712
Totelmnal 32, 468 bun
t PALMs
V N
c9 rfORNP

CITY OF PALM SPRINGS, CA
REQUEST FOR PROPOSALS ( RFP) 06-20

PARKING MANAGEMENT SERVICES AT PALM SPRINGS INTERNATIONAL

AIRPORT
ADDENDUM NO. 3
ThisAddendumis beingissuedfor the followingchangesand informationalitems:

THE FOLLOWING REVISIONS AND/OR ADDITIONS TO THE RFP DOCUMENT

AND INSTRUCTIONSARE TO BE INCLUDEDAND SHALL TAKE

PRECEDENCE OVER ANYTHING CONTRARY ON THE PREVIOUSLY ISSUED

SPECIFICATIONS AND INSTRUCTIONS AND SHALL BE REFERRED TO HEREINAFTER AS PART OF THE CONTRACT DOCUMENTS.

TheCity has receivedthe following questionsand is herebyproviding answers thereto:

Q 1: RFP Article 3, Scope of Work, Services, Objectives and Specifications, Page 5.

Pleaseadvisehowmanyservicevehicle(s) providedbyor usedbythe incumbentoperator currently.

A 1: The current operator utilizes one golf cart and one shuttle bus.

Q 2: RFP Article 3.2, Scope of Work, Services, Objectives and Specifications, Page 5.

Please advise with what frequency the Airport desires armored car service as this affects the price( e.g., daily, weekly, etc.)
A 2: The current operator has chosen not to utilize an armored car service.

Q 3: Please provide what percent of all revenue collected is paid via cash versus credit cards.

A 3. Current year to date is 83% credit card and 17% cash transactions.

Q 4: RFP Article 15, Scope of Work, Services, Objectives and Specifications, Page 5.

DoestheAirporthaveanimpoundlotwhereimproperlyparkedor abandonedcarsare towedto? Approximatelyhow manycarswere relocatedfromJanuary- October2019? A 4: Cars would be towed into an area in lot and then settled with customer upon departure. Three( 3) abandoned vehicles were towed during that period. 0 Q5: RFPArticle3.5, ScopeofWork, Services, ObjectivesandSpecifications, Page5.

Whoisresponsibletopayforthetowfees(AirportorOperator) requiredtorelocatecars? A5. Anabandonedvehicleisnocharge, othertowfeesaretheresponsibilityofthe Airport Q6: RFPArticle3.6, ScopeofWork, Services, ObjectivesandSpecifications, Page5.

Onaveragefora peakandnon-peakmonth, howmanyovernightvehiclesdoesthe operatorrecordwhileperforminglicenseplateinventory (pleaseprovidequantityandidentifythe peak and non-peakmonth).

A6. Duringpeak(Nov-May) therangeofovernightvehicleswas475-940. Duringtheoff season(June-October) therangeof overnightvehicleswas360-600.

Q7: RFPArticle3.14, ScopeofWork, Services, ObjectivesandSpecifications, Page6, isthereanyage (e.g., howold) ormileage (numberoftotalmilesdrivenperodometer) restrictionsfortheshuttlebustobeusedtotransportpassengerstoandfromtheoverflow lot?
A 7. Thecurrent operator's shuttle bus has 108kmilesandis a 2009FordE nine 9)passengershuttle. Vehiclesmustbein goodoperatingcondition, clean, well maintained, andmeetall mandatoryoperationalsafetycodesandregulationsof the StateofCAforthistypeofvehicle. Thisdemonstratesthattheairportiswillingto allowausedvehicleaslongasit meetstheaboverequirements, asit is ultimately a reflection on the airport to the passenger.

Q 8: RFPFacilityDescription, ReportingRequirementsandEquipment, ParagraphE, FutureParkingFacilities, Page7 - WouldtheCityagreethatif thenumberofparking spaces increases by more than a reasonable amount ( e. g., 10%, then Contractor shall havethe rightto adjustits operatingbudget/managementfeeto coverincreasedcosts liability insurance, etc.)?
A 8. Yes, ThereIsnothingin thecurrentfive-yearcapitalplanfortheexpansionof theexistingparkinglot. However, IFdemandrequiresadditionalparkingbeyond the currentlot's capacity, the airport's plan to addresscapacityneedson a permanentbasis is to use the remoteparking lot on Kirk Douglas. IF this need materializes it likely would be forjust the seasonal months and we recognize that a full-timeshuttle operationwouldberequiredby theoperator, it wouldthenbe the airport' s obligation to amend the current agreement to address the additional costs incurredby theoperatorto fulfill thisobligationasindicatedin theagreementunder Shuttle Service" section Facility Description, Reporting Requirementsand Equipment
Q 9: RFPFacilityDescription, ReportingRequirementsandEquipment, ParagraphO, EquipmentMaintenance, Page9 - pleaseconfirmthattheexistingparkingaccessand revenuecontrolsystemto beusedbythenewContractoriscurrentlyPCIcompliant.

A 9. Yes, it is.

Q 10: RFPArticle7, ProposalContents, Page12 - Giventhe quantityanddetailof informationrequiredto satisfactorilydemonstratetheproposersqualifications, coupled with our desire to concisely discuss operational improvements, will the City consider increasingthe maximumpagerestrictionfrom80 (40 pagesdouble-sided) to 120 (60 pages double sided)?
A 10. No.

Q 11: RFPAttachmentC, Page25. Pleaseconfirmthe Citywill be Merchantof Record for creditcard processingfees.

A 11: Bank of America through the City of Palm Springs.

Q 12: Please provide Attachment I in Excel as the current version is difficult to read.

A 12. Excel document was sent electronically via email with this Addenda#l3 to all tines thatregistered. If you didnot receiveit contactCraigGladders.

Q 13: RFPPage5, first full paragraph, indicatesthe "existingoverflowparkinglot accommodatesapproximatelyeight hundred (800)vehicles." It appearsa portionof that lot has beenrepurposedfor TNCstaging. Page70 AttachmentK, ExhibitA, Facility Description, ReportingRequirementsandEquipmentLetterB PublicOverflowParkingLot states the capacity for one thousand vehicles. Please verify the approximate number of vehicles which can be accommodated in this lot.

A 13. Our apologies for the confusion. Thelot holds approximately 800vehicles.

Q 14: Regardingthe parkingfacilities, pleaseconfirmthe Cityisresponsiblefor all repairs of a structuralnature. Please confirm the City will be responsiblefor restripingof the Overflow lot.

A 14: Yes, the City is responsible for structural repairs, including the restriping of the overflow lot.

Q 15: RFP Page 5, Section 3 Scope of Work, Services, Objectives and Specifications, Bullet number3. Pleaseconfirmthat parkingoperatorwill be responsibleto collect all baggagecart fees and that these fees will be depositedinto the city's bank accountas well.

A 15. Yes, correct.

Q 16: RFPPage6, Section3, Bullet14statesthe 9-passengershuttlehaspickupsevery 15 minutes. RFP Page 8, Section Facility Description, ReportingRequirementsand Equipment Bullet J. states shuttles service provides every ten - fifteen minutes. Please clarify which is.time frame is desired by the airport.

A 16: Our apologies for the confusion. The desired time is every ten-fifteen minutes.

Q 17: Please verify there are two electric chargers available for customers. Who is responsible for the maintenance of these chargers?
A 17. There are two and the Airport is responsible for their maintenance.

Q 18: There are a significant number of 2 hour parking spots. How are they monitored? ra
a. Are citations written for overstaying the time limit? b. What is the average amount of citations in a month? A 18: The current operator patrols these spaces every two hours. They use camera- based technology that records the license plates in thesespots and the subsequent patrols then rely on this technology to identify a parking offender. During high season it averages one citation a day ( 30 per month) and during off season it averages one citation per week( 4 per month).

BY ORDER OF THE CITY OF PALM SPRINGS, CALIFORNIA
Craig L. Gladders, C,P.M.

Procurement& Contracting Manager
DATE: November 25, 2019
ADDENDUM ACKNOWLEDGMENT:

Proposer Firm Name:

Authorized Signature: Date:

Acknowledgment of Receipt of Addendum 3 is required by signing and Including the acknowledgment with your submittal, or you may also acknowledge the Addenda on the bottom of Attachment A. Failure to acknowledge this Addendum may result in your submittal being deemed non- responsive. s
of PALMSp
V CN

CITY OF PALM SPRINGS, CA
REQUEST FOR PROPOSALS ( RFP) 06-20

PARKINGMANAGEMENTSERVICESAT PALMSPRINGSINTERNATIONAL

AIRPORT
ADDENDUM NO. 4
ThisAddendumis beingissuedforthefollowingchangesandinformationalitems:

THE FOLLOWING REVISIONS AND/OR ADDITIONS TO THE RFP DOCUMENT

AND INSTRUCTIONS ARE TO BE INCLUDED AND SHALL TAKE

PRECEDENCE OVER ANYTHING CONTRARY ON THE PREVIOUSLY ISSUED

SPECIFICATIONS AND INSTRUCTIONS AND SHALL BE REFERRED TO HEREINAFTERAS PART OF THE CONTRACTDOCUMENTS.

The City has received the following question and is hereby providing answers thereto:

Q 1: 1justtooka lookat theexcelsheetyouprovidedforstaffing. Whyareyou dividingthe total weekly hours by 2? If you add the hours across on the bottom of the spreadsheetor acrosseach day the number- is double what you are showing. Please advise which way we should propose our costs. Which hours are correct?
A 1: To clarify the figures provided. The total weekly hours are dividedby two in order to accountfor the30 minuteincrementsutilizedto developthestaffingmodel given there are two 30 minute periods per one hour. The values in the cells represent the number of employees required for each 30 minute increment. A value of" I" for any 30 minute increment represents a 30-minute unit of labor. For example, if one employee is required from 8:00 a.m. to 8.30 a.m. and three employees from 8.30 a.m. to 9:00 a.m., this equals four 30- minute units of labor or two hours of labor) from 8: 00 a. m. to 9: 00 a. m. or 4 ( 30- minute units of labor) divided by 2. Therefore, the values in last column on the right labeled" HRS" are the correct values.

BY ORDER OF THE CITY OF PALM SPRINGS, CALIFORNIA
Craig L. Gladders, C.P.M.

Procurement& Contracting Manager
DATE: November 27, 2019
ADDENDUM ACKNOWLEDGMENT:

Proposer Firm Name:

Authorized Signature: Date:

Acknowledgment of Receipt of Addendum 4 is required by signing and including the acknowledgment with your submittal, or you may also acknowledge the Addenda on the bottom of Attachment A. Failure to acknowledge this Addendum may result in your submittal being deemed non- responsive.

OFPALMSAYrL 'Pi
CqIFORNP

CITY OF PALM SPRINGS, CA
REQUEST FOR PROPOSALS ( RFP) 06- 20

PARKING MANAGEMENT SERVICES AT PALM SPRINGS INTERNATIONAL

AIRPORT
ADDENDUM NO. 5
This Addendum is being issued for the following changes and informational items:

THE FOLLOWING REVISIONS AND/ OR ADDITIONS TO THE RFP DOCUMENT

AND INSTRUCTIONS ARE TO BE INCLUDED AND SHALL TAKE

PRECEDENCE OVER ANYTHING CONTRARY ON THE PREVIOUSLY ISSUED

SPECIFICATIONS AND INSTRUCTIONS AND SHALL BE REFERRED TO HEREINAFTER AS PART OF THE CONTRACT DOCUMENTS.

The City has. received the following questions and is hereby providing answers thereto:

Q 1: RFP— Article 2, 2- paragraph, page 5— Regarding the Overflow Lot, will the Operator be responsible for the safety and security and thus be required to carry all applicable insurance coverages on the lot when it is not in operation? A 1: No, the operator is not responsible for safety and security in that lot when there are not operations.

Q 2: RFP— Article 3, Paragraph 7, page 6— Will the Operator's employees be required to assist customers with "keys locked in vehicles" or is this a service to be provided by a third party such" Pop-A-Lock"?
a. Who will pay for the service, the customer or the operator? b. If the Operator, will the expense be reimbursable? A 2: This Is the choice of the operator whether or not they want to accommodate a patron' s issue of` locked keys" and who they want to use, as well as determine who will pay. It is not a reimbursable expense if the operator chooses to do this.

Q 3: RFP— Article 3, Paragraph 13/14, page 6— Will an on-site fueling facility be provided for the shuttle bus service?
a. Is shuttle fuel expense to be included in the management fee? A 3. There is a CNG " natural gas" station on airport property which the operator could elect to use and purchase fuel. Other gas stations are located off the perimeterof the airport for your own use. Fuelexpenseis to be includedIn the management fee.

Q 4: RFP— Article3, ParagraphB, page7— What paymentmechanismis in placeat the OverflowLotwhen in use? Duringourtour of the facilityit did not appearas thoughthis exit lane was equipped with a fee computer.

A 4: Credit or debit card only. There is a fee computer for the transaction on the exit lane.

Q 5: -RFP— Article 3, Paragraph P, Tickets, page 9— Please confirm the City's desire to haveticket pre-numberedbythe printerand not bythe revenuecontrolsystem.

A 5: Page 59 and 60, items A- T include some points about the importance of ticket accountability. The method of pre-numbering is the operator's choice and may be influenced by the existing equipment's capability. It is reasonable to recognize that on site equipment number printing is subject to faults that can affect numbering verses likely fewer issues when pre-numbering stock before going into the machine.

Q 6: RFP— Article 6, DISADVANTAGED BUSINESS ENTERPRISE ( DBE) PROGRAM, page12— Istherea specificform (letterof intent/commitment)fortheDBEProgramthat eachproposershouldcompleteor dowesimplydiscusshowwewillmeetthe4.6% goal in the narrative of our proposal?
A 6: Page 76, Exhibit C references that proposers must submit documentation. It is theproposer's discretionon howto provehow theymeetor couldnot meetthe goal, with written emails or correspondence to potential DBEproviders.

Q 7: RFP— Section C, Paragraph C.1, 7• Bullet Point, page 15— Please clarify what is meant by" Maintaining the parking lots so. they are clean and free of lifter..." This seems tobecontrarytoAttachmentC, Part2of3(Page25)wherethe2- bulletpointnotes:Major groundsandparkinglotclean-upistheresponsibilityof theAirportstaff. a. Is the Operator responsible for cleaning the lot or simply reporting issues to Airport Operations?
A 7: It is the expectation that the operator contributes to the effort to keep the lot tidy usingtheirnormalstaff todominorpickupwhilegoingthru thelot andaround the exit booths. The larger major cleaning is the responsibility of the airport maintenance staff. There is not a need for the operator to hire or contract additional staff solely for the purpose of cleanup.

Q 8: RFP Section C, ParagraphC.1, 10- Bullet Point, page 15 — Will the Airport provide facilities for employee classroom training?
A 8., The airport is happy to provide, free of charge, the use of space, when available, to the operator for its training or meeting purposes.

Q 9: RFP — Section C, Paragraph CA, 2- Bullet Point, page 16 — Please clarify the Operator' s responsibilities for" lien sale vehicles."
A 9: The operator should have sufficient accounting of data related to substantiating liens that are put on vehicles to capture delinquent or uncollectable 0 0
parkingfeesshouldtheyoccur, whichis likelyrare. If vehiclesareabandonedin the public parking areas, the operator will not be responsiblefor the parking charges due.

Q 10: RFP— Attachment"C" Part 1 of 3— Pleaseconfirmwhetherthis scheduleshould include"labor"onlyorshouldit alsoincludepayrolltaxes,Workers' Compensation, Health Welfare insurance and other payroll related expense.

A 10. Should include all labor costs and benefits.

Q 11: Sample Agreement — Article 3.5, Page 52 — Termination Prior to Expiration of Contract Term
a. Would the City consider the Operator's right to terminate the contract for the City's breach and failure to cure within 10 days for a monetarybreachorwithin30daysfora non-monetarybreach.
b. Wouldthe Cityconsiderthe Operator's rightto curean alleged breach- 10daysfor a monetarybreachand30 daysfor a non-monetary.

C. Should the City cancel the agreement early for any reason other than " for Cause", will the operator be reimbursed for any unamortized capital costs and/or operating leases?
A 11: No to ( a) and( b). Yes to ( c) - the complete amortization schedule for any capitalcosts or operatingleasesshouldbeincludedwithAttachment "C"part 3of

3. Q 12: ' Sample Agreement — Article 6, Page 58 — Indemnification — Would the City consider changing the 2- sentence of this article from " This indemnificationclause excludesClaimsarisingfromthesole negligenceor willfulmisconductof the City, its elected officials, officers, employees, agents, and volunteers" to " This indemnffication clauseexcludesClaimsarisingfromthenegligenceor willfulmisconductof theCity, its elected officials, officers, employees, agents, and volunteers'? A 12: No.

Q 13: Addendum # 2 — Q. 1/ A. 1 & Addendum # 3 — Q. 11/ A. 1I — Please confirm/ clarify whetherthe City or the Operatorwill be the creditcard Merchantof Record.

A 13. The City.

Q 14: As all cash/credit cardrevenuesaredepositedintoa Cityaccount, wouldthe City considerprovidingan operatingadvanceequalto 2-months'operatingexpenses? A 14: No.

Q 15: Who is responsiblefor the payment/remittanceof parking/salestax? a. If the Operator, should this expense be included in our management fee as an operating expense?
A 15. The City.

Q 16: Please confirm that the City is responsiblefor structure repairs and capital expenditures and all replacements, upgrades or improvements to equipment, systems and fixtures.

A 16: The City is responsible for the structural expenditures and repairs for- the public parking. The operator is responsible for all repairs and maintenance associated with the revenue control system, shuttle bus and other equipment that the operator provides as pan` of this agreement.

Q 17: Does the Airport Authority receive credit card revenue in the Bank of America account net of the processing fees? Or, is the Merchant of Record responsible to reimburse the Authority for the processing fees?
A 17:. Credit card revenues are deposited into the Airport( City) bank account, as the City is the merchant of record. The respective credit card merchant fees are debited directly from the Airport Authority bank account as well.

Q 18: Are the Gross Revenues Net of Sales Tax?
A 18: The gross revenues as provided in the RFP attachment" J" is total cash and credit sales, the City is responsible for sales tax.

Q 19: RFP— Article 8, Security Instrument, page 18& Sample Agreement, Article 2.3. B.a, Security Instrument, page 51 — Will the City accept an annually renewable industry standard bond as the security instrument?
A 19. Yes.

Q 20: RFP— Article 3, Scopeof Work, page5 & SampleAgreement, ExhibitA, page 69 does the reference to " personnel bonds" mean Fidelity Bonds that would provide protection in the event that the operator's employees steal from the city? a. If so, would a master crime policy with an employee dishonesty clause be acceptable? The coverage provided to the City under our crime policy is substantially better than that offered by a standard fidelity bond.

A 20: Yes. Thespecific policy will need to be reviewed and approved by the City Attorney' s office.

CORRECTIONS TO PREVIOUS ANSWERS IN ADDENDUM 3. The City hereby strikes the original responses provided to Questions 16 and 17 in Addendum 3 and Is providing revised responses below:

Q 15/ Addendum 3: RFP Page 5, Section 3 Scope of Work, Services, Objectives and Specifications, Bullet number 3. Please confirm that parking operator will be responsible to collect all baggage cart fees and that these fees will be deposited into the city's bank account as well.

A 15/Addendum 3-- revised., No, the bag cart system is being converted to credit card only payments and the Airport will be responsible for the credit card deposits.

The operator will no longer manage the bag carts.

Q
Q 17/Addendum 3: Please verify there are two electric chargers available for customers.

Who is responsible for the maintenance of these chargers? A 17/Addendum 3- revised: Therearecurrently six( 6) charging stations within the public parking areas, and the airport is responsible for their maintenance.

BY ORDER OF THE CITY OF PALM SPRINGS, CALIFORNIA
Craig L. Gladders, C. P.M.

Procurement& Contracting Manager
DATE: December 3, 2019
ADDENDUM ACKNOWLEDGMENT:

Proposer Firm Name:

Authorized Signature: Date:

Acknowledgment of Receipt of Addendum 5 is required by signing and including the acknowledgment with your submittal, or you may also acknowledge the Addenda on the bottom of Attachment A. Failure to acknowledge this Addendum may result in your submittal being deemed non- responsive. pFPALMSA
cq IFpµNP

CITY OF PALM SPRINGS, CA
REQUEST FOR PROPOSALS ( RFP) 06- 20

PARKING MANAGEMENT SERVICES AT PALM SPRINGS INTERNATIONAL

AIRPORT
ADDENDUM NO. 6
This Addendumis being issued for the followingchangesand informationalitems:

THE FOLLOWING REVISIONS AND/OR ADDITIONS TO THE RFP DOCUMENT

AND INSTRUCTIONS ARE TO BE INCLUDED AND SHALL TAKE

PRECEDENCE OVER ANYTHING CONTRARY ON THE PREVIOUSLY ISSUED

SPECIFICATIONS AND INSTRUCTIONS AND SHALL BE REFERRED TO HEREINAFTER AS PART OF THE CONTRACT DOCUMENTS.

The City has received the following questions and is hereby providing answers thereto:

Q 1: Even though it's not mentioned in the RFP scope of work, will the Airport consider adding a future valet operation?
A 1: At this time, the Airport is not planning to offer valet parking. If this is considered during the term of the agreement, the agreement would be amended.

Q 2: Pleaseprovidethe numberof employeesandtheexistingwageratesfortheTEOs, Taxi Starters, and Cashiers.

A 2: The current schedule is:
1 Manager
1 Asst. Manager
1 Supervisor
7 Cashiers
5 Taxi Starters
10 TEO' s
We do not determine ormaintain the wage rates of the operator' s employees.

Q 3: Our firm is a California DBE with experience in the parking industry with representationin the PalmSprings, CA area. Howcan we ensurethatthe primefirms know we are available to partner so they can achievethe City's ACDBE goal and avoid relying on the ' Good Faith" documentation? Our firm is registered on the City of Palm Spring' s Procurement & Contracting website.
0 0
A 3: TheCityhaspostedonline (websitelink providedin RFP) forpublicaccess all of the contact informationfor everyvendorthat hasregisteredfor this RFP. This Information has been continually updatedas vendorshaveregistered throughout theRFPprocess. Assuch,prospectiveDBE'sinterestedinpartneringwiththeany of theprospective vendors has the ability to conduct their own outreacheffort to ensure that the firms are aware of their services.

Q 4: Althoughthe agreementwiththe incumbentoperatorappearsto bevery clear regardinganyincreasesinthefixedmanagementfee, whywasthefee increasedearlier this year( via Amendment No. 2)?
A 4: As is statedin the AmendmentNo. 2, "for labor costs stemmingfrom California's legislatively imposedminimum hourly wageincreases." Q 5: Whyis thecurrentagreementterminatingpriorto theendoftheoriginalterm? A 5. Withthe Californiaminimum wageincreasing againin 2020the City elected to solicit competitive proposals now.

Q 6: Would a $200,000 PerformanceBond be acceptablein lieu of a $200,000 Letter of Credit?
A 6: Any deviation from the language in the proposed agreement with the successfulproposerregardingthisissuewillneedtobereviewedandapprovedby the CityAttorney' s office.

Q7: Canyouconfirmifthefinancialstatementsarecountedaspartofthepage (orsheet). countof the proposal. Oursare approximately35 pageseach and two yearswould effectively fill out the 40-page (or sheet) maximum.

A 7: FinancialStatementsdo not count toward the totalpage count.

Q 8: There are to be two envelopes, one with the ManagementPlan and one with the ManagementFee. DoestheAirporthavea preferenceonhowto bindthe 80 page (40 sheets) proposal ( Management Plan) in the first envelope? A 8: No, we do not.

Q 9: .Canwe putupa performancebondinsteadofthe $200,000letterof credit? A 9: See answer to Question# 6 above.

Q 10: Canwe addan appendix, outsideof the pagenumbers, to includeanSOPanda sample of the transition plan?
A 10: No.

Q 11: In sectionC bullet #21 we are askedto providedetailsof the payscalein the layoutoftheManagementPlan. However, theManagementFeeincludesthepayscales on Attachment C part 3 of 3 and is requestedto be in a separateenvelope. Is it correctto say the pay scales should only appear in the ManagementFee envelope and not in the Management Plan proposal?
A 11: Yes.

Q 12: Can we add an appendix, outside of the page numbers, to include a Sample Reporting Package detailing the information we would be able to provide on reports regarding daily operations requested in section C?
A 12: No.

Q 13: Would the Airport please clarify in section C, bullet point #17 what the use of automated payment systems will cover? Will it cover more than just parking reservations? A 13: The current parking operation includes an automated exit booth at lane 3 and at the remote parking/ of, also a pay-on foot imachine in the terminal lobby, these systems are expected to continue. There maybe other automated features that the revenuecontrol system could facilitate, if so, pleaselist the options.

Q 14: How many phone lines and data linesare utilized,in the operationtoday? A 14: 1 DSL, 3 phone lines
Q 15: Please provide historical transaction counts for the past3 years broken down by year.

A 15:
2016 = 206, 562
2017= 208, 704
2018 = 210, 338
2019 January through November= 199,496
Q 16: Please confirm that the items listed in bullet point# 2, attachment C part 2 of 3— all miscellaneous expenses such as phone and data lines, tickets, supplies, etc. are to be included in the management fee.

A 16: Yes.

Q 17: If signage is to be included in the management fee please clarify what signage that, is and if the current operator owns any signage that will need to be replaced. If so, please provide a list of that signage.

A 17. The current signage is provided by the airport
Q 18: Is there anyoffice or booth furniture, drop safes, other safes, computers, phones, printers, office supplies or other equipment owned by the current operator that will need to be replaced by a new operator? If so please provide a breakdown of what that is.

A 18: One ( 1) drop safe remains, other safes that may be necessary will be the responsibility of the operator. The operator is responsible for; furniture, any 0 personalcomputersthatarenot pan'of thecun-entrevenuecontrol system,phones, radios, and all office supplies.

Q 19: Is there any specificequipmentthatthe airportis awareof that will needto be replaced in the next 5 years?
A 19: No.

Q 20: What is the current startingwage for the current operatorfor cashiersandTEOs? A 20: California minimum wages standards are followed, however we do not determine, maintain, or have records of the current operator' s wages for their cashiers or TEO' s.

Q 21: In regard to Section 3 of the RFP, page6, are# 13 and #14 the same or are they referring to separate occasions?
A 21: They are referring to the same occasions.

Q 22: Who isthe current serviceproviderfor the SkiDataequipment? A 22: Sentry
Q23:Willtherebeanynewparkinglots/areasoradditionalparkingservicesaddedto the airportwiththe upcoming30 milliondollarrenovationprojectthatwas referencedin the pre-proposalconferenceprojectedto beginin May2020?
A 23: No.

Q24:Whoisthecompanythatcurrentlyprovidesarmoredcarserviceto BankofAmerica? A 24: Thisquestion wasansweredin Addendum93, question#2.

THE DEADLINE FOR SUBMITTING QUESTIONS ON THIS RFP HAS NOW PASSED. THIS IS THE FINAL ADDENDUM.

BY ORDER OF THE CITY OF PALM SPRINGS, CALIFORNIA
Craig L. Gladders, C.P.M.

Procurement& Contracting Manager
DATE: December 3, 2019
ADDENDUM ACKNOWLEDGMENT:

Proposer Firm Name:

Authorized Signature: Date:

Acknowledgment of Receipt of Addendum 6 is required by signing and including the acknowledgment with your submittal, or you may also acknowledge the Addenda on the bottom of Attachment A. Failure to acknowledge this Addendum may result in your submittal being deemed non- responsive.

PARKINGMANAGEMENT CONTRACTAT PALM SPRINGSINTERNATIONAL AIRPORT

EXHIBIT C
Section A - Firm Qualifications & Experience
A.1 — Attachments — Reauired Forms
PleasefindcompletedAttachmentA, B, DandEattachedattheendofSectionA.

A.2 - Firm Name& Ownership Contact Person
Scott Hutchison
ABM Aviation
4151AshfordDunwoodyRd., Ste. 600
Atlanta, GA30319
404- 926- 4200
www. abm. com
ABMAviationisacorporationwhollyownedbyABM,Incandregisteredinthestateof California.ABMhasbeeninbusinessesinCaliforniasince1966underthenamesofAmpco Parking,AmpcoSystemParking,AmpcoAirPark,ABMParkingServicesandABMAviationsince 2017).

Primary Contact Secondary Contact
D. Scott Hutchison Larry DeLuca
Senior Vice President Vice PresidentAviationParkingOperations ABM Aviation ABM Aviation
4151Ashford Dunwoody Rd., Ste. 600 4151AshfordDunwoodyRd.,Ste.600 Atlanta, GA 30319 Atlanta, GA 30319
801- 419- 1812 Direct Phone 512- 587- 0796 Direct Phone Scott. Hutchison( a) abm. com Larrv. DeLuca( a)abm. com A_3 Minimum Qualifications
ABMAviationmeetsthequalificationstooperatePalmSpringsInternationalAirportparkingoperation. As oneofthelargestparkingmanagementandtransportationoperatorsinthe country,ABMAviationhasextensiveexperienceinairportparkingmanagement, shuttle operationsandgroundtransportationservicesofallsizes. ABMhasoperationsat thelargest airportsinthecountrysuchasLosAngeles, Atlanta-Hartsfield, Denver, Dallas -Ft. Worthand Minneapolis—St. Paul; mid-sizeairportslikeOklahomaCity,EppleyAirfieldandHonolulu; and regionalairportslikeLongBeach, CedarRapids, Gary, IndianaandSouthwestGeorgia RegionalAirport.ABMcurrentlyperformsalltypesofservicesattheseairportlocationssuch as parking management, valet parking services, ground transportation management, employeeandrentalcarshuttleservices, andwillusethisexperiencetohelpimprovethe operations at the Palm Spring International Airport.

Ourmanagementphilosophyensuresweprovidethehighestcaliberofoperationalcontroland exceptionalservicetoourclients, customers, andemployees. Ourmanagementand organizationalapproachesaredrivenbyresults. Weempowerourlocalmanagementteamto executethenecessarystepstoaccomplishsite-specificgoalswhilemaintainingoperationalcontrolandcompanyguidelines. Weincorporateourcorevalues— respect, fairness, and dignity—intoeverybusinessdealingtoguaranteedesiredresults. OurABMAviationteam understandsthedynamicsinvolvedin managingtheparkingand/or shuttleoperationsata fast-growingairport. Thesedynamicscanchangewithoutnoticemakingitessentialtohavea Management Plan
1 Section A
teamonthegroundthatcanmakedecisions, rapidlyadjustandimplementchangesrelativeto our business, while limiting operational impacts.

OurparkingmanagementteamhasbeencreatedtoensurethePalmSpringsInternationalAirport'sneeds, servicestandards, andexpectationsarecontinuallyexceeded.Wehave developedsitespecificoperationsplansandprocedurestomeetthedemandsoftheparking, shuttleandtrafficcontroloperationandourparkingguests. Ouroperationsplanfortheairport includecustomerservice, parkingmanagement, shuttlemaintenance,taxiandcurb management,training, and properreportingto the airport.

Airport Commercial Parking Experience
ABMAviationcurrentlyprovidesparkingmanagement,valetparkingserviceand/or transportationserviceto20airportsinthecontinentalUSandHawaii. Stallcountsatour airportlocationsrangefrom662stallsatHiloInternationalAirportto 27, 359atourTampa InternationalAirportoperation. AnnualRevenuesrangefrom$350,000atSiouxGateway Airportto over$90 millionatourLosAngelesInternationalAirportoperation. OurAirport clients include:

Des Moines Intemational Airport Los Angeles International Airport Eisenhower National Airport McCarren- Las Vegas
Eppley Airport International Airport
Hilo International Airport Minneapolis— St. Paul
Honolulu International Airport International Airport
Atlanta- Hartsfield Nashville International Airport
International Airport Newark Liberty International Airport John F. Kennedy Orlando International Airport
International Airport Ronald Reagan National Airport
Kahului & West Maui Airport Tampa International Airport La Guardia Airport Washington- Dulles
Lambert— St. Louis International International Airport
Airport Will Rogers World Airport
Lihue Airport Memphis International Airport _
Long Beach Airport
EachofourparkingoperationsprovidedbelowmeetPalmSpring's specificminimum qualificationsrequiredanddemonstrate:

Computerizedparkinglotaccessrevenuecontrolsystems
Minimum of 1,500 parking stalls
Annual revenues in excess of$ 3,000,000
Collection and accounting of parking revenue
Operationandmaintenanceofparkinglotrevenuecontrolequipment Colt
Aerate=. Sta, :.

I tls Aaa nted a u tvta nt8 n f' J CFat
St. Louis Lambert International Airport 9, 001 35, 000, 000 Amano McGann 2011 Nashville International Airport 11, 200 54, 400, 000 Scheidt& Bachmann 2015 Long Beach Ariport 3, 809 10, 000, 000 SkiData 1991
JFK International Airport 16, 688 I $ 90, 000, 000 Designs 2012 J 2 Management Plan
Section A
r- Airport Shuttle Experience
ABMAviationprovidesshuttleserviceinsomeofthebusiestairportsinthenationandpridesitselfinourfocusonthecustomerexperience, clientfocusonfinancialaccountability, exemplaryhistoryofsafetyandtheuseoftechnologytoimprovetheexperienceandefficiencyofshuttleoperations. ABMAviation'stransportationserviceclientsincludetheairportslistedbelow:

EachofourshuttleoperationsprovidedbelowmeetPalmSpring'sspecificminimumqualificationsrequired and demonstrate:
seating capacity greater than 20 passengers
airbrakes
ADA-approvedequipmenttoaccommodatedisabled,passengers
Wr-BradShu teS Approved' 2 en ers Setvtce
Ontario International 6 Yes Yes Yes 2014Los Angeleslnternational so Yes Yes Yes 2014 Washington- Dulles International 20 Yes Yes Yes 2014
ABMAviationhasextensiveexperiencesupportingADApassengersasdemonstratedbyABM'sADAshuttleoperationsatLAX.TheservicetransportsonlyADAcustomersbetweenterminals. InourNationalandDullesoperations, ABMoperatesthemaintenancefacilitiesforafleetofmore than7040ftshuttles. AtLAX,ABM'soperationsserviceamixedloadofbothemployeesand publicpassengers — achallengeinanyenvironment.Whiletheproposedshuttleoperationsequate tobarely1% thetotalannualoperatinghours, shuttleoperationswillhaveadisproportionateimpactonthecustomerexperienceduringtheholidaypeaktravelperiod.

Airport Parking Curb Control Experience
ABMAviationprovidescurbcontrolinthemostchallengingairportsintheUnitedStates. ABMfocuses onensuringthehighestcustomerexperience, managinganenvironmentofprofessionalismwiththe serviceprovidersonthecurb, andfocusonoperationalefficiencies. ABMAviation's curbsidemanagementserviceclientsincludethe airportslistedbelow:

Denver International Airport La Guardia Airport
Honolulu International Airport Newark Liberty International AirportJohn F. Kennedy International Memphis International Airport Airport San Francisco International Airport
EachofourcurbcontroloperationsprovidedbelowmeetPalmSpring'sspecificminimumqualificationsrequired and demonstrate:
r Operationswithinthe lasttenyears
Qualified staffing
Airport Passengers Length of
Dis atched Da Service
San Francisco International 5, 000 2011
Newyork/ New Jersey Airports( 3) 16, 000 2016
Honolulu 1, 250 2010
ABMAviationrecognizestheincrediblechangesincurbsidemanagementoverthelast3-4years— f 1 specificallytheintroductionofrideshareoperationsandtheimpactsuchoperationshaveonlimited Management Plan
3 Section A
curbsidespace.Anoperatorthathasnotoperatedcurbsidemanagementinthelast5yearswillbeataseriousdisadvantage; notonlyintermsofoperationalimpactsoftherideshareoperationsbutimpacts drivenbythetechnologysupportingrideshare.Technologyhasaffectedeveryaspectofcurbsideoperationsincludingthecollectionofuserfees, managementofvitalcurbsidespace, enforcementof operatorandgeneralpublicusageregulationandcollectionoffinesforpenalties. ABMAviationhasdemonstratedexperienceinmanagingnewtechnologiesandoperationalapproachestocurbside managementthatwillhaveasignificantimpactonPalmSpring'scustomerexperienceandoperational efficiency.

Airport InfrastructureImprovementProgramExperience
ABMAviationwascreatedwithinABMforthespecificpurposeofensuringourairportclients' expectationsofcontinuousimprovementweregiventheproperresourcesandfocus.Thisisadifferent approachfromaparkingcompanythatdoesnotdifferentiateinternallybetweencommercial,eventandairportoperations. Everylevelofourorganizationisstructuredtoprovidetheexperiencedstaff, financialdepthandsubjectmatterexpertisetomeetthespecificdemandsoftheairportclient.

EveryoneofABMAviation'sairportoperationshasinvolvedsignificantchangesininfrastructure.BelowarelistedasampleoftheseoperationswithafocusonABM'sabilitytoprovidesubjectmatter expertise, financialsupportanddesignfimplementationleadershipforthefullgambitofinfrastructure improvements.

LosAngelesInternationalAirport—Automation/RevenueControlUpgrades In2018, theLosAngelesWorldAirport (LAWA) requestedABMAviationleadLAXinthedesign, procurementandinstallationoftheautomationofthreeoftheeightparkinggarages. Theprojectcalledforaturnaroundtimeofapproximatelylessthan120daysforthefirsttwogaragestobecompletedand opentopublicusewhilemaintainingthealtlitytocollectrevenue.Theprojectincluded:

Introductionof Payon Footstationsin eachgarage
Relocation of the exit lanes and re- orientation of entrance lanes ti 1 Replacementof16staffedexitlaneswith 13automatedexitlanes Reductionof parkingstaff by16%
Reductionparkingoperating,expensesbymorethan$2.5M
ABMfinancedthepurchaseoftheequipment (approximately$3M)asapassthroughexpenseallowingforareductioninthelengthoftheprocurementprocess InstallationwascompletedtothestandardsrequiredbyLAWAconstructionandIT departments
ABMAviation'slocalandregionalmanagementteamsworkwiththeequipmentprovider, constructioncompanies, LAWA'sOperationsandITdepartmentstocompleteatrulydauntingtaskinrecordtime.

LongBeachAirport—Automation/GarageRenovation
In2017, LongBeachairportcompletetherenovationsofbothonsiteparkinggarages. Renovationsincludedstructuralrenovationofthegaragesthemselves, relocationofpublicentrancesandexits,introductionofautomationandrelocationofthetaxicurb.ABMAviation'sgeneralmanagerledefforts to:

Updateoperationalprocessresultinginthereductionofstaffingandsupportingexpenses Introduceautomationasanenhancementtothecustomerexperience Relocateemployeeparkingandcompleterevamptheemployeebillingprocessresultinginreductionofoperatingexpensesandimprovementinefficiencyincollectingimportantrevenue ABM'sgeneralmanagerworkedcloselywithLongBeachAirport'soperationsandaccountingstafftoensureaseamlessre-openingofthefacilitieswithnoimpactonthecustomerexperience. 4 Management Plan
Section A
EachABMAviationlocationhassometypeofsimilarcontributiontotheintroductionofcontinuousimprovementswithintheoperation. Suchimprovementsinclude:

Constantevaluationofpositiondutiesandschedulesforeffectivenessandefficiency.AtLAX,jobclassificationswererestructuredtoincreasecross-utilization. Typically, unionswouldresistsuchefforts. NegotiationswiththeunionweresuccessfulbecauseABMcoulddemonstrateto theemployeesthatreclassifiedpositionswere,infact,lesssusceptibletofutureautomation.

TheintroductionoftechnologyintoshuttleoperationsinDullesandReagan-National:
o Reducedshuttleoperatinghoursbycreatingmoreefficientdispatchingo Improvedthecustomerexperiencebyprovidingimprovedoversightondriver performance
o Improvedthecustomerexperiencebyallowingshuttlepassengerstotracktheprogressof shuttlesthroughtelephoneapplications ABMAviationgeneralmanagersworkedwithtechnologyprovidersatLAXtocreateseveralcustomapplications:
o :Employeeparkingpermitsaleswereautomatedtotheconvenienceoftheemployees thatwerenolongerrequiredtocomeintotheparkingofficetopayfees.Thecustomer systemintegratedtheaccesscontrolsystem, onlinepaymentsystemandaccountingsystemandresultedinreductionofoperatingexpenses. o AcustomapplicationwasdevelopedbyABMandRideSystemsthatimproved dispatchingofADAshuttlesbetweentheeightterminals. Inadditiontoimprovingdispatching, theapplicationallowedformuchneededaccountabilitybetweenallthepartiesinvolvedinmovingtheADAcustomerfromoneterminaltoanother. Thesystem r furthercreatedadetailedrecordofthecustomer'smovementinthecasethata complaint was received by the airlines.

A_4 ACDBE Goal
ABMAviationusestheservicesandproductsofACDBE, MBEandWBEbusinessconcernsinits nationwideoperationstothefullestextentpossible. AtLAX, weworkedcloselywithtwoMinorityBusinessEnterprisestoassisttheminapplyingforandreceivingtheirACDBEcertifications. WeareproudofourcommitmenttoworkingwithandpromotingACDBE/WBE/MBEandSBEcompanies; not justassubcontractorsbutinmanycasesasjointventurepartners. Insomecases, thesepartnersaremajority stakeholders in the operation.

ThefollowingisalistingofactualmajorprojectsweoperateandtheACDBE/MBE/WBEentitiesweworkwithin the dailyexecutionof our duties:

M. /
jpp<p° d _ ., E BF1MBErdVflB, =. Senet'
Washington Dulles International U Street Parking Parking Management Newark Liberty Intemational U Street Parking Valet Management DFW International Terminal Link ABC Fleet Services Vehicle Maintenance DFW International Terminal Link Unicorp Staffing Services Los Angeles International HW Maintenance Janitorial Services San Francisco International Pacific Parking Curbside Management Tampa international TPA Airport Parking Accts Auditing Services Denver international Nationwide Parking Shuttle Services Management Plan
5 Section A
ABMAviationproposestousePacificParkingasourACDBEcontractortomanagethecurbsideoperationsatthePalmSpringsAirport. PacificParkingisABMAviation'sACDBEpartnerforthesameresponsibilitiesattheSanFranciscoInternationalAirportandiswellrespectedfortheifexpertise,commitmenttocustomerserviceandlevelof.involvementinallaspectsofcurbsideoperations. TheABM/PacificParkingrelationshiprepresentsourtruecommitmenttothegoalsoftheACDBEprogram.PacificParkingwillresponsiblefordevelopingthecurbsidemanagementstaffandpoliciesandforcontinuousimprovementontheroadway.ABMAviationacknowledgestherequiredcommitmentof4.6% andwillmaintainrecordsdemonstratingcomplianceforreviewbytheAirport.

A.5 List 3 -10 Airport Parkina Locations
AsmentionedpreviouslyABMAviationmanagesmorethan20airportoperationsthroughoutthenation. Belowwehaveprovidedmoredetailonsomeofthoseairportlocationstodemonstrateour parkingmanagementexperience.TheoperationsbelowwereselectedtodemonstrateABMAviation'swiderangeinoperationalscopeandexperiencewithvariouscontracttypesandrevenue control systems.

Location Los Angeles International Airport
Owner LosAngeles International Airport
Number of Spaces 8, 500
Current Phone Number 424) 646- 6457
Email Address econs- antiniclesl 1mw. org
Contact Person alas Constantinides
Dates Operated 6/ 2016- present
Type of Revenue Control System HUBAEAG
Method& Amountof Reimbumementnanagemem Fee Billable Hours+ ManagementFee;$24M/Year Annual Parking Revenue 90M
Location LongBeachAirport
Owner Long BeachAirport
Numberof Spaces 3, 809
Current Phone Number 562) 570- 2605
Email Address Cynth' aG - drvolonebeach eov
Contact Person Cynthia Guidry
Dates Operated 1991- present
Type of Revenue Control System Ski Data
Method& Amount of ReimbursementANanagemem Fee ManagementFee/BillableHour/ReimbursableExpenses,$L7/YeT Annual Parking Revenue l0M
Location St. Louis Lambert International Airport
Owner St. LouisLambert.International Airport
Number of Spaces 9, 04E
Current Phone Number 314- 426- 8178
Email Address resalarano2flystl. Com
Contact Person Robert Salarano
Dates Operated 2011- present
Type of. Revenue Control System Amano McGann
Method& Amount of ReimbursementMlanagement Fee Reimbursable Expenses+ManagementFee:$10MIrear Annual Parking Revenue 35M
Management Plan
Section A
Location
Nashville InternationalAirport
Owner
Nashville International Airport
Numberof Spaces
11, 200
Current Phone Number
615) 275- 1605
Email Address
aaron. evansldflvn asv' I lesom
Contact Person
Aaron Evans
Dates Operated
2016- present
Type of Revenue Control System
Scheidt& Bachmann
Method& Amount of ReimbursementiManagement Fee
ManagementFee/BillableHours/Reimbursement;$8.6M/YearAnnual Parking. Revenue 54M
A_6 List 3- 10Airport Shuttle Bus Locations
Asmentionedpreviously,ABMoperatesover900shuttlesacrossthenationforairport, commercial andhospitalfacilities. ABMAviationprovidesallaspectsofshuttleoperationsadheringtoState, localandFederalrequirementsandADAcomplianceforoperatingsafeshuttlefleets. Someofourshuttleclients include:

Location
DFW Remote Shuttle
Operatedon BehalfOf
DFW International Airport
Current Phone Number
972- 973- 0983
Email Address
kirw' n1( ddhva' roort com
Contact Person
Kristi Irwin
Dates Operated
3 2012- present
NumberofBuses( 20+ passengers) 17
MethodandAmountofReimbursement/Management
Fee
Billable Hours;$ 4M/ Year
Location
LAXEmployeeShuttles(Mixedemployee/publicuse)Operated on Behalf Of Los Angeles International Airport
Current Ph one Number
424) 646- 6457
Email Address
econstantinidesnclawn org
Contact Person
Ellas Constantinides
Dates Operated
2015- present
NumberofBuses( 20+ passengers) 34
MethodandAmountofReimbursement/Management
Fee
BillableHours/ManagementFeed$10M/ Year
Location
Denver Internatio nalAirport
Operated on Behalf Of
DenverinternationalAirport
Current Phone Number
303) 342- 2976
Email Address
ree. holtPffydensercom
Contact Person
Mr. Greg Holt
Dates Operated
1998- present
NumberofBuses( 20+ passengers) 60
MethodandAmountofReimburserrent!Management
Fee
Billable Hours/ Management Fee;$24M/ Year
ems.

Management Plan
7 Section A

6.7 List3-10TrafficControlOperations
ABM Aviation operates curbside traffic control operations in some of the most challenging airport J environmentsinthecountry.In2096, ABMAviationtookovertheheavily-scrutinizedtaxidispatchservicesinallthreeNewYork— NewJerseyairportsandspentthefirstyearimprovingcustomer serviceonthecurbsandtheprofessionalismofthecurbstaff.InSanFrancisco,ABMAviationleadoneofthecountry'sfirsteffortstomovethehigh-volumerideshareoperationsfromcurbfronttoinside the parking garage.

Location San Francisco International Airport
Operated on Behalf Of San Francisco In temationalAirport Current Phone Number 650) 821- 6514
Email Address Daniel oinoMmsfo. com
Contact Person Dan Pino
Dates Operated 2011 to present
NumberofTraffic Control Officers 70
Method'& Amount of Reimbursement/ Management Fee Mana ementFee/ BillableHours;$5M Location JFK International Airport
Operated on Behalf Of JFK International Airport
Current Phone Number 212) 435- 3729
Email Address g_carbonaftanvnl.00v
Contact Person Mr. Peter Carbonaro
Dates Operated 2016- present
NumberofTraffic Control Officers 38
Method& Amountof ReimbursementiManagement Fee Billable Hours/ ManagementFee•$9M Location Daniel K Inouye InternationalAirport
Operated on Behalf Of Daniel K Inouye International Airport Current Phone Number 808) 838. 8676
Email Address foss smlthftaw ii gmt
Contact Person Mr. Ross Smith
Dates Operated 2010- present
Number of Traffic Control Officers 42
Method& AmountofReimbursemenf/ Management Fee Leasea reement$ 16.5M/Year A:8 List Qualifications of Personnel
KeyIndividualsandTeamMembers
ABMAviationwillassignmembersofABMAviation'sExecutiveManagementTeamthatwillprovidesupervisionandsupporttotheonsitepersonnel. Theonsitepersonnelwillpossessthequalificationsandexperiencenecessarytomanageanairportparkingoperation, shuttleserviceandgroundtransportationservice.ABM'sgeneralmanagerwillberesponsibleforallaspectsoftheoperationand,serveasABMAviation'sdirectrepresentativetotheairport.Thegeneralmanagerwillbesupportedregionallyinoperations, humanresource, safetyandprocurementmatters- ABMAviationisverypleasedtoproposeMr. MahmudPatel(Patel) asGeneralManagerforparkingatthePalmSpringsInternationalAirport. Patelhas25yearsofparkingmanagementexperience—muchofitin Southern California airports such as Long Beach, John Wayne and LAX. Patel' s experience 8 Management Plan
Section A
encompassesparkingoperations, shuttleoperationsand revenuecontrolsystemmaintenanceand r •
installationsincludingSkiData.Patelwillhaveanimmediateimpactonparkingandcurbside operations at Palm Springs.

MAHMUD A PATEL

SUMMARY OF ACCOMPLISHMENTS
MORETHAN26YEARSOFEXPERIENCEIN ALLPHASESOF PARKING
MANAGEMENT AND CUSTOMER SERVICE. 9ACKGnouao INCLVOES A

WIDE VARIETY OF TECHNICALAND ACAIMISTRAYNESUPPORT
FUNCTIONS; OPERATIONS OF BUSIEST AIRPORT AND COMMERCIAL PARKING MANAGEMENT. EXCELLENT SALES AND CUSTOMER SERVICE aKlus. TEAM PLAYER,WHO WORKS WELL VIIOER PRESSURE AND CAM HANDLEMULTIPLETASKSAND PROJECTSSIMULTANEOUSLY. ABLE TO
LEARN NEW SYSTEMS OUICKLY AND INTERACT PROFESSIONALLY 491TH VENDORS AND CUSTOMERS.

PROFESSIONAL EXPERIENCE
ARM AYIagon 1994— Preserd
Operations l General Manager
Los Angeles, CA
SERVEDIR A VARIETYOF POSITIONSAl OVFERENTLOCATIONSWIT$AN EMPHASISON

AIRPORT LOCATIONG
August1994tDJuly 190 AssistantMarlagerat LAX
Jury 1995WJanuary1997AssistoINMane erat JVVA
JErnlary 1997 t0 July 1998 Operations Mana er at TAX
A69ast 199810 ADHOI 9 AMSi Mnt Manager at JVJA
APO1899to July2004GeneralManageral LGB
Jury20O1MJMly200DA:. ROMOparaEOnsManager- Chicagoregion Aog= 20D9 M ABOU2015 Oporaliona AA., C,
May 2015 t0 July 2019 General Manager at LAX
Y \
August 2D19 to Presets Guneral Maroagal at LGB
PERFORMCOMBINATIONOFTHEFOLLOWINGDUTIES.ADMINISTRATIVEANDOPERATIONAL SUPERVISION. HIRING. TRAININGAND SCNEOULIIIG OF SUPPORT STAFF. HIGHLY INVOLVED

IN REVENUE CONTROL, FACILITY ORGANIZATIOIJ, FLEET OPERATIONS, MANAGEMENT

STRATEGIES, CUSTOMERSERVICEPOLICIESAND INFORMATIONSYSTEMSTHATARE

CRITICALTO ABM, ACTASAN INFORMATIONRESOURCEBETWEENPROPERTYMANAGER AND ABM PRIORITIZE AND MANAGE A VARIETY CF DIVERSE TASKS AND ASSIGNMeNTS, t INCLUDINGBUTNOTLIMITEDTO THEFOLLOWINGACTIVITIES;TRACKWORKSCHEDULES A" 0 ONUPL0E THEPAYROLLPROCESS. MAINTAIN, COMPLETEANDACCURATEFILES TMROUGN THE DEVELOPMENT OF FILING SYSTEMS AND CLASSIFYING,. ARRANGING AND O13CARDING MATERIALS. MAINTAIN CONFIDENTIALITY OF PERSONNELRECORDS,.PAPER WORK, ACCOUNTING AND INFORMATION. COLLECT, COMPILE AND INPUT DATA AMD

INPORMATION IN OROER TO PROCUCE MONTHLY REPORTS INCLUDING PROFITAOSS

REPORTSPREPARETHENECESSARYACCOUNTINGFORMSINCLUDINGDAILYCASHREPORT DR), MONTHLY LEDGER, PETTYCASH AND No PITNLY MANAGERREPORT.

ThegeneralmanagerwillbescheduledMonday— Fridayduringnormalbusinesshoursbutis responsibleforthe operation24/7. Thegeneralmanagerwillremainoncallincaseofemergencies oroperationalissues. Supervisionwillbescheduledduringpeakhoursandwillbequalifiedtocover forthegeneralmanagerfornormaloperationalissues. Duringthoseoccasionswhenthegeneral managerisnotavailable, regionalsupportwithequivalentexperienceinairportparkingwillbe assignedby nameto coveroperationalissuesinsupportof the onsitesupervisor. ABMAviationis fortunatetohaveseveralairportoperationsofcomparablesizeorlargerinwithineasycommuteto providesupport, eitherduringthegeneralmanagersabsenceorassituationsrequire. Thegeneral managerisexpectedto performthefollowingdutiesin anexemplarymanner:

Responsibleforadministeringand/orimplementingpolicies, systems,programs, processes, procedures and/or plans within the station
f"\ Supervises and controls all locations within the station 9 Management Plan
Section A
Monitorand maintainstaffinglevelswiththe assistanceof the localHumanResources Department
Abilityto performauditstoensurecompliancewithallsafety,quality, andcompliance standardsestablishedbythe Company,by our Clients, and by regulatoryauthorities Accommodate increased/ decreased staffing needs
Foster deep and meaningful relationships with our client representatives Visitour clientsfrequentlyto discussperformance,planning, outstandingissues, concerns, and opportunities
Inspire and motivate others to do well
Ensure effective scheduling and time management
Workcloselywithourhumanresourcesteamtorecruitandretainthemostcustomerservice driven workforce in the business
Deliverworldclasstrainingprogramsthatensureteammembersremainattentivetoeach passenger's personal needs
WorkcloselywithourSafety/Qualityteamtoexecuteavigorousmetric-basedsafety, quality and security program
Manage daily schedules
Maintain communication with supervisor to maintain optimum staffing levels Effectively coach, counsel and discipline employees
10 —
Management Plan
Section A
ATTACHMENT " A"

THISFORMMUSTBECOMPLETEDANDSUBMITTEDWITHYOURMANAGGEMENTPLAN Envelope# 1)*
REQUESTS FOR PROPOSALS ( RFP)# 06- 20

PARKINGMANAGEMENTSERVICESATPALMSPRINGSINTERNATIONALAIRPORT

SIGNATUREAUTHORIZATION
NAMEOFCOMPANY(PROPOSER): ABMAviation, Inc.

BUSINESS4151AshfordDunwoodyRoad, Suite600, Atlanta, GA30319ADDRESS:

TELEPHONE: 1 CELLPHONE FAXCONTACTPERSON Cott UtChlson EMAILADDRESSSCott.HutChlSon(Cr7abmcorn
A.

I herebycertifythatI havetheauthoritytosubmitthisProposaltotheCityofPalmSpringsfortheabovelistedindividualorcompany. IcertifythatIhavetheauthoritytobindmyself/thiscompanyinacontractshouldIbesuccessfulinmyproposal.

D. Scott Hutchison, Senior Vice President

PRINTED NAME AND TITLE
December 13, 2019

SIGNATURE AND DATE
B.

Thefollowinginformationrelatestothelegalcontractorlistedabove, whetheranindividualor a company. Place checkmarksas appropriate:

1. Ifsuccessful, thecontractlanguageshouldrefertome/mycompanyas:

An individual;
A partnership, Partners' names:

A company;
X AcorporationIfacorporation, organizedinthestateof: Georgia

2. My tax identification number is: 58- 2654157
ADDENDAACKNOWLEDGMENT:

AcknowledgmentofReceiptofanyAddendaissuedbytheCityforthisRFPisrequiredbyincludingtheacknowledgment with your proposal.

FailuretoacknowledgetheAddendaissuedmayresultInyourproposal being deemed non- responsive.

Inthespaceprovidedbelow, pleaseacknowledgereceiptofeachAddenda:Addendum( s)# 1, 2, 3A, 5,& 6 is/are hereby acknowledged. n
22 n
ATTACHMENT" B"
THISFORMMUSTBECOMPLETEDANDSUBMITTEDWITHYOURMANAGEMENTPLAN(Envelope#1)*

NON-COLLUSIONAFFIDAVITTOBEEXECUTEDBYBIDDERANDNOTARIZED

AND SUBMITTEDWITH BID
STATEOFCALIFORNIA)ss

COUNTY OF RIVERSIDE)
Theundersigned,beingfirstdulysworn,deposesandsaysthatheorsheisSenior Vice President of ABM Aviation Inc 7the party makingthe foregoing Proposal. ThattheProposalisnotmadeintheinterestsof, oronthebehalfof,anyundisclosedperson,partnership, company, association, organization, orcorporation; thattheProposalisgenuineandnot.collusiveorsham; thattheProposerhasnotdirectlyorindirectlyinducedorsolicitedanyotherProposertoputinafalseorshamProposal, andhasnotdirectlyorindirectlycolluded, conspired,connived, oragreedwithanyProposeroranyoneelsetoputinashamProposal, orthatanyoneshall refrainfromProposing, thattheProposerhasnotinanymanner, directlyorindirectly, soughtbyagreement, communication, orconferencewithanyonetofixtheProposalpriceoftheProposeroranyotherProposer, ortofixanyoverhead, profit, orcostelementoftheProposalprice, orofthatofanyotherProposer, ortosecureanyadvantageagainstthepublicbodyawardingthecontractofanyoneinterestedintheproposedcontract;thatallstatementscontainedintheProposalaretrue; and,further, thattheProposerhasnot,directlyorindirectly,submittedhisorherProposalpriceoranybreakdownn thereof, orthecontentsthereof, ordivulgedinformationordatarelativethereof, orpaid, andwillnotpay, anyfeetoanycorporation, partnership, company, association, organization, Proposaldepository,oranyothermemberoragentthereoftoeffectuateacollusiveorshamProposal.

BY:

Title: Senior Vice President
Subscribed and sworn to b fore me thic 13dayof December 2019 n
23 ATTACHMENT " D"
THISFORMMUSTBECOMPLETEDANDSUBMITTEDWITHYOURMANAGEMENTPLAN(Envelope#1)*

CITY OF PALM SPRINGS, CA

CONFLICTOFINTERESTANDNON-DISCRIMINATION

CERTIFICATION
ConflictofInterest. ConsultantacknowledgesthatnoofficeroremployeeoftheCityhasorshallhaveanydirectorindirectfinancialinterestinthisAgreementnorshallConsultantenterintoanyagreementofanykindwithanysuchofficeroremployeeduringthetermofthisAgreementandfor oneyearthereafter. ConsultantwarrantsthatConsultanthasnotpaidorgiven, andwillnotpayorgive, anythirdpartyanymoneyorotherconsiderationinexchangeforobtainingthisAgreement.

Covenant Against Discrimination. In connectionwithits performanceunderthisAgreement, Consultantshallnotdiscriminateagainstanyemployeeorapplicantforemploymentbecauseofactualorperceivedrace, religion, color, sex, age, maritalstatus, ancestry, nationalorigin ( i.e.,placeoforigin, immigrationstatus, culturalorlinguisticcharacteristics, orethnicity), sexualorientation, genderidentity, genderexpression, physicalormentaldisability, ormedicalconditioneach a " prohibited basis").

Consultantshallensurethatapplicantsareemployed, andthat employeesaretreatedduringtheiremployment, withoutregardtoanyprohibitedbasis. Asa conditionprecedenttoCity's lawfulcapacitytoenterthisAgreement, andinexecutingthis1 Agreement, ConsultantcertifiesthatitsactionsandomissionshereundershallnotincorporateanydiscriminationarisingfromorrelatedtoanyprohibitedbasisinanyConsultantactivity, includingbutnotlimitedtothefollowing: employment, upgrading, demotionortransfer; recruitmentorrecruitmentadvertising; layoffortermination; ratesofpayorotherformsofcompensation; andselectionfortraining, includingapprenticeship; andfurther, thatConsultantisinfullcompliancewiththeprovisionsofPalmSpringsMunicipalCodeSection7.09.040, includingwithoutlimitationtheprovisionofbenefits, relatingtonon-discriminationincitycontracting.

NAMEOFCONSULTANT/VENDOR: ABMAviation, Inc.

NAMEandTITLEofAuthorizedRepresentative:

Print) D. Scott Hutchison
SignatureandDateofAuthorizedRepresentative:

Sign) —¢ r.

Date) December 13 2019
27 ATTACHMENT" E" ( 5 pages)
THISFORMMUSTBECOMPLETEDANDSUBMITTEDWITHYOURMANAGEMENTPLAN(Envelope#1)*

CITYOF PALM SPRINGS

PUBLICINTEGRITYDISCLOSURE

INSTRUCTIONSFORAPPLICANTS)
Who Must File?
ApplicantsthatareNOTanaturalpersonorgroupofnaturalpeoplethatwillbeidentifiedontheapplication, andseekaCityapprovaldeterminedbya voteofCityofficials.Examplesincludecorporations, limitedliabilitycompanies, trusts, etc. thatseekaCityCouncilapproval, oranapprovalbyoneoftheCity'sboardorcommissions.

Why Must 1File?
TheCityofPalmSpringsPublicIntegrityOrdinanceadvancestransparencyinmunicipalgovernmentandassistspublicofficialsinavoidingconflictsofinterest. TheCity's Public IntegrityOrdinance, codifiedinChapter2.60ofthemunicipalcode, reflectstheCity'sinterestinensuringthatcompanies (andotherlegalentitiesthatarenotnaturalpeople)doingbusinessinthecommunityaretransparentandmakedisclosureastotheirownershipandmanagement, andfurtherthatthosecompaniesdisclosetheidentityofanyperson, withanownershipinterestworthtwothousanddollars ($2,000) ormore, whohasamaterialfinancialrelationshipwithanyelectedorappointedvotingCityofficial, orwiththeCityManagerorCityAttorney.

Note:Amaterialfinancialrelationshipisarelationshipbetweensomeonewhoisanowner/investorintheapplicantentityandavotingofficial (ortheCityManagerorCityAttorney), whichrelationshipincludesanyof thefollowing:
1) theownerfinvestorandtheofficialhavedonebusinesstogetherduringtheyearpriortotheapplication; 2) theofficialhasearnedincomefromtheownerrnvestorduringtheyearpriortothefilingoftheapplication; 3)theownerfinvestorhasgiventheofficialgiftsworthfiftydollars ($50) ormoreduringtheyearpriortothe filing of the application; or 4) theofficialmightreasonablybeanticipatedtogainorlosemoneyorathingofvalue, basedupontheownerAnvestor'sinterestintheapplicantentity, inrelationtotheapplication'soutcome.

When Must I File?
YoumustfilethisformwiththeOfficeoftheCityClerkatthesametimewhenyoufileyourapplicationforaCityapprovaldeterminedbyavoteofCityofficials, whetherelectedorappointed.

What Must I Disclose?
A. Thenamesofallnaturalpersonswhoareofficers, directors, members, managers, 28 trustees, andotherfiduciariesservingtrustsor othertypesof organizations attorneys, accountants, etc.).
nNote: (1) onlytrustsorotherorganizationsthatarenotthefiduciaries, (2) ifasecondentitythatisnotaaturalpersonservestheapplicantentity(e.g., asamemberofanapplicantLLC), thenallofficers, directors, members,managers, trustees, etc., of thesecondentitymustbe disclosed).

B. Thenamesofpersonsowninganinterestwithavalueoftwothousanddollars ($2,000) ormorewhohavea materialfinancialrelationshipwithanelectedorappointedCityofficialwhowillvoteontheapplicant'sapplication, orwiththeCityManagerorCityAttorney.

What if I Have Questions?

PENALTIES
Falsificationofinformationorfailuretoreportinformationrequiredtobereported maysubjectyoutoadministrativeactionbytheCity.

Therearesomeadditionalsupplementaryinstructionswithan
examplefollowingtheformshouldyouneedfurther clarification.

Youonlyneedtofilloutandreturnthenext2pagesofthisAttachment with your proposal
29 OpALAIsA.

PUBLIC INTEGRITYDISCLOSURE
Q• APPLICANT DISCLOSUREFORM
q/ FORN

1. Name of Entity
ABM Aviation, Inc

2. Addressof Entity( PrinciplePlaceof Business)
4151AshfordDunwoodyRd, Ste600, AtlantaGA30339
3:

Localor CaliforniaAddress(if differentthan#2)
651-3WorldWaySouth, LosAngeles, CA90045

4. StatewhereEntityisRegisteredwithSecretaryofState
Georgia
IFother than Californi
Type of Entity
a is the Entityalso registered in California? Yes No5. 3Corporation Limited Liability Company Partnership Trust Other( pleasespecify) a.

Officers, Directors, Members, Managers, Trustees, OtherFiduciaries (pleasespecify)Note., ff anyresponseisnota naturalperson, pleaseidentifyalloflcers, directors, members, managersandotherfiduciariesfor themember, manager, trustor otherentity ABM Industries Inc. Officer Director © Member Managername] General Partner Limited Partner
Other
name]
El Officer Director Member Manager
General Partner Limited Partner
Other
name]
Officer Director Member Manager
General Partner Limited Partner
Other
30 r

7. Owners/investorswitha5%beneficialinterestintheApplicantEntityorarelatedentitEXAMPLE

JANEDOE
50% ABC COMPANY, Inc.
name of owner/ investor] percentage of beneficial interest in entit and name of entitA.

ABM Industries, Inc. 100%, ABM Aviation, Inc.
name of ownerlinvestor]
percentage of beneficial interest in
B. entt and name of entit
name of owner/ investor) percentage of beneficial interest in entity and name ofentiC.
name of ownerlinvestor]
percentage of beneficial interest in
D. entity and name of enti
name of ownerlinvestor] percentage of beneficial interest in E. entity and name of entit
name of owner/ investor] percentage of beneficial interest in of entity)

IDECLAREUNDERPENALTYOFPERJURYUNDERTHELAWSOFTHESTATEOF
CALIFORNIATHATTHEFOREGOINGISTRUEANDCORRECT.

SignatureofDisclosingParty, PrintedName,Title Date
December 13, 2019
D. Scott Hutchison, Sr.Vice President
31 i
City of Palm Springs, CA.

BusinessDisclosureSupplementaryInstructions
Inanefforttoensurewecapturetherequiredbusinessentityinformationinaccordancewiththeattachedinstructions, weprovideyouthesesupplementaryinstructionstoclearlyidentifytherequiredinformation, andtheformattheinformationshouldbeprovided.

Ifyou, astheapplicant, areabusinessentity (i.e. acorporationorlimitedliabilitycompany), anditisalsocomprisedofotherbusinessentitiesasitsmembersorhavingafinancialinterest, allothersuchbusinessentitiesmustalsobedisclosed, includingthoseentitiesotherbusinessentities, if any.

Ultimately, theCity'sdisclosuredocument (attached) requiresalistingidentifyingallnaturalpersonshavinganyfinancialinterestover5% ofthebusinessentities (andanyotherbusinessentitiescomprisingyourbusinessentity).

Asanexample, Applicantis: AcmeBrothers, Inc., aCaliforniacorporation, whoseofficersare:JohnDoe, JillDoe, andJayDoe, whichisowned50% byAcmeBrothers, LLC, aCalifornialimited liability company, and John Doe ( 25% interest) and Jill Doe ( 25% interest). Acme Brothers, LLC, ismanagedbyAcmeBrothers2, Inc., aCaliforniacorporation, whoseofficersare: GeorgeDoe, BillDoe, andJaneDoe, whichisowned100% byAcmeBrothers2, LLC, aCalifornialimitedliabilitycompany, whichismanagedbyGeorgeDoe, withGeorgeDoeandJaneDoehaving50% interesteach.

Thefullbusinessentitydisclosureinthisexamplewouldresemblethefollowing:

1. AcmeBrothers, Inc., aCaliforniacorporation
a. Officers: JohnDoe, JillDoe, andJayDoe
b. Ownership:
t. 50%AcmeBrothers, LLC, aCalifornialimitedliabilitycompanyii. 25% John Doe Ill. 25% Jill Doe

2.AcmeBrothers, LLC, aCalifornialimitedliabilitycompanya. Managers:AcmeBrothers2, Inc., aCaliforniacorporation b. Ownership: 100% AcmeBrothers2, Inc., aCaliforniacorporation3. AcmeBrothers2, Inc., aCaliforniacorporation a. Officers: GeorgeDoe, BillDoe, andJaneDoe
b. Ownership: 100% AcmeBrothers2, LLC, aCalifornialimitedliabilitycompany4. AcmeBrothers2, LLC, aCalifornialimitedliabilitycompanya. Managers: George Doe b. Ownership:
i. 50%
End of Attachment " E"*
32 SectionB - Financial Resourcesand FinancialReferences B_1 Financial Statements
AspertheRFPwehaveincludedourtwoyearsfinancialstatementsintheformofour AnnualReportto Stockholdersfor2017and2018as providedattheendofSectionB.

B_2 List 3 Business References
ABMis proudto presentthefollowingairportclientsfor whomwe haveconductedfinancial transactionsandexpensereportingcrucialtoitsparkinglotand/orshuttlebusoperations duringthepasttwoyears.AspertheRFPwehaveincludedreferencelettersfromeachof the clients listed at the end of Section B.

Eisenhower National Airport, Wichita, Kansas
WichitaAirportAuthority
2211 Air Cargo Road, Wichita, Kansas 67209
Contact: Victor White ( 316) 946- 4700 Email: vwhite(&wichita. gov Contract Term: 1995— Present
Lambert—St. Louis International Airport, St. Louis, Missouri St. Louis Airport Commission
10701LambertInternationalBlvd.,St. Louis, Missouri63145 Contact: Robert Salarano ( 314) 426- 8178 Email: resalaranoCc)_flystl. com Contract Term: 2011 — Present
Denver International Airport, Denver, Colorado
City and County of Denver
Parking and Transportation Department
8500 Pena Boulevard
Denver, CO 80249
Contact: Brian Pokorny( 303) 342- 2535 Email: Jon. aokornyoflydenver. com Contract Term: 1998— Present
B_3 List Bank References/ Credit Standing
ABMAviationis pleasedto submitthefollowingbankreference.Wehaveincludeda letterfrom Bank of America at the end of Section B.

Bank of America
125 South Market Street, 2nd
Floor San Jose, CA 95113
Contact: James Kelliher, Senior Vice President ( 646) 855- 5637 B_4 Bankruptcy
ABMAviationhasneverbeenin bankruptcyorpetitionedthecourtforreliefunderthe Bankruptcy Code or Act.

B_ 5 Unfavorable Audit
ABMAviationhasneverreceivedanunfavorableauditofitsfinancialperformancein conjunction with contractual agreements.
n
1 Management Plan
Section B
B. 2 Business ReferenceLetter( Wichita)
W

IIIII HIT A
Wichita Airport Authority
December 16, 2019
City of Palm Springs
Attention City Manager
3200 E. Tahquitz Canyon Way
Palm Springs, California 92262
REt LETTER OF REFERENCE
Wearehappytoprovidethisletterofreferenceandrecommendationto theCityofPalmSpringson behalfofABMAviation. ABM,ortheirpredecessorcompany,hasbeenavaluedserviceproviderand partnertotheWichitaAirportAuthorityforalmost25years. ABMmostrecentlyearnedthecurrentmanagementagreementforparkingandshuttleoperationsthroughcompetitiveRFPin2017.

WeofferhighpraiseandcomplimentfortheexceptionalperformanceandcustomerserviceABM providesatEisenhowerNationalAirport. InouropinionABMisunrivaledintheairportparking industryin financialmanagement, expenseandrevenuerepotting, andcostcontainment. Their managementofourparkingservicesandshuttleoperationsmeexceptional,andwecouldn't bemore satisfiedwiththeirperformance. TheABMleadershiphasalsoprovidedouragencywithinvaluable consultationandadviceregardingparkingdesign(newgarage,parkingsystems, andPARCSin 2015), parkingpromotionsandmarketing,andarecentlyimplementednewparkingrewamMoyaltyprogram_ Pleasefeelfreeto contactmeif t canprovideanyadditionalor detailedinformation,oranswerany questionsyou mayhave.

R
try
Brad Christopher,A.A1i., Assis t DireMor of Airports
ouYdS. lY®
2173NkCargoRead .Wiehita,Kansas67208.1958
T 3' 6. 946A700 F 316. 945. 4723
www. fri'+ id ila. rnm
4 Management Plan
Section B
r-
B. 2 Business Reference Letter( St. Louis)
ST. LOUISLAMBERT
IMERNATIOtJAL AIRPORT.

December16,2019
City of Palm Springs
Attention:CityManager
3200E.TahquitzCanyonWay
Palm Springs, California 92262
OnbehalfofSt.LouisLambertInternationalAirportI amhappytorecommendABMAviation, Inc,asaparkingfacilityandshuttlesystemoperator. Thecompanyhasdoneexcellentworkat STL,wheretheyoperatefivesurfaceparkinglotsandtwoparkinggaragesonbehalfofthe AirportAuthority. Additionally,ABMmaintainsandoperatesaFleetofairportownedshuttle vehiclestotransportcustomersamongthevariousparkingfacilitiesandterminalcomplex. Their onsitedaytodayoperationiswellmanagedandefficient,andtheyhavebeenextremelyresponsiveto specialeventsandrequirementsfromtheAirport.

T1
Beyondthisstrongdaytodayonsiteoperation,the.AirporthasrecentlyhadoccasiontoutilizeABht'scorporatelevelsupportintheselectionandimplementationofanewPARCSand FrequentParkerProgramforourparkingfacilities. Wewereverypleasedwiththesupportandexpertiseof the corporatelevel smtt:

ThankyouforallowingmethisopportunitytorecommendABMAviation,Inc. Ifyouhaveanyquestions,pleasedonothmitatetocallmy officeat(314)426-8178.

Sincerely777
Robert C. Salarano
Airport PropertiesDivision Manager
POBOX10212110701LAMBERTLaTEInATMNALBLVD.MTN'2276•ST.LBU6.M0B3ws-0212•USA•MANPHONE314.426.m• PtYSTLCOM 1 5
M anagernent Plan
Section B
B. 2 Business Reference Letter( Denver)
FAWN
EN
December 13, 2019
Denver International Airport
Parking and Transportation Department
Airport Office Building,04 Floor
8500 Pena Boulevard
Denver, CO 80249
To whom it may concern:

ABMAviation providesthe comprehensiveshuttle bus managementservicesfor DenverInternational Airport( DEN) for both our Public Passengers and Employees. In 2016, DEN conducted a formal RFP and evaluation process and ultimately chose to work with ABM Aviation.

We chose to work with ABM. Aviation for the following reasons: 1) Knowledge and Experience in Transportation; 2) Flexibilityto meet the needsof their Client and DEN's customers;and3) Proven performance.

Pleasefeel free to contact me if you haveanyquestion. I wish you the very bestin your evaluation processandknowyouwillfindtheABMAviationteamveryknowledgeableandInnovativewith customized and flexible solutions to meet your airport' s ever- changing transportation needs.

Respectfully,
Brian Pokomy
Transportation Systems Manager
City and Countyof Denver,Department of Aviation
303) 342. 2535
Jon. pokornvt@flvdenver. com
DENVER
nr.. v-:. h,.. e., w: a,,. w. tv} r, a. nve: on•.!; r, . a;, 49A: A A fiWj :. np+., v..... . a- ..--.... ,. 6 Management Plan
Section B
B.3( Bank Letterof Reference)
BankofAmerica'I
Merrill Lynch
Dewmber, 12, 2019
Cityof PalmSpringsprocurementandContactingDepartmuM
3200E.TahqultzCanyonWayPalmSpringsCA,92262
Arm:CraigGladden,C.P.M.,Procurement9,ContractingManager RE: Reference letter
PleaseacceptthisletterasconfirmationthatABMIndustries(the"Customer')hasbeenaclientofBank ofAmerica,N.A.(the"Bank')foraperiodofOver90years.

TheBankistheadministrativeagentwithrespecttotheCustomer's$1,700,000,000multHendercredit facility(the"CreditFacility'). TheamountoutstandtrUundertheCreditFadlityIscurrentlyinthehigh9figure rangeTheavailabilityoffundsundertheCreditFacnlryissubjecttocertainterms,conditionsandcovenantsset forth In the CreditFacility.

TheCustomercurrentlyhascash,marketablesecuritiesorotherinvestmentsondepositwiththeBank and in affiliates in the moderate 9 figure range.

ThisletterisbeingproddedasamatterofcourtesyattherequestoftheCustomer. Pleasenotethatthef InformationprovidedbytheBankInthisletterisgivenasofthedateofthisletterandissubjecttochangewithout notice,andIsprovidedInstrictconfidencetoyouforYouOwnuseorgy,withoutanyresporzsiblity,guarantee, representation,warranty(expressedorImplied),commitmentorliabilityonthepartoftheBank,in parents, subsidiariesoraffiliatesoranyofin ortheirdirectors,officersoremployeestoyouoranythirdparty,andnoneof themassumesanydutiesorobligationstoyouinconnectionherewithoranytransactlanbetweenyouoryou affiliatesandtheCustomer. ThisletterisnottobequotedorrefertedtowithouttheBank'spriorwrittenconsent TheBznkcannotprovideanyopinionsofthecreditworthinessoftheCustomeroranyofinaffllams,andthe aboveinformationdoesnotmmUtunanopinionoftheBankoftheabilityoftheCustomertosuccessfully performitsobligationsunderanyagreementitmayenterIntowithyou,theBankoranyotherpersonorentity.

TheBankhasnodutyandundertakesnoresponsfbilltytoupdateorsupplementtheInformationsetforthInthis letter.

Very truly yours,
James Kelliher
SVP;Sr.RelationshipManager
646855. 5637
iames. t keil' he, Mbsml
7 Management Plan
Section B
SectionC - OperatingPlanfor PSP
Management Plan
1 Section C
IdentifyProposedVehicles
ABMAviationproposestouseoneE50FordCutawayShuttleVanwithninepassengercapacity andequippedwithanADA-compliantwheelchairlift.Additionally, ABMproposestoprovideone 4-persongolfcardfor staffmovementwithintheoperation.

Coordinate Operationswith Shuttle BusOperator If Different ABMAviationwilloperatetheshuttleserviceinternallyduringpeakperiods. Shuttleswillbe dispatchedbythetaxidispatcher, whowillmanagequeuelinesthatwillbelocatednexttothe taxi start booth.

CollectingParkingFees/ CreditCards/ Bookkeeping/ Accounting Cashier Procedures
ABMAviationunderstandstheintricaciesinvolvedwiththeSkiDataParkingRevenueControl SysteminplaceattheAirport. Thisunderstandingenablesustoemployprocessesand proceduresthatallowforoptimalhandlingtime, unparalleledrevenuecontrol, accuratereportingandtransactionaccountability. Havingthenecessarycontrolsandprocessesinplacetoensure all exception transactions
canbeverifiedandproperlyaccountedforisessential. ABMunderstandsthisimportanceand hasspecificproceduresforthedifferentexceptiontransactionsthatoccur.Itisinevitablethat parkerswillhavelostticketsandthatsomepeoplewillattempttotakeadvantageofthesystemintheireffortstoescapewithouthavingtopaytheiraccruedparkingfees. Therevenuecontrol systemcurrentlyinplaceemploysatickettovehiclecheckandbalancesystemthathelps prevent system manipulation.

Allexceptiontransactionswillbeauditedthefollowingdaytoensureaccurateprocessingand verifythevalidityofthetransaction. Additionally, allexceptiontransactionswillbetrendedtothecashierprocessingthetransactiontoensureourinternalcontrolsareinplaceandanysuspect trendscanbeproperlyinvestigatedandrespondedtoifneeded.

Financial Controls
Ourparkingmanagementphilosophyensuresweprovidethehighestcaliberofrevenuecontrolandexceptionalservicetoourclients, customersandemployees. Ourmanagementand organizationalapproacharedrivenbyresults. Weempowerourlocalmanagementteamto executethenecessarystepstoaccomplishsite-specificgoals, whilemaintainingrevenue controlandcompanyguidelines. Weincorporateourcorevalues (respect,fairnessanddignity) intoeverybusinessdealingtoguaranteedesiredresults. OurABMAviationteamunderstandsthedynamicsinvolvedinmanagingtheparkingoperationsatamajorairport. Thesedynamics canchangewithoutnotice, thusmakingitessentialtohaveateamonthegroundthatcanmake decisions, rapidlyadjustandimplementchangesrelativetoourbusinesswhilelimiting operational impacts.

WewilldevelopsitespecificcashcontrolprocedurestomeetthedemandsofthePalmSprings InternationalAirport.Theseprocedures, whichincludereportingstructure, cashieringoperations andrevenuecollection, areinplacetoaddressallaspectsofparkingrevenuecontrol. 2 Management Plan
Section C
r-
Revenue Collection
Asaprofessionalparkingservicemanagementcompany,ABMAviationhasdeveloped collectionprocedurestomeettherequirementsofthePalmSpringsInternationalAirport. Our Proceduresaredevelopedtoprotectourclient'srevenue,thecompany'sreputationandouremployee'ssafety. Eachemployeeisthoroughlytrainedinrevenuecollectionandcash accountabilitybeforebeingallowedtoactasacashier. Ouremployeesaretrainedtobe proficientintheuseofcashierterminals, whichteachthebenefitofkeepingallcurrencyneatlystoredinclosedcashdrawersandrequirefrequentdropstothesafe. Similarpracticesand proceduresweredevelopedfortheproperacceptanceandreconciliationofcreditcardsand checks.Employeesunderstandtheimportanceofproperreporting/reconciliationofallrevenue.

Forms of Payment
TherearemanywaysABMAviationcollectsrevenue. Thefollowingdetailsacceptableand unacceptableformsofpaymentaswellascorrectcashhandlingprocedures.

Acceptable Forms of Payment Unacceptable Forms of Payment Cash ( US Currency only) Non-UScurrency
Checks
Counterfeitcurrency
Visa and MasterCard Checks with addresses
r American Express out of the country
Discovery Checks drawn on banks out of the
Traveler' s check( US only)
US
Two-party checks
Cash Transactions
Ifacustomerispayingcash, thecashiermuststatetheamountofcashpaid.Allbillslargerthana$20mustbecheckedwithacounterfeitpen.Afterexecutingthetransaction, thecashierwillcount the change back to the customer.

Handling Basics
Thecashiermustalwayssecurethemoneyinthecashdrawer.Thecashierwillcallthe supervisorforchangebeforetheyneeditandwillcheckeverybillof$20orlargerwitha counterfeitpen. Thecashierwillmakeacashdropanytimetheyaccumulate$300inthedrawer.

TravelersChecks—U.S. Only
Traveler'schecksareconsideredaformofcash. Thecustomermustsignthesignaturelinein thecashier'spresence. Apre-signedtraveler'scheckisneveraccepted.Thecashierneedsto askthecustomerfortheirdriver'slicenseandverifythatthenameonthelicense.matchesthe nameonthetravelerscheck.Thesequencenumberofthetransactioniswrittenin'theupper right comer of the travelers check.

PersonalandCompanyChecks
Checksmayonlybeacceptedfortheexactamountduethatshowsonthepaymentscreen. Itis neveracceptabletogivecashbackon acheck.Whenthecustomerpresentsthebankcheckto Management Plan
3 Section C
payforthetransaction, thefollowinginformationmustbeprintedonthecheck:makersfull name, complete address and telephone numbers.

Credit Card Transactions
Inrecentyears,theparkingindustryhasseenatremendousgrowthinthenumberofcreditcard transactionsrelatedtoparkingpaymentsfortransactionsfewerthantwentydollars. We anticipateitscontinuedgrowthasthiscontinuestoproveaneffectiveandsecureformof payment.Accordingly,ourstaffmembersaretrainedinthefollowingproceduresforhandling credit cards transactions.

Cash Back
Likechecksallcreditcardtransactionsareprocessedintheamountofthetransactiononly.

Cashis nevergivenbackfroma creditcardtransaction.

Credit Card Exceptions
Asmallnumberofattemptedcreditcardtransactionscannotbecompleted.Therearemany reasonsforthis, includingproblemswiththeequipment. Itis imperativethatthecashiermake everyefforttoassistthecustomerwithoutassumingtheproblemiswiththecustomer'scard.

Denied or Declined Transaction
Declinedisdifferentthandenied. Adeniedtransactionoccurswhenthecreditcardprocessing companyisunabletoapprovethetransaction. Inthiscase, thecustomermaybegiventheoptionofusinganothercreditcardorpayingcash. DeclinediswhenthePARCSdoesnot process the transaction.

Invalid Entry Required
InvalidTransaction-ManualEntryRequired" generallymeansthatthereadercouldnotidentifytheinformationonthecard'smagneticstrip. Allmanualcreditcardtransactionsmusthavean imprintofthecardmadetoprovideverificationthatthecustomerusedthecard. Itisimportant thatallinformationisrecordedonthemanualreceipt: Customer'sname, accountnumber, card'sexpirationdate, amount, dateoftransaction, lane, cashiernumberandcustomer's signature.

PCI Compliance
ABMhasthehighestlevelofmerchantcertification. MargaretKann, ourDirectorofPCI compliance,isconsideredasubjectmatterexpertonPCIcomplianceandfrequentlyadvises ourairportclientsregardingPCIcompliance.ABMAviation'sproposedmanagementfeeincludes $7,000toupgradeSkiData'screditcardprocessingtoP213. P2Pprovidesforcredit processingterminalsthatareencryptedbythepaymentprocessingcompanyandthensealedfromaccessbytheterminalusers. P2PnotonlyoffersthemostsecuremeansforprocessingcreditcardtransactionsbutreducestheAirport's liabilityincaseoffraudorhackingandcan haveasignificantimpactontheentireCityofPalmsSpring'sPCIcomplianceexpensesifthe revenuecontrolsystemsharestherestoftheCity'snetwork.

Exception Transactions
Therearetwotypesofexceptiontransactions. Oneexampleiswhenoneofthepiecesneeded foranormaltransaction (ticketorpayment)ismissing. Anotherexampleiswherethe customersactualpaymentvariesfromthefeescalculatedbythesystem.AllexceptionsmustberecordedontheCashierReport. Mostexceptiontransactionswillbehandledwiththe supervisor's approval.
4 Management Plan
Section C
r-
OperatingandMaintainingtheRevenueControlSystem
ABMAviationwillberesponsibleformaintainingandoperatingallparkingequipmentandvehiclesnecessarytomeettheprojectscoperequirements. ABMwillneitherhavenorallow accesstoparkinglottransactioncountingdevicesassociatedwithexitgates, exceptinthe presenceoftheCityauthorizedrepresentative.Additionally, ABMAviationpersonnelshall witnessallaccesstosuchparkinglottransactioncountingdevices.ABMwillnotifytheAirportwhenmaintenanceisneededonanyCity-ownedequipmentandfacilitateAirportaccesstosuch devices, uponrequest. ABMAviationstaffwillnotifytheContractAdministratorimmediateof anymalfunctionorbreakdownofanyparkinglotequipmentsupplyingauditdataoraffectingparkinglotingressoregress, andshallgivetheContractAdministratornoticeofthedateandtimesuchmalfunctionorbreakdowniscorrectedandrepaired. ABMwilltransmitwritten confirmationonallsuchinformationtotheContractAdministrator, withintwenty-four(24)hours.

AsreflectedintheinformationprovidedinSectionA,ABMAviationhasextensiveexperiencewithmaintainingandoperatingSkiDatarevenuecontrolsystemssuchasthesystemusedat PalmSprings.ABM'sexperienceincludestheabilitytotrainABMstafftomaintainasmuchof thesystemaspossiblelocally—avoidingtheexpenseofservicecallsandfullyunderstandingthemaintenancecontractswhichallowsforSentry,themaintenanceservicecompany,tobeheldaccountablefortheresponsibilitiesunderthecontract.ABM'sstaffwillbetrainedat Level1maintenancesuchasreplacingdamagedgates, clearingticketandreceiptpaperjamsandresettinghardwaretobringthesystembackonline_ ABMhasextensiveexperiencewithSentryinsouthernCaliforniaandwillbeabletomaximizetheeffectivenessofSkiData system. Partofmaximizingthesystemisunderstandingthemostappropriatelevelofservice scheduling, thevalueofincludingsparepartsandPCIupgradesintheannualbudgeted costsandkeepingthesystem'ssoftwareupdatedatthebestlevel. Thebestlevelisnot alwaysthelevelrecommendedbySkiDataandSentrysalesstaff.Forthisreason, ABM AviationhaspricedthefollowingSkiDatamaintenanceintothemanagementfee:

ServiceCoverage—SkiDataoffersfourlevelsofservicecallplansrangingfromBasic Monday—Friday, 0800 —1700) with24-hourresponsecommitmenttoPremiumPlus Monday—Sunday,24hoursperday)witha4-hourresponsecommitment. ConsideringtheconfigurationofPalmSpringAirport'sentryandexitplazas, ABMhaspricedthe serviceresponseattheExtendedpackage: Monday—Friday, 4-hourremoteresponse, 24-houronsiteresponse, incidentresponseincluded, quarterlypreventivemaintenance, quarterlysystemperformancereviewand4 hoursofannualtraining.

SpareParts—Sparepartswillbeincludedinthemaintenancepackageexceptfor expendableparts —whichis normalin the industry.

PC] Supporthasbeenincludedinthepricedmaintenanceplan. Theplansupportsboth thesoftwareaspectofthesystemandsupportformaintainingsecurityofloginsand administrative rights.

Inadditiontotheannualmaintenanceplan, ABMAviation'smanagefeeincludesthemost recentupgradeoftheWindowsLicensingandhardwaretosupportthediscontinuingofsupportforWindows7thatwillgointoeffectonJanuary15, 2020. Thisupgradewillcost$19K.

Removal of Vehicles
AbandonedvehiclescancreateunsafeandunprofitableconditionsatPalmSprings InternationalAirport. Thedetectionandremovalofthesevehiclesisvigorouslypursued. Atthe conclusionofthenightlyinventorytheassignedinventoryclerkorsupervisorwillreviewthelistn Management Plan
5 Section C
ofinventoriedvehiclesandnoteanyvehicleparkedinexcessof30days.Vehicleslefton premises30dayswithoutnotificationfromtheregisteredownerarerecordedonan'abandoned vehiclereportandturnedinto managementfor follow up. Cityauthoritiesare providedthe updatedabandonedvehiclereportwith detailedvehicleinformationandrequestedto runthe vehicle's VIN to determinethevehicle's registerowner's nameandaddress. At this timethe vehicleischeckedfor a possiblestolenvehicle.ABMwillcontacta third-party liensalecompany tohandleandprocessthepaperworkregardingallabandonedvehicles.Theliensalecompany willattemptto contacttheownerfollowingtherequisiteprocedures. If theownerfailsto respond, thepaperworkwillbeprocessed, andABMcontactedtohandlethefinalsaleofthe vehicle.Allrevenuecollectedfromabandonedvehiclesisincludedinthedailyrevenuewithall transaction documentation added to the daily records.

License Plate Inventory ( LPI)
Theimplementationofaparkedvehicledailycount, whichisundertakenthroughtheprocessof theLicensePlateInventory(LPI) System,isoneofthemoreimportantcheckfeaturesofan Airport's internaloperationsandrevenuecontrol. Longterm parkingfees constitutea sizable portionofthetotalAirportparkingincomeandthereforeimportanttomaintainanaccurateandupto'dateLPISystem.TheLPISystemwillenablethecashierandtheparkingofficestaff,even withoutthebenefitoftheparkingticket, todeterminethelengthofstayandthefee. The inventorycanalsobelinkedandrelatedtoquantitiesofticketusage, ticketscollected, and ticketslostsothatoperatingdatarelatingtotheseissuesmaybecollated, analyzed, and eventuallyusedasabasisformanagerialdecisions. AdescriptionofatypicalABMAirportLPI Procedure follows:

Physical Count
AphysicalcountofallvehiclesparkedwithintheAirportparkingareaisperformedeachnight between the hours of 12:00 AM and 6:00 AM by parking area.

License Plate Inventory
LPIisprocessedusingahandheldmenudrivencomputer,whichwhenusedtogether withitscentralcomputerunit, comprisesasystemthatpossessesthecapabilitytoallow:

Data input and output.

Dataprocessing; enablingtheuserto updateexistinginformation.

Reportgeneration; enablingtheusertoview,analyze, andprintinventoryresults.

Thecapabilitytosearchforspecificlicenseplatenumberstodeterminelocation.

Theabilitytodeterminethenumberofvehiclesparkedandavailablespaces.

Hand- Held Unit
Thehand-held (HH)unitis asmallcomputerwhichisusedbytheinventorytakertoinventory theassignedareabylevel, row,andspace.TheHHwilldirecttheuserastowheretostartand finishandwillmaintainthepreviousday'sinventory. Ifanewplatenumberistobeenteredinto aspace, thenewnumberistypedovertheoldplatewhichisautomaticallydeleted. Oncethe LPIhasbeencompleted,allunitsaredownloadedtotheInventorySysteminorderto update theLPI. ABMAviationdoesnothavethedetailsofthecurrentLPIsystembeingused. Itisour intentiontocontinueusingthecurrentsystem.Ifthisisnotpossible, ABMwillnotifytheAirport Management Plan
Section C
ofwhatLIPsystemis beingproposed.

Parking Lot Cleanliness/ Maintenance
Themaintenanceofthesurfacelotsandstructuralfacilitiesisaveryimportantportionofthe parkingoperation. AlthoughABMAviationisnotresponsibleforthemaintenanceoftheAirport parkinglots, ABMemployeeswillensure, aspartoftheirdailyroutine, tokeeptheareapickedupasmuchaspossible. MorecomprehensiveissueswillbereportedimmediatelytotheAirport.Thefacilitywillbeinspecteddailyanddeficiencieswillbenotedinthehandheldmaintenance trackingunit. Theinspectionresultswillbeforwardedelectronicallyviaemailtothedesignated Airportpointofcontact.Thissystemwillallowdeficienciestobecommunicatedquicklyandallowfor maintenanceissuesto be trackedover time.

Customer Service Amenities
Parker Assistance
ABMwillprovideseveralvehicleassistancesservicestothecustomersoftheAirportparkingoperation. Theseservicesmustbeperformedefficientlyandeffectivelytoavoidanyinjuriesand/ordissatisfiedcustomers.Beingvisible, awareandobservantdemonstratesourreadiness toassistcustomers. Findingandservingpatronswhoappeartoneedassistancewilldecrease stressandimprovetheparkingexperience. Someoftheservicesweassistcustomerswithinclude:

Jump Starts
Tire Inflation / Spare Installation
Lock Out Assistance
Helping to Locate a Lost Vehicle
Assist Customers Who Run out of Gas
Arrangea VehicleTowiftheCustomer's CarCannotbeStarted (towat customer's expense)
ABMpersonnelwillprovidetheassistancedirectlywithsomeoftheissues. Withtheothers, ABMemployeeswillprovidethecustomerwiththird-party,optionsandsupporttocontactthe providers.

Establishand Maintain a High Levelof Customer Service
ABMAviationiscommittedtoqualityinallaspectsoftheparkingindustryandtheparkingoperationisguidedbymeasurementsofsuccess.ABMwillestablishaviablecustomerservice programandlevelofserviceandthereaftermonitorthatservicethroughqualitycontrolchecks andbalances.Thiscommitmentisdemonstratedbythevarietyofproceduresandprograms activelyutilizedbyourcompanytomonitorthequalityandsuccessoftheparkingoperations.Perthecontract, ABMwillresponsetoanycustomercommunicationwith24hoursand document the response.

ItisimportantthatcustomershaveagreatexperiencewhenvisitingPSPandthisexperience includestheparkingoperation. Theseareafewprogramsthathavebeenimplementedwith Management Plan
Section C
favorable results and will be implemented at PSP.

Customer& Client Surveys
Surveysareperiodicallydistributedtosolicitfeedbackonthefacilityandthelevelofservices.

Theresultsofthesesurveyswill besharedwithPSPto identifyissuesorconcernsfromthe customer'sperspectiveandtohelpusdevelopsolutions. Inadditiontosurveyingcustomersofthefacility,wealsodistributesurveystoeveryclientonanannualbasis. Overthepastseveral years, ABMhasconsistentlyachievedaccumulatedscoresof90% orhigher.

Mystery Parker Program
Anindividualsentbyourthird-partyauditorposesasapatronandratesthetreatmentheorshe receivesfromtheparkingpersonnelanddocumentsthevisitwithhis/herreceiptandpictures wherenecessary. Positivefeedbackresultsinafavorablereviewandimmediatereward (dinner fortwo, movietickets, etc.). Negativefeedbackresultsinconstructivecriticismandtargetpoints forimprovement.Thefrequencyofmysteryshopscanbeasfeworasmanyasdesiredtoensure quality performance.

Complaint Resolution
ABMstrivestoresolvecustomerissuesandcomplaintsassoonaspossible. Ifaproblemarises atPSP, customerscansimplyasktospeaktothemanageronduty.Ourmanagersaretrained incustomerserviceandarefamiliarwithmanyofthesituationstheymaybeconfrontedwith.

Thishotlinenumberandwebsiteaddresswillbepostedatthefacilitiesandinshuttlebuses, so customersknowwheretoforwardcomments,suggestionsorcomplaints.Whetheracustomer callsthehotlinephonenumberorsendsanemail, theissueorcomplaintisloggedintoa complaintdatabase. Thedatabaserecordsthecustomer'sinformation,detailsofthecomplaint, statusofthecomplaintandfinaldetermination. Thecomplaintdatabasesendstheissuetothe General Manager for investigation.

Quality AssuranceInspection
ABMalsohasitsownin-houseQualityAssuranceTeamtoensurethateachofourcustomer serviceobjectivesisattained. AmemberoftheCIAteamwillvisitthefacility,unannouncedand performacompletequalityassuranceinspection. Theresultsoftheinspection, whichmayalsoincludespecificemployeeevaluations, willbereviewedwiththeclient'smanagementstaff.The inspectioncoversspecificsinfiveareas: Personnel/Courtesy, Office/BoothAppearance, Structure/SurfaceLotConditions, EquipmentandSignage/Graphics. Thecompletedinspection willbegiventotheGMandAirportmanagementwithafollowuponanyoutstandingitems within 30- 60 days.

Traffic Enforcement Operations
ABMAviationinitiatethebaseschedules(PeakandNon-Peak)providedforintheRFP.ABMwillmeetwiththeAirportwithin90daysofthestartofthecontractandreviewtheschedulefor allthepositions. Atthattime,ABMwilleitherproposechangesorproposetoremainattheexistingstaff.Exactshiftscheduleswillbedeterminedduringthetransitionperiodasemployees 8 Management Plan
Section C
are.onboarded. ABMwillseeabalancebetweenofferingfulltimepositionswithbenefitsand parttimepositionsthatoffertherequiredflexibilitytocovercalloffswithsuchasmallworkforce. emaenrorcer• m mnan rzox
2 ] D A, 2S
aH Y
vacs y . e to p
f M xe'!Ya ec
i. 45 C
t4Y'3kt
b ? q
y
Yf t
fraf( i,( amen- n
u. w fm iu is nn
Y A• S A
y Y. 1 2
ABMAviation's experienceincurbsidemanagementincludesawidescopeofresponsibilities. In somelocations, suchasSeaTac,ABMemployeesonlyreportviolationstoAirportstaffwhothen decideifpenaltiesaretobeapplied. Inotherlocations, suchasSFO,ABMstaffnotonlyissue theviolationstotheprovider, buttheyconductinitialhearingsregardingsuspensionofoperating privileges. UnlessthereisanimmediateneedtogetAirportinputonprocedures, ABMwill maintaincurrentpracticesand meetwith theAirportwithin90 daysof thestart of the contractto discuss possible improvements.

Training Standards
QualityStaffRecruitment&Training
ABMAviationtakesextraordinarycarewithrespecttothehiringandtrainingofnewpersonnelToensurethatourhiring,andtraininggoalsaremet, wehaveassembledoneofthefinest HumanResourcesDepartmentsintheindustry; onewhichisdesignedtoserveasanextension ofthelocaloperatingteam. TheHumanResourcesDepartmentplaysaninstrumentalroleinthe hiringprocess, aswellasprovidingneededadviceonallemployee-relatedissuesandexpertise intheintricaciesoflaborlawandregulations, whichleavesourOperationsDepartmentfreeto focusontheongoingsmoothandsuccessfuloperationofyourfacility.

Recruitment
ABMrecruitsfromvarioussourcesincludingonlinejobpostings, newspaperadvertisements, jobfairs,jobplacementcenters, educationalinstitutionsandoneofourmostsuccessful,employee referrals.ABMrecruitsnon-managementpersonnelthroughtheabovelistedmethods.

Managementpersonnelaretypicallypromotedfromwithin. However,ABMdoesrecruitquality managementpersonnelthroughjob postingwebsitesand referrals.

The Hiring Process
ThehiringprocessbeginswiththeHumanResourcesDepartment,whichisinvolveddailyinthe screeningofapplicants, witha viewtowardfindingthemostqualified, customerservice-oriented employeesinourindustry.Jobcandidatesmustsuccessfullycompleteamulti-steprigoroushiring process which includes:

Applications - All interestedpersonsare invitedto completean applicationon 1 ourwebsiteatwww.abm.com/careers.ApplicationsarereviewedbyourHR Management Plan
9 Section C
Departmentandselectedapplicantsareinvitedintocompletethehiring process. Potentialapplicantsarewelcometoapplyformultiplepositions.- Interview-ApplicantsareinterviewedbyanHRrepresentativeto ensurethey meetthe criteriaof the specificjobthey haveappliedfor andthe HR representativewill makeatentativeofferof employment,pendingthe outcome ofaprescreeningprocess, whichincludestestingfor substanceabuse, acriminalbackgroundinvestigation, referencecheckand, in thecaseof drivingpositions,a Departmentof MotorVehiclesReport.

Uponsuccessfulcompletionoftheprescreeningprocess, thejobofferisconfirmed,andallnew hirepaperworkiscompleted.TheHumanResourcesDepartmentthenauthorizestheuniformcompanytoprovideuniformsandschedulesthenewhiretoattendorientationtraining.

Employee Retention
Inordertoencourageparticipationamongstemployeestoprovidesuperiorcustomerservice, maintainasafeandcleanfacility,andmostimportantlyremainanABMemployee,wehave createdanumberofemployeeincentiveprogramsthatcanbeimplementedattheAirport.

ImmediateRecognition -TheImmediateRecognitionprogramwasdesignedto recognizetheemployeethatdoesaqualityjobexactlyasexpected. Itisimportantto rewardtheemployeethatshowsupeveryday,ontime, andperformshis/herduties exactlyasexpected.CreatingthisrecognitionawardgaveourManagementstaffthe opportunitytoprovidemoreemployeeswithapatontheback!
RewardsincludeaCertificateofRecognitionanda smallgiftsuchasmoviepasses, lunchmoney(McDonalds, BurgerKing, etc.), adayofforanABMlogogift OutstandingLocationoftheQuarter-Oneofourmostcompetitiveawardsbestoweduponourfacilitiesisour"OutstandingLocationAward" (OLA).Attheendofeach quarter, theBranch/RegionalManagernominatesafacilityfromhis/herbranchinspecificsize. Inordertobeconsideredforthisawardthestaffatthefacilitymustwork together to meet the following criteria:

ImplementationandcompliancewiththeCustomerCourtesyProgram.

Positive Quality Control Inspections.

Overall appearance of all employees.

Claims Management.

Complianceof StandardOperatingProcedures (SOP)
Attendance of all employees.

Input from customers, ability to handle problems properly.

Revenue and expense management.

Abilitytointerfacewiththeclient'smanagementstaff.

General attitude and enthusiasm of employees.

Thecommitteeselectsthewinnerbasedonthecriteriastatedaboveandpresentsthe awardstothewinningfacilitiesinaspecialceremonyheldatthefacility.Theaward includesanOLAPlaque, acertificateofrecognitionandanOLAlapelpinforeach employee and a cash award for the Manager.

EmployeeDrawingsI Recognition -ABMhasEmployeeRecognitionprogramsthat cantakevariousformsdependingonthesizeofthelocationandnumberofemployees.

Employeesmeetingdailyrequirementsareentereddailyintoadrawingwheretheycan 10 Management Plan
Section C
winprizes. Theprogramcanbeongoingwithentriesaccumulatingforweekly, monthlyand/or quarterly prizes.

BirthdayRecognition- Ifanemployeeisworkingontheirbirthdayitisniceto recognizethatemployeewitha cardorcupcakeduringtheirlunchbreak.Again, employeesthatfeelapartofafamilyandteamenvironmentwillperformwithall customersinmind: bothexternalandinternalcreatingagreatteamworkenvironment.

ManageroftheYear-Towardstheendofeachcalendaryear, aManageroftheYear isselectedfromeachofthepreviouslymentionedcategories. Thenominatingand votingare competitiveandthe winnerselectedbysecretballot. Winnersareannounced attheendoftheyearandrecognizedinaspecialceremony.

ShiningStarAward-TheShiningStarawardisgivenattoemployeesthatstandout inCustomerServicealwayssmiling, assistingcustomers, withapleasantattitude, and makingeye contact. OnlyemployeesinParkingAttendants, Valets, Cashiers, and ShuttleBusDriverscanbenominated. Thehonoreesarerecognizedattheendofeach yearintheHRNewsletterandreceiveacashbonusandaShiningStarTrophy.

PromotionalOpportunities-ABMisproudtosaythatmanyofourmanagement personnelbegantheircareersinthefield, eitherascashiers, valetattendantsorclerks andhaveexcelledthroughtheranksandbecomesomeofourleadersoftoday.

Promotionalopportunitiesexistforallouremployees. Employeesareencouragedto learn, askquestionsandtakeadvantageoftrainingorpersonaleducational opportunitiesto be readywhen promotionalopportunitiesbecomeavailable.

Employee Development Programs
ABMprovidesnewhireandretrainingopportunitiesthroughoutanemployee'scareerwithABM Aviation. Outlinedbelowwehaverecappedourtrainingprogramsbeginningwithnewhire orientationandthenongoingtraining. EmployeesareissuedanEmployeeHandbookupon hiringwhichoutlinesthecompanyexpectationsaswellastheirbenefits.

Comprehensive Orientation
ABMAviationbelievesthehiringprocessisoneofthemostcriticalaspectsofanysuccessful operation. Inturn,wehaveestablishedanemployeeorientationprogramthatis unsurpassedin the parking industry. New Hire Orientation includes:

All AboutABM andABMAviation- Employeesareprovidedwiththebasicbackground knowledgeandphilosophyofwhoABMandABMAviationareandwhatourphilosophyis.Additionally, allnewhiresareissuedanEmployeeHandbook.TheEmployeeHandbook containsdetailedinformationonalltheissuesdiscussedduringorientation, however,we realizeemployeesneedto refreshtheir memoriesandanswerquestionslater; the EmployeeHandbookwillservejustthatpurpose.

Benefits -Newemployeesobviouslyhavequestionsaboutthebenefitstheycanexpect fromtheirnewcompany.Webeginbyoutliningtheirhealthandwelfarebenefits, if applicable. Thenemployeesareadvisedoftheholidayschedule, vacationpolicies, stock purchaseoptions, 401K plan, availablescholarshipprograms, andABMAviation's Roadmap to the Future.
n
SafetyintheWorkplace -ABMAviationtakesacriticalviewofworkplacesafety,asthere 11 Management Plan
Section C
isnothingmorebasicthanthesafecompletionofalljobtasks. Thisisespeciallytrueina typicalparkingfacility,whereactivityiscontinuousandoccasionallyhectic. Allnew employeesarefamiliarizedwiththeABMAviationSafetyProgram, throughwhichthey learntorecognizepotentialhazards, correctexistingproblemsandconductsafety maintenanceinspectionsto reduceriskor eliminateit altogether.

Safetyawarenesstrainingincludesparking-relatedissueslikevehicledamage,•personal liability, workers'compensationandtheft. Specialattentionisgiventothespecifichazards that comewithcertainjob functions, such as maintenance, parkingattendants, valets, shuttlebusdriversandcashiers. Also, employeesmustbeknowledgeableaboutproper reportingproceduresif anincidentoccurs.

JobSpecifcTraining-Allnewemployeesaregivenhands-ontrainingwithrespecttothe equipmenttheywilluse. Generally,thistrainingwilltakeplacebeforetheemployeebegins hisfieldservice.Newhiresalsoaregiventheopportunitytocomplete,reviewandcorrect theformstheywilluseaspartoftheirdailyactivities, whichpromotesaccuracyand familiaritywithappropriateparkingterminologyandtheparticularsoftheirworksite.

ATrainingManualisissuedtoeachemployeetoprovidegeneralguidelinesand proceduresforperformingspecificjobtasks.Themanualisintendedtoserveasaready referenceguidein thefield.

CustomerService-Toensurethatouremployeesdemonstrateapropercustomerservice attitude, weendtheorientationclasswitha powerfulemphasisoncustomerservice.The philosophyofABMAviationissharedwiththeentireclassandoureverimportant"Whatis a Customer?' plaqueis prominentlydisplayedintheclassroomsetting.

AllthecomponentsoftheCustomerCourtesyProgram, asdiscussedintheCustomer Servicesectionoftheproposal, arereviewedindetailandthegrouppracticesusingthe componentsduringthejob-specifictrainingportionoftheprogram. Forexample,one componentoftheprogramiscalledaTroubleIdentificationWalk.TheTroubleIdentification Walkrequirestheemployeetowalkthefacilityandinspectvehiclesforleaks, brokenlights, lowtires, andpotentialproblems. Theemployeecompletesthe"troublecard"andplacesit onthevehicleinquestion. Customersfindthisserviceanaddedamenity,whilethe presenceoftheattendantsinthegaragecreatesanecessaryvisibilityfortheparkingstaff.

Local and Offsite Management Team
AspreviouslystatedinSectionA.8, ABMAviationwillstaffafulltime,qualifiedgeneralmanageronsitewhowillserveasABM'shighestlocalauthority. Thegeneralmanagerwillbesupported byshiftsupervisorfor80hoursofmanagementpresenceonsiteperweek.ThegeneralmanagerwillbeavailabletoAirport2417. Ifthegeneralmanagerisnotavailable, theshiftsupervisorwillserveastheprimarycontactfortheAirport. ABMwillassign, byname, aperson withqualificationsequaltothegeneralmanager,toprovidesupport, eitherremotelyoronsite, duringtheabsenceofthegeneralmanager. Thegeneralmanager's primaryresponsibilities include but not be limited to:

Full PAL accountability
PrimarypointofcontactfortheAirport'sdesignatedcontractadministrator Review and implementation of all work schedules
Payroll processing
Monthlyreporting —internalABMandAirport
Interviewing,trainingandperformancereviewsofallstaffassignedtothelocation12 Management Plan
Section C
Managementofthe revenuecontrolmaintenancecontract
Thegeneralmanagerisexpectedtomaintainthefollowingqualifications:

Minimum3yearsmanagementexperienceinAirportparkingoperations Excellentoralandwrittencommunicationskills
Minimum5years'directlysupervisingfrontlinecashieringandcustomerservicestaff Abilityto operatea motorvehicleintheStateof California
Abilityto be bondedunderABM internalrequirements
Thegeneralmanagerwillbesupportedbyregionalandnationalexecutivesinthefollowingareas:

Accounting— Los Angeles
Financialreporting —Atlanta
SafetyandRisk Management LosAngeles
Human Resources— Los Angeles
OperationalSubjectMatterExpertise—LosAngeles (ParkingandShuttles), San Francisco (Curbside Management)
IT/PCI— Atlanta & Orlando
Supportforthegeneralmanagerisprovidedbywell-seasonedexecutivesattheDirectoror higherlevelandwillmakeupthetransitionteamaswell. Eachsupportgroupwillmakeperiodic sitevisitstothelocationdependingonthesupportprovidedwithOperationalsupportvisiting onsite quarterly at a minimum.

Management Plan
13 Section C
Organizational Chart
I
3 a
Y
t
t
i
F
x
9 Lh:.

Transition Plan
Transitionsfrom:oneparkingoperatortoanotherareoftendifficult.Butwhenhandled professionally, thetransitioncanstrengthentherelationshipwiththeproject'scustomers.ABMAviationhastransitionedairportoperationsofeverysizeandtypeandourpromisetoyouis thatwewillhandlethetransitionatthePalmSpringsInternationalAirportsothateveryaspect ofthechangeoveriscompletedsmoothly, systematicallyontimeandwithdetailed documentation. OurmostrecenttransitionattheSeattle-TacomaIntemationalAirportwas deemedverysuccessfulbythePortofSeattleanddemonstratesourcommitmenttosuccessful operationseffectiveDayOneofthecontract.We areconfideritthatourextensiveexperience coupledwiththeexpertiseofouron-sitetransitionteamwillallowABMAviationtoexceedthe PalmSpringInternationalAirport'sexpectationsandprovideforaseamlesstransition.

UponawardofthecontracttomanagetheparkingfacilitiesmanagementforthePalmSprings InternationalAirport, ABMAviationwillprovideanexperiencedonsiteTransitionTeamto 14 Management Plan
Section C
facilitatethechangeover. Ourtransitionteamwillbeassembledbyandunderthedirectionof ourSeniorVicePresident, ScottHutchinson. ThisteamwillincludeourproposedGeneralManager, ourACDBEsubcontractorandvariousregionalspecialistsintheareasofoperations, accounting, safety, humanresourcesandinformationtechnology.Althougheachteammember willberesponsibleforoneaspectoftheprocess, webelieveadynamicmanagementteamisthebackboneofasuccessfultransition. Ouron-sitetransitionteamwillbesupplementedas necessarywithsupportfromourRegionalOfficeinLosAngeles. Toensurethatweunderstand exactlywhatisrequiredfromtheparkingoperator, bothMr.HutchinsonandtheproposedGeneralManagerwillbeavailabletoattendregularmeetingswiththeAirportstaffwellbeforethetransitiontakesplace.Weplantohaveourcoretransitionteamassembledweeksin advancesothatampletimecanprepareforthetransition. Inaddition, ourexperiencedstaffis uniquelyfamiliarwiththetransitionprocessatinternationalairportsandasaresultweare confidentthatwewillbeabletofacilitatethetransitiononaminimaltimeframe.This comprehensivetransitionplanwillallowABMAviationtoeffectivelycoordinateoureffortswiththePalmSpringsInternationalAirportduringallstagesofthetransition.

FirstStage (Start Date- 45 days)
Uponverbalawardthecontract,ABMAviationwillimmediatelybegintocoordinatetheoverall transitionprocess. Mr.Hutchinsonwillassemblethecoretransitionpersonnelanddelegate eachindividual'sassignmentsandresponsibilities. TheproposedGMwillimmediatelybeginhistransitiontothePalmSpringsInternationalAirport. TheABMAviationTransitionTeam, includingourDirectorofSafetyandourDirectorofAirportAudit& RevenueControl, will conductacompletewalkthroughandevaluationoftheentirefacilityduringthisstage. In addition, ABMwillsetupameetingattheearliestpossibletimewiththeappropriateAirport contractadministrators) to addressthefollowingissues:
aCoordinationofthetransitionagendawiththeABMTransitionTeamandAirportStaff a Verifystaffing,routeandmaintenanceschedules.

Evaluateequipment/inventoryneeds.
a Ratifyallcontractrequirementsandaddressinsuranceissues.

SecondStage(Start date— 30 days)
Staffing& Training
Atthebeginningofthisstage, theABMAviationtransitionteamwillconductthorough departmentalevaluationsandmakerecommendationstosupplementexistingoperations.Basedontheseevaluations, adefinitivestaffingplanoftheentireoperationwillbedeveloped andsubmittedtotheAirportforfinalapproval. Uponapprovalofthestaffingplan, trainingand orientationwillcommenceforallexistingemployeesacquiredbyABM.Itisourintenttooffer jobstoallcurrentqualifiedparkingpersonnelsothatacorebaseofcompetentemployeeswill remainattheairport. Eachemployeewillberequiredtopassadrugscreenandadetailed backgroundchecktoincludeMVR(driver)verification.Wewillhireanynecessarynew employeesatleastoneweekpriortothetransitionsothattheycanbeadequatelytrainedandready to work prior to takeover.

Inadditiontotheinitialtrainingandorientationofsite-specificpoliciesandprocedures, ABM Aviationwillensurethatallouremployeeshavebeenproperlytrainedonourindustryleading customerserviceprogram.Technicalsupportandtrainingwill be arrangedfor employees Management Plan
15 Section C
involvedwiththerevenuecontrol, accountingandinventorysystems. Eachofouremployeeswhodrivevehiclesmustcompleteourdrivertrainingprogram, aswellasourDecisionDrivingProgram,ABMAviationhassuccessfullyimplementedthisdrivertrainingprogramatallouroperationsnationwide. Thisprogramallowsourdriverstodemonstratecompetencyineachof thethreetrainingmodulespresentedinthecourseincludingVehicleOperations, Emergency Management and Customer Service.

Uniforms
Duringthisstage, ameetingwillbescheduledwithMr.HutchinsonandtheassignedAirportstaffmember(s)tofinalizetheuniformschemeforallpersonnel. Uniformswillbedistributedto employeespriorto thetransitiondate.

Forms& Supplies
Also, duringthisperiod, acomprehensivelistofrequiredformsandsupplieswillbecompiled.Allnecessaryformsandsupplieswillbeordered, andeverythingwillbeavailabletobeplaced on siteat leastoneweek priorto the start-up date.

Fixtures, Equipment& Vehicles
Anynewfixturesand/orequipmentrequiredfortheoperationofficefurniture,cornputersandcommunicationequipment.Allexistingequipmentwillbeinspected, andanynecessary maintenancewillbescheduled /performedonanasneededbasis. Anynecessaryvehicleswill be delivered before start- up.

Contractors& Suppliers
ABMAviation'sproposedGeneralManagerwillreviewexistingagreementswithallcontractors and suppliers involved in the parking operations. Contractors and suppliers will be informed of y
theoperatorchangeandtheeffectivedate. Newcontractor!supplieragreementswillbe negotiatedasnecessaryandwillbesubjecttoAirportapproval.

PARCS
Anotherimportantmemberofourteamisanin-houserevenuecontrolspecialist: JeffMiller.

Jeffwillbeinvolvedwiththeinvestigation, selectionrecommendationandifnecessary, procurementofanynewPARC'ssystem.Jeffhasexperiencewithvirtuallyeverytypeofequipmentandunderstandsthe"whatWeofeachscenariotohelpourclientsselecttheright equipmentfortheirproject. Additionally, ournationalPARC'spurchasingrelationshipswithall majorvendorswillallowownershiptotakeadvantageofvolumepurchasediscountsasingle systempurchasercouldn't receive.

Contract Start Day
Thefulltransitionteamwillbeonsiteat00:00hoursthedayofthestartofthenewcontract.

ThegeneralmanagerworkwithAceParkingtocompletetheturnovereffortsincludingfinalinventoryoffinalequipment, turningoveroperationkeysandtransitionofemployeestonew ABM uniforms and forms.

ScottHutchisonwillprovidedirectsupportandliaisonwiththeclient'stransitionteamtoallow thegeneralmanagertofocusonthetransition.

Contract Start Date+ 90 Days
16 Management Plan
Section C
Bytheendofthefirst90daysofthecontract,ABMAviationwillhavegainedtheexperiencetodevelopthefollowingitemsforreviewbytheclient:

Operations Manual
Basedonourfirst90daysofexperience, ABMAviationwilldevelopaStandardOperatingProcedures(SOP)manualdesignedtomeetthespecificneedsoftheparkingandshuttleoperationsforthePalmSpringInternationalAirport. TheinitialmanualwillbesubmittedtotheAirport for approval.

Safety Audit
Bytheendofthisstage, theABMAviation'sSafetyDirectorwillhaveevaluatedthecurrent operationanddevelopedacomprehensivesafetyprogramspecificallytailoredtotheparkingfacilitiesforthePalmSpringsInternationalAirport.

Operational Audit
Finally, onceinoperationfor90days, wewillprovidetheAirportwithacomprehensive operationalandproceduralauditforreview.Aswithmostnewcontractsacquired, thereare typicallymanyareasofconcernthatneedtobeevaluatedandaddressed. Wehavefoundittobeverybeneficialtoourlocalmanagersandcontractadministratorstohavesuchanaudit performed.Aswithmostoperations, auditorscanhelpusrecognizepotentialproblemsandidentify appropriate solutions.

Accounting Methods
TicketHandling—Non-revenue, LostTickets, TicketStorage
SecurityPolicy-ItistheresponsibilityoftheGMtoensuretheproperproceduresarebeingfollowedforthehandlingofnewand/orusedtickets. CompanyPolicyrequiresthatalltickets mustbestoredsecurelywithaccesstotheseticketsbyauthorizedpersonnelonly.NewTickets-AllAirportparkingfacilitiesarerequiredtouseandmaintaina "LocationTicket InventoryLog'; themainfunctionofwhichistodocumentticketinventorymovement.Thelog 1 identifiesthebeginninginventorynumberandtheticketboxesreceivedbythefacilityaswellasthoseissuedtotheentrylaneanddepletiontime.Thelogalsoaidsinidentifyingdiscrepanciesindistribution. Theentireticketinventorypresentatthefacilityshouldberecordedintothelog.Allticketdeliverieswillalsoberecordedintothelog. Allentriesintothelogmustbeinitialedbytheauthorizedpersonnel. Thelogisalsousedtocalculateaveragemonthlyusagetoaidthemanager in re-ordering tickets.

UnusedandProcessedTickets-Allusedorprocessedtickets, includingotherformsusedfor processing, mustbestoredproperly.Ticketsarestackedchronologicallyandbundledwitharubber-band,journaltapeandcopyofthecashiershiftreport.Allticketsareconsolidatedand baggedbydateandkeptinasecurearea. TicketswillbestoredaccordingtoAirportorCompanypolicy; whicheverislonger. Upondisposal, ticketswillbeshreddedbyacommercialshredding company.

AirportGM'sarerequiredtoperformticketauditsonaregularbasis. Specialattentionshouldbe directedtowardsthedifferencebetweenthetotalissuedandcollectedandtherelationshipofthisdifferencewiththenumberofvehiclesparkedovernightwithintheparkingareas. The numberofmissing, lost, andvoidticketsaretrackeddaily. Parkingareasarecheckedforanyparkingticketsthatmaybelyingontheground. r^ LostTickets—CustomersthatclaimtheyhavelosttheirticketwillbeissuedaLostTicketform Management Plan
17 Section C
forcompletionandmustproduceID.ThevehiclelicenseplateisverifiedagainsttheLPIfor verificationofpaymentdue. ItshouldbenotedthatSOPindicateslostticketspaymaximumfor each day.

HandlingShiftTickets-Machineprintedinformationonallprocessedticketsmustalwaysbelegibleorcashiersshouldimmediatelynotifyasupervisor. Allprocessedticketsshouldbe segregatedintoappropriatecategories(void, signed, damaged, lost, used, etc.) andbundled togetherwitharubber-bandandlabeledwiththecashiersname, date, andshift.Allexceptions musthaveasupervisor'sorauthorization. Allnon-revenueticketsaresubmittedwiththedaily reportandtabulatedandnotedinthecorrectsectionoftheCashierReport.

ExceptionTransitions-Therearetwotypesofexceptiontransactions. Oneexampleiswhen oneofthepiecesneededforanormaltransaction (ticketorpayment) ismissing. Anotheriswherethecustomer'sactualpaymentvariesfromthefeescalculatedbythesystem.All exceptionsmustberecordedontheCashierReportandrequiresupervisor's approval. Some exceptiontransactionsmaybehandledbythecashiersuchasmutilated, blankorunreadable tickets, validations, or lost tickets
Abandoned Vehicles
AbandonedvehiclescancreateunsafeandunprofitableconditionsatPalmSpringInternational Airport.Thedetectionandremovalofthesevehicleswillbevigorouslypursued. Atthe conclusionofthenightlyinventorytheassignedinventoryclerkorsupervisorwillreviewthelist Ofinventoriedvehiclesandnoteanyvehicleparkedinexcessof30days.Vehicleslefton premises30dayswithoutnotificationfromtheregisteredownerarerecordedonan"abandonedvehiclereportandturnedintomanagementforfollowup. Cityauthoritiesareprovidedthe updatedabandonedvehiclereportwithdetailedvehicleinformationandrequestedtorunthe vehicle'sVINthroughtheDMVtodeterminethevehicle'sregisterownersnameandaddress.

Currentlythevehicleis checkfor apossiblestolenvehicle.

Withcontactinformationforthevehicle'sregisteredowner,ABMmanagementsendsformalnotificationofthevehiclesstatusandadvisestheownerthatthevehiclesubjectbeingsoldata liensaleauctiontorecoupparkingfees. ABMhasestablishedverystrictpoliciesregardingthe saleofabandonedvehiclesatliensalesandmakeseveryefforttoreachtheregisterownerofthevehiclebeforesuchaconclusionisreached.Allrevenuecollectedfromabandonedvehicles isincludedinthedailyrevenuewithalltransactiondocumentationaddedtothedailyrecords.

Lien Sale Vehicles
ABMAviationwillusealiensalecompanytohandleallaspectsoftheliensaleshouldthe AirportdelegatetheactualsalestoABM.Thecompanywillbenotifiedandprovidedwithall informationrelatedtothevehicle.Theliensalecompanywillprocessthepaperworktoplacea lienonthevehicle.ABMwillbeprovidedwithallpaperworkandwaittherequisiteamountoftime.Atsuchtime,theliensalewillbeadvertisedandhandledbyABM.Allrevenuefromalien saleis depositedintheCity'saccountandreportedasappropriate.

Cashierand SupervisorCashHandling Procedures
ABMAviationunderstandstheintricaciesinvolvedwithmanyparkingrevenuecontrolsystems andABMemployprocessesandproceduresthatallowforoptimalhandlingtime,unparalleled revenuecontrol, accuratereportingandtransactionaccountability. 18 Management Plan
Section C
Havingthenecessarycontrolsandprocessesinplacetoensureallexceptiontransactionscanbeverifiedandproperlyaccountedforisessential. ABMAviationunderstandsthisimportanceandhasspecificproceduresforthedifferentexceptiontransactionsthatoccur.Itisinevitablethatparkerswillhavelostticketsandthatsomepeoplewillattempttotakeadvantageofthesystemintheireffortstoescapewithouthavingtopaytheiraccruedparkingfees. Therevenuecontrolsystemcurrentlyinplaceemploysatickettovehiclecheckandbalancesystemthathelpspreventsystemmanipulation.

Allexceptiontransactionswillbeauditedthefollowingdaytoensureaccurateprocessingandverifythevalidityofthetransaction. Additionally, allexceptiontransactionswillbetrendedtothe cashierprocessingthetransactiontoensureourinternalcontrolsareinplaceandanysuspecttrendscanbeproperlyinvestigatedandrespondedtoifneeded.

CashiersreceivecashierstrainingaccordingtotheStandardOperatingProceduresforABMas wellasrequirementsspecifictothetypeofrevenuecontrolsystemutilizedatthefacility.Cashierswillreceiveinitialnewhireorientation, customerserviceandon-the-jobtrainingaspartofthetrainingprogram. Minimumtrainingisfourhoursandincludescashhandlingprocedures,cashierreportingandreconciliation, registerprocessing, creditcardprocessing, cashiersafety,exceptiontickets, andinsufficientfundsamongothercashierrelatedtasks.

CashierCashHandling
CashiersreceivetrainingaccordingtotheStandardOperatingProceduresforABMas wellasrequirementsspecifictothetypeofrevenuecontrolsystemutilizedatthefacility.Trainingincludespropercashhandlingprocedureswhichincludeticketprocessing, dailyreconciliation, reporting, tickethandling, depositsandexceptions. Uponcompletionof trainingemployeesatSacramentoInternationalAirportarealsoissuedaCashierSOP andTrainingManualcontainingallthedetailsofthetraining. ThefollowingcashierprocedureswillbemodifiedtomeettherequirementsofthePalmSpringsInternationalAirportrevenuecontrolsysteminplaceaswellasfutureenhancements.

ABM — Cash Handling Procedures

1. Cashiers.
a. Atthestartoftheshiftthecashierwillverifyandsignforbeginningshiftbank.b. Shouldacashierrunlowonchange, theyshouldcallasupervisorandrequest change by type and amount.
c. Thecashiershouldalwaysverballyinformthecustomertheparkingfeesandtheamount taken from the customer to be tendered. d. Thecashiermustalwaysmakecertainthatthecorrectchangeisreturnedand counted verbally.
e. Neverleavemoneyoutsideofthecashdrawerorcominglepersonalmoneyf. Thecashdraweristobeorganizedneatlywithallbillsfacingupbydenomination.g. Donotacceptandforeigncurrency. h. Typicallychecksareacceptedonasalastresort, orasdirectedbytheCity.Ifacheckistheonlyformofpaymentavailable, thecashieristocallasupervisor. i. Cashiersarenottoallowexcesscashtoaccumulateandmustmakecashdropsin excessofestablishedlimitswithapprovalandsignatureofa supervisor.

2. Accounting for revenue.
a. Attheendofeachshiftoranytimerevenueisverifiedcashiersarerequiredto accountforallrevenuecollectedandthebankissuedatthebeginningoftheshift.b. Ifacashierisfoundtobeoffby$5.00ormoreoverorshort, asupervisorwillissuea Management Plan
19 Section C
correctiveactionnotice. Ifmissingfundsarelaterfoundthiswillnotnegateanearlier correctiveactionnoticeasthe cashiermishandledthefunds.
c. Cashiersareauditeda minimumofonceperweekperrevenuecontrolprocedures. d. Supervisors.
e. Atthebeginningofacashiershiftasupervisorwillissueandhavethecashiersign fora bank/tillwhichwillbetheInPaymentwhenthecashierlogsintothePARCS system. Generally, the amountof the bank/till is$200.00. f. Supervisorswillberesponsibleforconductingrandomcashierspotaudits g. Shouldasupervisorreceiveacallfromacashierstatinghe/shehasacustomerwho hasnootherwaytopaytheparkingfeeotherthanacheckthesupervisorgoesto that cashier's booth. In orderto acceptchecks,thesupervisormust:

1. VerifythecheckisfromalocalbankandcheckthecustomerI.D. andverifyit matches the name on the check.

2. Verifytheaddressonthecheckmatchestheaddressonthecheck.

3. Recordthevehiclelicenseplatenumberonthecheck.

4. SupervisormustpolitelyandprofessionallyinformthecustomeroftheAirport's policyregardingchecksandacceptingthecheckforthetransactionisan exception and honored one time only.
h. Attheendofacashiershiftthesupervisorwilljointlywiththecashierverifythecash amount received during the cashier shift.

I. Whentherevenueverifiedthesupervisorwillinstructthecashiertodepositintothe safeallthecashlesstheamountofbank/tillissuedatthebeginningoftheshift. j. Change fund.

1. Supervisorsareresponsibleforaccountingforallmoniesinthechangefund.

2. Atthebeginningofeachshiftamemberoftheincomingshiftandamemberof theoutgoingshiftwilljointlyverifyallchangefundsbydenomination.

3. A SafeCashCountSheetwillbecompletedandsignedbyboththeincoming and the outgoing supervisors.

Supervisor Cash Handling
EachCashierandSupervisorisresponsiblefortheirownmoneyandcashdrawer.Whenan employeeisprovidedwithalunchthecashierremoveshis/hercashdrawerandthesupervisororrelievingcashieruseshis/herowncashdrawer; thiseliminatesmultiplepersonsbeingresponsibleforthesamecashdrawer.Therearetimeswhenmoneywillchangehandssuchas:

Issuing/turninginbanksIssuingchangefunds
Makinga cashdropforexcesscashinthedrawer
End of shift cash verification
Duringsuchtimes, theSupervisorwillverifythecashjointlywiththecashier. Proceduresareinplacethatrequiresignatureswhencashistransferringownership. Cashiers, however,dropfinal revenue for their shift directly into the drop safe.

Use of Automated Payment Systems
ABMhasextensiveexperienceinusingautomatedpaymentsystemsatairports, hospitals,commercialofficecomplexesparticularlywhentransitioningthosefacilitiesfrompay-on-exitor partialautomationtofullautomationwhichiswhatwearerecommendingforPalmSprings International Airport.
20 U
Management Plan
Section C
ExperiencewithTransitioningfromCashieredtoAutomated
ABMisexperiencewithsuccessfullytransitioningparkingoperationstototalautomation. ABMAviaitonintheSouthernCaliforniamarkethastransitionedover250facilitiesfromlabordrivenoperationstoautomatedfacilitiesforourclients, andmanymorenationwide. ThereisnoothercompanyintheCaliforniamarketthathasmoreautomatedparkingexperiencethanABM.Noristhereanyothercompanythatmaintainsafull-timeRevenue EnhancingtheTransitionExperience
Whileautomatedoperationsreducecashierstaffing, theequipmentmuststillbemaintainedandthecustomer'sexpectationsforservicemustbemet.ABMiswellversedinprocessingPOF/Automatedrevenueaswellasauditingthesetypesoftransactions. Ourphilosophyinmanagingautomatedpaymentsystemsistoensurethatthecustomerexperienceisequalto theexperiencethecustomerwouldhaveatastaffedbooth. Regardlessofthetechnology,systemerrorswilloccur:ticketswilljam, billsorcreditcardswillnotbeaccepted, orthe customerwillneedhelpunderstandinghowtoperformthetransaction. Automatedpaymentprocessesdonotequatetoleavingthecustomerunsupported. ABMhasdevelopedoperationalsystemsthatprovidethehighestlevelsofcustomerserviceatthelowestoperationalcostsandenablesus to handlethese"exceptiontransactions." ABMwouldofferseveralrecommendationswhenselectingthefutureautomatedsystem. Firstistominimizetheacceptanceofcashatautomatedterminals. Acceptingcashisexpensive, bothintheprocessingofthecashfromtheequipmenttothebank, aswellasincreasedexpensesinadditionalsecuritywhileservicingthemachines.Severalairportshavemadesuccessful transitionsawayfromacceptingcashatthePOFmachines—'successful'beingdefinedasnonegativeimpactonperceptionsofcustomerservice. Thekeyforthetransitionistounderstand thatremovingthecashoptionfromthePOFmachinesisnotthesameasnolongeracceptingcashforparking. Customerswillalwayshavetheoptiontopaywithcash—butthiswillbedoneat the cashier booth.

Oursecondrecommendationistodevelopawell-thoughtoutplantotransitioncustomersfromcashierexiststoeitherPOFpaymentstoeitherpay-in-lane (PIL) orcreditcardin/outpayments.Eitheroftheproposedoptionsrepresentsthenaturalprogressionfromthecustomer's willingnesstouseanautomatedpaymentoption. WhilePOFisanimprovementovercashier transactions, theultimategoalsaretonotissueaphysicalticketatall. Eachphysicalticketrepresentsanopportunityformanipulation, incurscostsinprovidingthetickets, andrequires expensivemachinerytoprocessthatmustbemaintained.ABMhasaverysuccessfulhistoryoftransitioningcustomerstothemoreefficientautomatedpaymentoptionssuchasHonolulu,LaGuardia, Minneapolis-St.PaulandNewarkLibertywhichareallautomatedfacilitieswithgreat success.

Finally, ABMpridesitselfonrefusing-toacceptthestatusquo.Astechnologyopensnewopportunity, everyeffortshouldbemadetoidentifywhatopportunitiesarerightfortheAirport andtointegratesuchopportunitiesinanefficientmanner. Automatingtheprocessingofparkingcouponstoallowredemptioninnon-staffedlanesisjustoneexampleofameanstoincreaseefficiency,reducecosts, andimprovecustomerservice. n
Remote Reports
Management Plan 21
Section C
1 ABMhastheabilitytoprovideallrevenuecontrolreportsandmonthlylandownerstatementsvia ourwww.ABM4WD.comwebsite.Thisportalcanhousenotonlytherequiredreportingbut claimsinformation,ratesurveys,customerinquiriesandcomplaintslogandanyotherinformationthattheCitywouldliketoaccess.Thewebsiteissecureandrequiresuserlogonto approved and authorized users only.

Prelim and SecondaryAuditing Procedures
Preliminary Auditing Procedures
ABMParking'sinternalauditdepartmentperformsauditsfortheparkingoperationsatairportsinaccordancewithgenerallyacceptedauditingpractices. Duringthecourseofouraudit, wewillevaluatetheintegrity, organization, administration, riskassessmentandmonitoringfunctionsof theairportparkingsystem.Theauditwillencompassallaspectsoftheparkingoperationincludinganevaluationoftheresultsoftheon-siteauditteam.Allresultsarereportedtoour clients and to ABM senior management.

Locationswillbeauditedontheaccuracyoftheirfinancialreporting, recordkeeping, gross depositandcashhandlingprocedures, creditcardsettlement, promissorynotes, exceptionticketverification,ticketaccountability, staffinglevels, payrollprocessingandlaborhours,reimbursableexpenses, andsafety.Allauditorswillarriveunannouncedatthelocation.

Allreportsareauditedforaccuracy.TheinformationenteredonthecashiershiftreportisauditedandverifiedagainsttheShiftSummaryAnalysis.TheDailyReportischeckedfor accuracyandreconciledtothecreditcardandcashdroptotals. CashdropsarereconciledtotheFacilityShiftDepositReportandthenverifiedagainstthedepositslip.

Creditcardtransactionsarecheckedforcompliancewiththenon-signaturelimit.Allmanually processedtransactionsarereviewedtoensurethattherequiredimprintsareattachedandcompletewiththerequiredinformation.ThecreditcardtotalsareverifiedagainsttheTerminalBatchReports,theCashierShiftReports,theCreditCardReconciliationLogandtheDaily Consolidation Report.

Allexceptiontransactionsarereviewedforcompliancewiththeapprovedpoliciesand procedures. ExceptioncountsareverifiedtotheShiftSummaryAnalysisReport. EachexceptionticketisverifiedagainsttheShiftSummaryDetailsReportandreviewedtoensurethatallrequiredinformationisrecordedontheticket.Alllost, swappedandstolenticketsarereconciledtotheLicensePlateInventoryReport. Validatedticketsareauditedtoensurethatthecorrectvalidationcodewasusedandthatallrequiredapprovalswereobtained.

Alloverringsandunderringsarereviewedforauthorizationsandexplanations. PromissoryNotetransactionsareverifiedforaccuracyandcompletenessandarereconciledtothe PromissoryNoteReport. Carcountandticketaccountabilityreportsareauditedforaccuracy.

Themonthlystatementwillbereviewedtoensurethatallsubmittedexpenseswereinaccordancewiththetermsoftheparkingmanagementagreement.Afullreportisprovidedtotheclient, ABM'sRegionalVicePresidentandExecutiveVicePresident. Thereportwillbereviewedwiththeon-sitemanagementteamandwillusedasatrainingtoolfortheon-site auditors.
22 Management Plan
Section C
Operational Audits Procedural Audit
Cashier Shift Reports PerimeterIntegrityException Tickets Y Equipment Performance Promissory Notes Reconciliation of RCS Reports
Gate Count! Vehicle Count Analysis Effectiveness of Internal Controls Credit Card Transmittal Report Procedure Manual
Cash/ Checks collected Safety Audit
Shortages/ Overages
CarCounts/TicketAccountabilityDaily Deposit Paperwork Security Bank Reconciliation ReviewMonthlyStatement
Inventory Analysis Ticket Posting and Revenue Reports
SecondaryAudit Procedures
Secondaryauditproceduresarecompletedbythirdpartyauditors. Thirdpartyauditorsperform revenueaudits, ticketshopsandcustomerserviceaudits. ABMiscommittedtoqualityinallaspectsoftheparkingindustryandtheparkingoperationisguidedbymeasurementsof success.Thiscommitmentisdemonstratedbythevarietyofproceduresandprogramsactivelyutilizedbyourcompanytomonitorthesuccessoftheparkingoperations.

Wewillestablishmetricsforallaspectsoftheoperationandwillworkwithmanagementto developaprogramofcustomersurveysandusethesefindingstocontinuallyimprovethe ti customer' s experience.

Itisimportantthatcustomershaveagreatexperiencewhenvisitingthefacilityandthisexperienceincludestheparking, valet, andshuttleprograms.TheseareafewprogramsthathavebeenimplementedwithfavorableresultsandwillbeimplementedatPalmSpringsInternational Airport.

TicketShop—Anauditorarrivesatthefacilityunannouncedandtakesaticket.Theauditorwillstayforalengthyperiodtopayforparking.Theauditormayeitherpresenttheticketorindicatetheyhavelosttheirticket..Theauditorwilldocumenttheticketinformationandmethodof payment.Allthecashierticketswillbeauditedthefollowingdaystoensuretheticketwas processedcorrectlyandtherevenuereport.

Revenueaudits—annuallyateamofauditorswillauditallrevenuereports, monthlyreportsandoperatingproceduresatafacilitytoensureadherencetoallStandardOperatingProcedures. Revenueswillbeauditedtoensuretimelydeposit, accuratereportingandproperticketprocessing. Therevenuecontrolequipmentwillbereviewedtoensurenoloopholesexistandequipmentisfunctioningproperly. PCIcompliancewillbereviewed.

Customer& Client Surveys— Surveysareperiodicallydistributedtosolicitfeedbackonthe facilityandthelevelofservices. TheresultsofthesesurveyswillbesharedwithHJAIAto identifyissuesorconcernsfromthecustomer'sperspectiveandtohelpusdevelopsolutions. Inadditiontosurveyingcustomersofthefacility,wealsodistributesurveystoeveryclientonanannualbasis. Overthepastseveralyears, thecompaniesABMhasconsistentlyachievedaccumulated scores of 90% or higher.

Customer Response Program—
Monitors, tracksandrespondstoallcustomerinquiries.

InquiriesareloggedonaCustomerResponseFormandcopiedtotheSeniorProjectManager. r` Customerscanalsorespondbyvisitingourwebsite.

Management Plan
23 Section C
Mystery Parker Program — Anindividualsentbyourthird-partyauditorposesasapatronand ratesthetreatmentheorshereceivesfromtheparkingpersonnel. Positivefeedbackresultsina favorablereviewandimmediatereward (dinnerfortwo, movietickets, etc.). Negativefeedback resultsin constructivecriticismandtargetpointsfor improvement.

Complaint Resolution— ABM strives to resolve customer issues and complaints as soon as possible. Ifaproblemarisesatouroperation, customerscansimplyasktospeaktothemanageronduty. Ourmanagersaretrainedincustomerserviceandarefamiliarwithmanyof thesituationstheymaybeconfrontedwith.Thishotlinenumberandwebsiteaddresswillbe postedatthefacilitiesandinshuttlebuses, socustomersknowwheretoforwardcomments,suggestionsorcomplaints.Allissuesareloggedintoacomplaintdatabasedocumentingall detail. ThecomplaintdatabasesendstheissuetotheGeneralManagerforinvestigation.

TheQualityAssuranceProgramswillenhancetheoperationsoftheAirportparkingoperation and serves as one more example of our commitmentto our customers.

Althoughthesespecialprogramsareimportant, weunderstandthatthebestwaytoensure qualityserviceisformanagementtobeever-presentatthefacilityworkingwiththestaff,rolemodelingdesiredservicebehaviors. Additionally, constantandopencommunicationwith Managementis a vital componentin monitoringourandimprovingperformance.

Customer ServicePolicyandTraining
Wecurrentlymanageandmaintainfirst-classpublicparkingandshuttletransportation operationsatanumberofsignificantairportsacrossthecountry.Wethereforeunderstandthe paramountimportanceofcustomerservice,bothintermsofprovidingapositiveparking experienceforthetravelingpublicandenhancingtheimageof ourairportclients.

Inorderto meetandexceedthePalmSpringsInternationalAirport's (andourown) expectations forachievementof ahighlevelofcustomerservice,wewillprovideatPSPthecustomerservice programsthathaveproventobesosuccessfulandatourotherairportoperations, andhaveledtosuchachievementsaswinningthe "BestCustomerServiceAward"byaPortAuthorityofNew YorkandNewJerseycontractorforourJohnF. KennedyInternationalAirportoperations. The customerserviceprogramsthatwehavedeveloped, andwillcontinuetodevelop, focuson:

Process orientation rather than task orientation
The needto servicethe"internal" and "external" customers C Teamwork
Communication
Process improvement
Overall enhancement of customer service skills
Appearance
e Accountability
Understandingpolicies, procedures, incentives, disciplinaryaction, etc.

Thefollowingisabriefoutlineofsomeofthebenefitsthathavealreadybeenrealizedduetothe implementationoftheseprogramsatsomeofourairportoperations:

Researchhasshownthatifpeopledon't recall, review, orworkwithwhatthey'velearned onagivendaywithin24hours,theywillforget50-80% ofit. Deliveringcustomerservice trainingeverysixmonthshasallowedemployeestolearn, useandretaininformation.Reductionofcostlymistakes-theabilitytodeliveroutstandingcustomerservicehas proventoreducecomplaintsandtheamountofmonetarycompensationaskedforby 24 Management Plan
Section C
customers.

Employeesrelateandcommunicatewitheachotherinrelationtocustomerencounters andhavecreatedstrongerteamunity.

Performanceincreasesoninternalandexternalperformanceevaluations, especiallyduringthemonth(s)followingtrainingsessions.

Increasedpositivecustomerfeedbackthroughcomplimentarylettersandphonecalls.

Insomeindividualcases, employeeshavetakenthetrainingbeyondjobapplicationand changed their overall behavior and attitude.

Continuoustraininghascreatedleveragewhenunacceptableemployeebehaviormust be acted upon.

Continuoustraininghasallowedustobaseincentive.programsonperformanceand pinpointpositivebehaviorsthatwereadirectresultofthetrainingprogram.

Employeessurmountdifficultsituationsbyskillful, activelistening. Thisisaskilllearned specificallythroughtrainingprograms.

Wehavealwaysfocusedonthequalityandeffectivenessofourmanagement,operationaland administrativeplansforprovidingsuperiorcustomerservice,whileexceedingcustomer expectationsandprovidinga lastingpositiveparkingexperience.

Wearethereforecommittedtohiring, andmoreimportantly, retainingqualityindividualswhoexemplifytheutmostincustomerserviceandoperationalefficiency.

Westrivetohire, train, reviewandrewardemployeesinanorchestratedefforttoensurethat therearenosurprises. Allemployeesarekeptabreastofmanagementexpectationsandon whereeffortsmustbemadetoimproveperformance.Webelievethatgreatcustomerservice canberealizedthroughtreatingouremployeesthewaywewouldlikeouremployeestotreat. our customers.

Personnel Policies
EmployeesarebondedunderourCrimeInsurancePolicyissuedtoABMforourclientsupon approval of a signed contract.

Employee Duties & Qualifications
Qualifications
Unlessnotedspecially, newemployeesmustalsomeetthephysicalrequirements, haveahigh schooleducationorGEDequivalent; excellentverbalandwrittencommunicationskills; abilityto performessentialjobfunctionsasoutlinedintheformalJobDescriptionwithHumanResources; abilitytostandorsitforlongperiodsoftime; graspandliftobjectsessentialtotheirjobduties;ShuttledriversmustalsopossessaClassAand/orBcommerciallicenseforallshuttle_ positions, maintainacleandriving,record, andsuccessfullypassallDriversTraining.

General Manager(GM) Qualifications& Job Description:

TheGMistheseniorrepresentativeforABMonafull-timebasisattheAirport, responsiblefor theadministrationandoperationofthepublicparkingandshuttleoperations. Dutiesinclude:

Plan, organize, directandevaluatetherequiredpractices, programs, andactivitiesof theentireadministrative, supervisory, cashier, attendantandotherpersonnelatthefacility.

Management Plan
25 Section C
Ensureadherenceto establishedpolicies, rulesandregulationsofABMandAirport.

MaintaincloseliaisonwiththeAirportAdministrator, handlingproblemsofmutual concernsuchas minimizingtrafficcongestionleadingintoandoutof thevarious facilities, andotheritemsrelativetosecurityandtothepropertyoftheAirportand patrons.

Originateandenforcestandardsregardingparkingemployees' personalappearance and demeanor to assure a professional, first-class operation.

Ensuresadherenceto hiringpracticesandfinalselectionanddismissalofparking personnelandsuperviseassistantpersonnelandofficestaff.

Responsibleforachievinganacceptablelevelofpublicrelationsbyall employees.

Initiateand directthe orientationandtrainingof all employeesto assuremaximum efficiencyandsafetyat all levelsofthe operation.

Reviewall recordsandreportsandtakenecessaryactiondirectlyorthroughstaffto improvethe proficiencyandaccuracyof parkingemployees.

Responsible.forthepreparationandevaluationofthemonthlybillingandproviding requiredmanagementreportsas directedbytheAirportanditsFinanceDepartment.

Maintainpettycashaccount,whichistobeusedforpurchasestoensure uninterruptedparkingoperation, authorizepurchaseofsupplies, servicesand materialsassociatedwiththeadministrationandoperationofthefacilities.

Assurethetimelysubmissionof requiredoperationalandadministrativereports regardingpertinentparkingoperationsactivitiesandrevenuesgenerated.

AssurecooperationandcommunicationwithAirportStaffregardingequipment malfunctions, conditionandmaintenancerequirements. Establishandmaintainanon- goingdailymaintenancelog, indicatinglocation, date, andtimeofnotification.Assurethatall Workers' CompensationClaimsare processedin a timelymanner.

Responsibleforthesubmissionofyearlyoperationalbudget. Providea budget analysisand substantiateeachitem's increaseor decreasefrom the prioryear.

Conductunannouncedpersonalinspections, observeandevaluateperformanceof subordinatepersonnelin fulfillingpatronservicestandards.

Conductunannouncedpersonalaudits, toobserveandevaluateofficerecord-keeping andaccountingandcashcontrolperformance.

Conductfacilityinspectionsonafrequentbasistodeterminesafetyandappearance andreportto AirportAuthoritydeficientitems.

ResponsibleforcompliancewithallU.S. Government,StateandCityrequirements, codesand statutesregardingemploymentandequalemploymentopportunities.

ResponsibleforanalyzingoperationandmakerelevantrecommendationstoAuthority.

Qualifications/ Requirements:

Preferred2-or4-yearcollegedegree. Abilitytomulti-taskandpossessstrongaccountingandcashhandlingskills. Computerliterateandexperienceinparkingpreferred. Possessesvalid driver's license and clean driving record.

Capabilities/ Responsibilities:

Operationalactivitiesrelatedtoparkinglotoperations, detailedaccountingofrevenues andreviewofrelatedinternalcontroldocumentation,themaintenanceofparking facilities and scheduling of personnel.

Overseesupervisionofmanagementstaff,shiftsupervisors, valets, maintenancestaff, andotherpersonnelengagedindirectingtraffic,collectingfeesandschedulingof personnel; assistinsupervisionofandcoordinatingspecialeventsparkingandsnow removal during inclement weather months. 26
Management Plan
Section C
Assistinplanningandschedulingworkforthegroup, ensuringproperdistributionofassignmentsandadequatemanning, spaceandfacilitiesfortheperformanceofduties.

Assistin trainingemployees, supervisorsandmaintenancestaff.

Checkoutcashiersandpaystationsatendofshiftincludingverifyingcashdeposit, reconciliationtocashregistertapeandlanecounters, reviewofticketstoensure properdocumentationofexceptions, andrecordingcashieractivityinrevenue accountingsoftware. Preparedaily, monthlyandannualreports.

Participateinavarietyofdutiesinvolvedindirectingandcontrollingtrafficandaccesstoparkingthroughoutlotstoincludedirectingthemovementofvehiculartrafficand regulatingandmonitoringvehicleparking. Monitorandcorrectsafetyhazards.Overseetheupkeepofrecordstorageandticketinventory.

Authorizeanddirectthetowingofillegallyparkedvehicles. Resolvedamage complaints from customers.

Monitoroperationofcontrolequipmentandautomaticgatesandreplaceexpendable suppliessuchasticketsandprintribbons; notifycontractorforotherrepairs. Perform other relateddutiesincidentaltothe workdescribedherein.

Assistin promotionoffacilitiesandperformsotherrelatedfunctions,asassigned.

Shift Supervisor
AShiftSupervisor, asaseniormemberoftheGM'sStaff,andchargedwiththeresponsibilityoforganizinganddirectingsubordinatepersonnelinallaspectsofStandardOperatingProcedures necessarytomaintainaprofessional, firstclass, day-todayoperation. Dutiesinclude:

MaintainliaisonwiththeGMonallaspectsoftheoperation, daily, advisingofanyproblemsencounteredor anticipatedwhich shouldbe discussedand resolved.

BeresponsibleinmattersnormallyrequiringthedecisionoftheGM,toactonhis/her behalfshouldhe/shebeabsentorunavailable. Suchactionsaretobedocumented, outliningtheincidentorsubjectandtheresolutionof theproblem.

Monitorandreviewdailyallrequiredlogs, forcompletenessandaccuracy,assuringthat properaccumulationof permanentrecordsismaintained.

MaintaincloseliaisonwithMaintenanceTechniciansonday-to-dayequipment problemsandassurecooperationofABMpersonnelregardingequipment malfunctions.

Monitorandreviewshiftschedulestoascertainthatstaffingrequirementsarebeing maintainedandovertimedemandsarekeptminimalandreviewattendancereports.

Responsibleforthereplacementofpersonnellosses, interviewingandhiringthrough theutilizationofthestandardhiringpractices, ensuringthatanadequatestaffis maintained.

Evaluatetheprogressofemployeeswithinthetraineeprobationaryperiods, advisingthemofareasneedingimprovementbeforepermanentstatuscanbeassigned.

Inconjunctionwithjobperformanceinformation, providedbytheShiftSupervisorsand theutilizationofpayrollandcashierrecords, evaluatetheprogressofemployeesand providetrainingwhennecessaryandcounselthosewithpoorattendancerecords.

PrepareandmaintainSupervisoryStaffschedulesto ensuremaximumutilizationof availablepersonnel. Contemplatedchangesofshiftassignmentsareto bediscussed andmutuallyagreeduponwiththeManagerpriortotheinitiationofsuchchange.

Conductpreliminaryinvestigationonanycustomercomplaint, investigateandissues disciplinary action as appropriate.

Befamiliarwithandenforceall policiessetforthbytheAviationDepartmentandABM Management Plan -
27 Section C
and prepareandupdatetrainingmanuals
Prepare a monthly ticket inventory.

Removeabandonedvehiclesfrom theAirportfacility.

Supervisor Position Overview
Generallyresponsibleforemployeeoversightandsupervision, ensuresafeandefficientoperations, andoutstandingcustomerserviceprovidedtocustomers. JobDutiesinclude:

Supervisorhourlyemployees,.maintainemployeeschedulingandvacationcoverage Managevehicleflowinvaletareaanddirectemployeeswhereneeded Firstlineresolutionforcustomerissuesandfirstlineinvestigatorforclaims InterviewapplicantsandmentorandCounselemployeesonneededprogress Goodcustomerserviceandproblem-solvingskillsandworkwellwithothers Educationfrraining/ Licenses(s) Required:

HighSchooleducationorequivalentandsomecollegecourseworkand/orcustomerservice training helpful.

Experience/ Job Knowledge:

Ahistoryofworkingthepublicserviceindustry, asolidemploymentrecordandprevious experienceas supervisoris preferred.

Essential Job FunctionslQualifications:

Maintainhighlevelofprofessionalism/ communicationskillsasmaincontactforclient.

Musthaveabilitytoworkwithlittletonosupervisionandbeabletoindependently determine tasks to complete daily.

Mustbeabletoperformallphysicalaspectsoftheabovejobduties.

Mustbeableto speak/understandwrittenEnglish.

Previousexperiencepreferredbutnotrequired.

Cashier
Cashiersarethemostimportantlinkintheoperationoftheparkingfacility.Allrevenuetakeninbythefacilitywillbecollectedbycashiers. TheCashieristhelastrepresentativeofthecompanythecustomerwillencounter. Listedbelowaresomeofthemoreimportantaspectsofa cashier's job:

Report directly to Shift Supervisors
Supportsupervisorsbymaintainingopencommunicationregardingday-to-day operations, reportingunresolvedissues/concernstosupervisorsandrelaying information tocustomers.

Responsibleformaintainingahighstandardofcustomerserviceinacourteousand professionalmannerwiththehighestconsiderationforqualityandsafety.Responsibleforgivingroutineinformationtothepublic, suchasratesanddirections.

Responsibleforcomputingthecorrectparkingfeeforthecustomers.

Responsibleforcomputingthecorrectparkingfee, collectingparkingfees, and returningcorrectchangetothecustomerandanycashvariances.Responsibleforpreparingdropswhennotified, maintainingallrequiredrecords tickets, credit card slips, etc.).

ResponsibleforprocuringaShiftSupervisor'sapprovalforallexceptiontickets.

Responsibleforkeepingassignedcashierboothcleanandstockedwithsupplies. 28 Management Plan
Section C
Taxi Starter
Taxistarterpersonnelmanagetheprovider/customerinteractionatthetaxicurb. Dutiesinclude:

Greetcustomersuponarrivalat the taxi curb.

Provideforinitialvisualinspectionoftaxi'sarrivingatcurbforpick-ups.

Providecustomersgeneralinformationfor servicesand area
Documentandreportanyissuesthatmayariseduringthetransaction.

Dispatchshuttletopickupcustomersfortransportationbacktoholidaylot (seasonal).

Qualities/ Requirements:

Good verbal and written communication
Abilityto standfor long periodsof time
Traffic Enforcement Officer
TrafficEnforcementOfficersmanagethetrafficflowattheterminalfront.Thepositionrequires the,abilitytocommunicateinapositivebutauthoritativemannerwithpickupanddropofftraffic.Duties include:

Thoroughcommandofroadwaypoliciesforvehicularuseoftheroadways.

Ability to diffuse confrontational situations.

Providecustomersgeneralinformationfor servicesand area.

Accuratelyandprofessionallydocumentandreportanyissuesthatmayariseduringthe transaction.

Qualities/ Requirements:

Good verbal and written communication.

Abilityto standfor longperiodsof time.

Recruitment / Hiring
ABMAviationrecruitsemployeesusingavarietyofsourcessuchasnewmedia, socialmedia, jobfairs, employmentcenters,jobplacementcentersandourmostsuccessful, employee referrals.Allemployeesarerequiredtosubmittoourstrictprescreeningprocesswhichincludes substance abuse screening, criminal background investigations, reference checks, and DepartmentofMotorVehiclesChecksforallemployeesindrivingpositions. Allemployeeswho drivewithABMwillalsobeenrolledinourDMVpullnoticewhereintheemployee'sdrivingrecordwillbepulledeverysixmonthandafterany"incident" toverifycleandrivingrecord.

Employeeswhofailtomaintainacleandrivingrecordwillberemovedfromadrivingpositionupto and including discharge.

Pay Scale
Inordertoattractandretainqualityemployees,ABMpayscompetitivesalariesandprovidesa comprehensivebenefitspackage. Theproposedpay scaleis:

General Manager 27-$ 30/ hour
Shift Supervisor 23 -$ 26/ hour
Parking / Taxi / TEO 13 -$ 15/ hour
Shuttle Driver 14 -$ 16/ hour
Management Plan
29 Section C
4 Benefits
Toqualifiedemployees,ABMoffersacomprehensivepackagethatincludesmedical,dental,employeestockpurchase, deathbenefit, 401Kfornon-unionemployees, vacation,sickdays,7 paidholidaysandcommutertransitandparkingbenefits.

Training
ABMprovidesnewhireandretrainingopportunitiesthroughoutanemployee'scareerwithABMAviation. Outlinedbelowwehaverecappedourtrainingprogramsbeginningwithnewhire orientation and then ongoing training.

Comprehensive Orientation
ABMbelievesthehiringprocessisoneofthemostcriticalaspectsofanysuccessfuloperation.

Inturn, wehaveestablishedanemployeeorientationprogramthatisunsurpassedinthe parkingindustry. Throughouttheorientation, theopportunitiestoadvanceinthecompanyandintheindustryareemphasized. Further, westressthatABMAviationconsidersitselftobean activelyemployee-orientedcompany.Dedicatedworkerswill.notgounnoticed, andthose showingsuperiorworkhabitswillberewarded. NewHireOrientationincludes:

AllAboutABMandABMAviation-Employeesareprovidedwiththebasicbackground knowledgeandphilosophyofwhoABMandABMAviationareandwhatourphilosophyis. AllnewhiresareissuedanEmployeeHandbookwhichcontainsdetailedinformation on all the issuesdiscussedduringorientation.

Benefits-Newemployeesreceiveinformationabouttheirhealthandwelfarebenefits, if applicableaswellastheholidayschedule, vacationpolicies, stockpurchaseoptions, 401K plan, availablescholarshipprograms, andABMAviation'sRoadmaptotheFuture.

SafetyintheWorkplace -AllnewemployeesarefamiliarizedwiththeABMParkingSafetyProgram,throughwhichtheylearntorecognizepotentialhazards, correctexistingproblemsand conductsafetymaintenanceinspectionstoreduceriskoreliminateitaltogether. Safetyawarenesstrainingincludesparking-relatedissueslikevehicledamage, personalliability,workers' compensationandtheft.Specialattentionisgiventothespecifichazardsthatcome withcertainjobfunctions,suchasmaintenance, parkingattendants, valets, shuttlebusdriversandcashiersincludingknowledgeableaboutproperreportingproceduresifanincidentoccurs.

JobSpecificTraining-AIInewemployeesaregivenhands-ontrainingwithrespecttothe equipmenttheywilluse. Generally, thistrainingwilltakeplacebeforetheemployeebeginshisfieldservice. Newhiresalsoaregiventheopportunitytocomplete, reviewandcorrecttheformstheywilluseaspartoftheirdailyactivities, whichpromotesaccuracyandfamiliaritywithappropriateparkingterminologyandtheparticularsoftheirworksite. ATrainingManualis issuedtoeachemployeetoprovidegeneralguidelinesandproceduresforperformingspecific job tasks.

CustomerService-Toensurethatouremployeesdemonstrateapropercustomerservice attitude, weendtheorientationclasswithapowerfulemphasisoncustomerservice.The philosophyofABMAviationissharedwiththeentireclassandoureverimportant"WhatisaCustomer?" plaqueisprominentlydisplayedintheclassroomsetting. AllthecomponentsoftheCustomerCourtesyProgram, asdiscussedintheCustomerServicesectionoftheproposal, arereviewedindetailandthegrouppracticesusingthecomponentsduringthejob-specifictraining 30 J
Management Plan
Section C
portionoftheprogram. Notto beforgottenduringcustomerservicetrainingissuchitemsas uniformrequirements, aswell asgroomingandcustomergreetings, all of which arediscussed indetailduringtheinitialorientation. PleaseseeourCustomerSectionformoredetailed information.

ConflictAvoidance- Role-playingisanimportantpartinpreparingtheemployeeforwhathe orshemayencounterinthefield. Wecreatesituationsandrole-playwiththeemployees,then asagroupwediscussthepositiveandnegativebehaviorsusedbytheemployeeinhandling thesituation. Thispracticeencouragesemployeeinvolvementandrequiresthemtodrawonthe valuable resources provided during training.

Attendance- Excellenceinattendanceis expectedof all employees.Absencesandtardiness disruptthenormalconductofourbusinessandarean impositiononotheremployees.Accurate recordsof absencesandtardinesswill be maintained. Employeesare responsiblefor their attendanceandpunctuality. Itis the responsibilityof the GeneralManagerto maintainaccurate attendance records, payroll records and vacation status.

OnsiteFieldTraining- Eachfacilityis uniquein itslayout, services, customerneeds, andeven employeefunctions. Therefore,classroomtrainingmustbefollowedupwithon-sitetraining.

Thissegmentoftheorientationwillconsistofa varietyofinformationsuchasthemissionand goaloftheAirport, atouroftheparkingfacilities, aswellasspecificknowledgeofthefacilitylayout, size, staffingandschedules. Employeesaretaughtinformationthatwillbe helpfulwhen answering customer inquiries about the Airport facilities.

OngoingDevelopmentforExistingEmployees -Inadditiontothecomprehensivearrayof topicspresentedtonewemployees,ABMAviationpridesitselfontheongoingtrainingprograms itrequiresofourteammembers.Weunderstandthatit isimperativethatweprovidecontinuousZ trainingtoallouremployees, enhancingtheirskillsandknowledgeoftheparkingindustry. Byinvestingintheirpotential, wedeveloptop-notch, qualityemployees. Severalofourongoing, industry-leadingtrainingprogramsarediscussedindetailinthepagesthatfollow.

Cross-Training-Withintheparkingindustry, it is criticalthaton-siteemployeesbecross- trainedtoperformtheotherfunctionsandtasksrequiredattheirindividualfacility. Toensure capableandwell-trainedemployeesarealwaysreadilyavailable, eachFacilityorGeneral Managermaintainsanon-calllistofemployees.Theselistsarecompiledofemployeescross- trainedin equipmenttypesandjob functionssuch as cashier,or attendantassistance, and locatedwithinareasonabledistancefromtheiroriginaljobsite. Generally, employeesincross- trainedpositionsorinthe"floatpool"havemanyoftheskillsnecessarytoadvancewhen promotional opportunities become available.

SafetyTrainingSeminar-ABMunderstandsthatis trulyinthebestinterestofthecorporation toreduceitsclaimexposuretooffercompetitiveratestoclients. Therefore,ABMhasdeveloped an aggressive Safety Program. Ourfull time Director of Loss Control ensures that all objectives oftheSafetyProgramaremetandincludevehicle/driver'ssafety,personalprotective equipment, AccidentandIllnessPreventionPlan, SafetyAwareness, Workers' Compensation and PublicLiability (PropertyDamage.

StandardOperatingProcedures (SOP)TrainingSeminar -Annually,theGeneralManager willattendaSOPtrainingsessionwhichisconductedbyourin-houseauditingstaff.The seminarincludesastructureddiscussionoutlininganynewcompanypoliciesandproceduresas wellasareviewofexistingpoliciesanddiscussionofnewconcernsorissues. Shortly thereafter, theauditingstaffchecksandrechecksthefacilitytoensurethatallthenewor revisedprocedureshavebeenfully implemented. Inthose instanceswheredeficienciesare detected, theGMwillberequiredto attenda supplementaltrainingsession.

Management Plan
31 Section C
Technology Training- On an" as needed" basis, ABM offers its employees extensive training v onseveralofthemostcommonprogramsutilizedtoday.Whethertrainingthenovicewho virtuallypossessesnoknowledgeofcomputersortheexperienceduserdesiringonlytobrush-uponhis/herskills, ABM'strainingdepartmentisquitecapable.WeencouragetheGMtotakeadvantageofavailabletrainingtoexpandhisexpertiseinareasuchasMicrosoftProject, MicrosoftExcelandMicrosoftWord, ailofferedatnocosttotheproject.

Employee Conduct and Discipline
ABMhasaphilosophythatwestronglybelievein, postinouroffices,inthebreakrooms, and t shareeverychanceweget. ABMbelievesinRespect, FairnessandDignityandweexpectthat our employees conduct will reflectthat:

Respect-Wehavenothingbutthegreatestrespectfor ourskilledandhardworking employees.Werespecttheneedsandconcernsofourclientsanddoourutmostto solve their challenges. Every time.

Fairness -Webelieveinjusttreatmentfor all.Westriveto leadthefacilityservices industrythroughourhonest, ethicalattitudeandopencommunicationwithall employees and clients.

Dignity-Self-respectbeginsonourhometurf.Westrivetoupholdasoundbusiness philosophyinallmatters, whetheritconcernsouremployeesorourclients.Whenit comes to integrity, we don't compromise
ABMbelievesinapolicyofprogressivedisciplinewhethertheemployeeispartofaCollective BargainingAgreementornot. Ourobjectiveistoworkwithouremployeesindevelopingtheirskillsandprofessionalism. Employeesreceiveregularfeedbackandanannualevaluation. Theevaluationoffersaformalopportunitytodiscussfuturegoalsandareasofexcellenceorthose requiringimprovement.AnEmployeeHandbookisissuedthatoutlinesthepoliciesand proceduresandguidelinesforemployeebehavioronthejob.

Evaluation of Employees
Frequency-Allnewemployees, upongraduatingfromthetrainingprogram, canexpecta performancereviewafter90daysonthejob.Theevaluationreviewcoversallareasoftheemployee'sresponsibility. Technical, behavioralandcustomerrelationsskillsareconsideredin theoverallperformanceevaluation. Forinstance, inthecaseofacashier,datacompiledfromcashauditsandqualitycontrolinspectionsareconsideredimportanttothereview. Complaintsorcomplimentsfromthetravelingpublicwouldalsoplayamajorroleintheprocess. The performanceofsupervisorsormanagerswouldbeweightedtowardspolicycompliance,timely reportingandfinancialperformanceoftheoperation.

Promotion-ABMpromotesfromwithinthecompany. Employeesaremadeawareofthis policyearlyonandencouragedtostriveforadvancement.Promotion, payraisesandcontinuedemploymentarealltiedtoperformance.inshort, theemployeewhodemonstratessuperiorjobskillsandknowledgeandadesiretodosomethingextrawillberewardedwithadditional responsibilitiesandpromotion. Mostofourpresentmanagementstartedatthelowestlevelsofresponsibilityandhaveworkedtheirwaythroughtheranks.ThisiscommonknowledgeatABM andprovidestheimpetusforemployeestodotheverybestjobpossible.

ProgressiveDiscipline -ABMadherestoastrictsetofpoliciesconcerningdisciplinethatmayleadtoademotionorinvoluntarytermination. Fortheprotectionoftheemployee,itisimportantthatwhenaruleviolationoccurs,theemployeeisnotifiedverballywithawrittennoticetotheir 32 l
Management Plan
Section C
personnelfiletomemorializetheconversation. Thisfollowsasystematiccoursethatprogresses withadditionalwarningsiftheruleviolationscontinue, eventuallyleadingtotermination. It is importantthatalldisciplinebeleveleduniformlyandthatallemployeesareexpectedtoadhere to the same rules and regulations.

Terminations-Itis importantthatallterminations, voluntaryornot, behandledina professionalmannerconsistentwithallstateandfederallaws. ABMhasafullystaffedHuman ResourcesDepartmenttomonitorandassistallfieldpersonnelinthesometimes-delicate procedureofa dismissal. Inthecaseofa firing, it isourpracticeto initiallysuspendthe individualpendinga briefinvestigation. Thisallowsusto makesurethe terminationis warrantedandallowsthefieldmanagerto receiveproperdirectionbeforemakingthe terminationfinal. In everycase, all departingemployeesreceivean in-depthexitinterviewwhere allquestionsareansweredincludinganexplanationofavailablecontinuingbenefits.

Guidanceof SupervisoryPersonnel-Supervisorypersonnelandtrainingwillbethedirect responsibility of our on-site General Manager. As a senior staff member, she will be charged withtheresponsibilityoforganizinganddirectingsubordinatepersonnelinallaspectsof requiredproceduresandstandardsnecessaryto maintaina professionalfirst-classoperation.

Toassistmanagement, wehavea HumanResourcesManualwhichis availableonlinethrough our parent company ABM Industries, Inc.

Uniforms-AIIemployeesarerequiredtobeina completeuniformduringworkhourswhich consistsof dark pants, whiteshirtwithtie or a poloshirt, dark shoesandajacket.Themonthlyuniformcostperemployeesincludestheweeklypickup, cleaningandreturnofuniformsto thelocation. If necessary, repairswillalsobemadeatno additionalcharge. Webelievethemonthlyuniformprogramalwayskeepsemployeeslooking professional and clean and creates consistency.

I
EEOPolicy
ABMisanEqualEmploymentOpportunity(EEO)andAffirmativeAction(AA) employer.The Companymakesemploymentdecisionsbasedon meritinorderto ensurethefull utilizationof people of all backgrounds who possess the best available skills in everyjob.

Companypolicyprohibitsdiscriminationbasedonrace, color, creed, gender, religion, marital status, registereddomesticpartnerstatus, age, nationaloriginor ancestry,physicalor mental disability, medicalconditionincludinggeneticcharacteristics, sexualorientation, amnesty, status as a coveredveteranor any otherconsiderationmadeunlawfulbyfederal, state, or locallaws.

ABMpolicyalsoprohibitsdiscriminationbasedontheperceptionthatanyonehasanyofthose characteristicsorisassociatedwitha personwhohasoris perceivedashavinganyofthose characteristics.All suchdiscriminationis unlawful.This policyappliesto all termsandconditions ofemployment,including, butnotlimitedtorecruitment, selection, assignment, promotion, termination, reductionin force,transfers, benefits, leavesof absence, compensation, socialand recreational programs, training, and education.

TheCompanyiscommittedtocompliancewithallapplicablelawsprovidingEEO.This commitmentappliesto all personsinvolvedin Companyoperationsandprohibitsunlawful discriminationbyanyemployeeoftheCompany, includingsupervisorsandcoworkers.All employees are encouraged to assist the Company's affirmative efforts in support of its EEO/AA policy, includingtherecruitmentandreferralof qualifiedindividuals. All membersof managementmustbefamiliarwith this policyand mustfully supportit. They are responsibleto applythese principlesin goodfaith, andtheirperformanceunderthese policiesis reviewed.

TheCompanywillworkcooperativelywithpublicandprivateentities, governmentagencies, educationalinstitutions, civic organizations, communitygroups, andother appropriate 33 Management Plan
Section C
organizations concerned with employment opportunities, as well as with its suppliers and J subcontractors, in support of its EEO/AA policy.

DisabilityAccommodation -Tocomplywithapplicablelawsensuringequalemployment opportunitiestoqualifiedindividualswithadisability, theCompanywillmakereasonable accommodationsfortheknownphysicalormentallimitationsoranotherwisequalifiedindividual withadisabilitywhoisanapplicantoranemployeeunlessunduehardshipwouldresult. Any applicantoremployeewhorequiresanaccommodationinordertoperformtheessential functionsofthejobshouldcontactABM'sHumanResourcesDepartmentandrequestsuchan accommodation.Theindividualwiththedisabilityshouldspecifywhataccommodationheorshe needstoperformthejob. TheCompanythenwillinvestigatetoidentifythebarriersthatinterfere withtheequalopportunityof theapplicantoremployeetoperformhisorherjob.

TheCompanywillidentifypossibleaccommodations,ifany,thatwillhelpeliminatethelimitation. Iftheaccommodationisreasonableandwillnotimposeanunduehardship, the Company will make the accommodation.

ReportingandInvestigation- Ifanemployeebelievesthatheorshehasbeensubjectedto anydiscrimination, theemployeeshouldreportthediscriminationtohisorhersupervisororHumanResources. Thecomplaintshouldbespecificandshouldincludethenamesoftheindividualsinvolvedandthenamesofanywitnesses. Iftheemployeeneedsassistancewiththe complaint,oriftheemployeepreferstomakethecomplaintin person, theemployeecan contactHumanResourcesorcalltheComplianceHotlineat1-877-253-7804. TheCompanywill immediatelyundertakeaconfidential, thorough, andimpartialinvestigationtoresolvethe situation.

AffirmativeAction(AA)-ABMmaintainsanAAProgramasrequiredbylawbecauseits businessunitsholdfederalcontractsandsubcontracts. ExecutiveOrder11246, asamended, notonlyprohibitsdiscriminationinemployment,italsorequiresfederalgovernmentcontractorsandsubcontractorstoidentifyclassificationswithunderrepresentationofminorities, females, coveredveteransandpersonswithqualifieddisabilities; tosetgoalsandtimetablesfor increasingtheemploymentofunderrepresentedgroups, todevelopanAAProgram,andtakeextrastepsforimplementingthosereasonablegoalsthroughoutreach, recruitment,training, and other special activities and commitments.

Anygoalsthatareestablishedarenotintendedasrigid, inflexiblequotasthatmustbemet, butratherastargetsreasonablyattainablebyapplyingeverygoodfaitheffortinimplementingthese plans. TheuseofgoalsintheCompany'splansisnotintendedtodiscriminateagainstanyindividualorgroupofindividualswithrespecttoanyemploymentopportunityforwhichtheyare qualifiedonthegroundsthattheyarenotthebeneficiariesofAffirmativeActionthemselves.NothingintheCompany'sAAPlansisintendedtosanctionthediscriminatorytreatmentofany person. Thus, theCompany'splanshavebeendevelopedinstrictrelianceupontheguidelines onAA issuedbythe U.S.Dept. of Labor.

Sexual Harassment. Policy
ABMwillnottolerateharassmentofemployeesbyanyone, includinganysupervisor, co-worker,vendor, clientorcustomeroftheCompany.Unlawfulharassmentisunwelcomeorunsolicited speechorconductbaseduponage, sex, race, color, creed, religion, nationalorigin, ancestry, physicalormentaldisability, maritalstatus, sexualorientation, oranyotherprotectedstatus under federal, state or local law.

Oneformofunlawfulharassmentissexualharassmentwhichisdefinedasunwantedsexual advances, requestsforsexualfavorsorothervisual,verbalorphysicalconductofasexual 34 Management Plan
Section C
nature. Thisdefinitionincludesmanyformsofoffensivebehaviorandincludesgender-basedharassmentof a personof thesame sexas the harasser.

Itistheresponsibilityofany.employeewhohasbeenharassed, discriminatedagainst, or retaliatedagainst, orwho has witnessedsuchharassment, discrimination, or retaliation, to immediatelyreportitusingtheComplaintProcedure. Itistheresponsibilityofanymanagerwho hasreceivedanemployeecomplaintofharassment, discrimination, orretaliation, orwhohas witnessedharassment, discrimination, orretaliation, toimmediatelyreportitusingtheComplaintProcedure.

Retaliation - Itisunlawfultoretaliateagainstanemployeeforfilingacomplaintofsexual harassmentorfor cooperatinginaninvestigationofa complaintforsexualharassment.

DisciplinaryAction - Ifitisdeterminedthatinappropriateconducthasbeencommittedbyan employee, theCompanywilltakeappropriatedisciplinaryaction. Consequencesmayrange fromcounselingtoterminationofemploymentandmayincludesuchotherformsofdisciplinary action as are deemed appropriate under the circumstances. Managers who fail reportemployeecomplaintsmaylikewisebesubjecttodisciplinaryaction.

ComplaintProcedure-Employeesandmanagersshouldreportincidentsofharassment, discriminationorretaliationbyusingthecomplaintprocedureoutlinedbelow. Thisincludes incidentswithcustomers,tenants, suppliersorindependentcontractors.Allemployeesare provided the following information:

TheABMComplianceHotlineat 1-877-ALERT04(1-877-253-7804). TheHotlineis staffed24hours/day, 7days/weekandspecialistscantakecallsinanylanguage.

Reportscanbemadeanonymouslyandarealsoacceptedonlineat
www. abmhotline.ethicspoint.com. Reports are taken by an unbiased vendor and are forwardedin asecureandconfidentialmannertoanappropriateHumanResources professional for prompt investigation; or
Your local HumanResourcesrepresentativeor regionalHR Director; or a
TheABMEmployeeRelationsunitat(415)351-4367. Employeesmayraiseconcerns andmakereportswithoutfearof retaliationbymanagement, employeesorco- workers.

OurHumanResourceswillconductanimmediate, thorough, objectiveandcomplete investigation of all complaints.

Safety Policy
ABMoperatesincompliancewithapplicablehealthandsafetyregulationsandlaws; andwe expectour employeestocomplywithestablishedsafety,healthandenvironmentalregulations andourownstandards, whichmaybestricter.Anyworkplaceaccidentandanyunsafeworking conditionsorpracticesmustbereportedimmediately.Thehealthandsafetyofourfellow employeesandothersrequirethateachemployeeworksfreefromtheinfluenceofany substancethatcouldimpactorpreventasafeworkingenvironment. Employeesareprohibited fromusingor possessingalcoholordrugsinviolationofanyfederal, stateorlocallaw, regulation or ordinance or Company policy at the workplace or in connection with ones work, in aCompanyvehicleorinanymotorvehiclewhenusedinconnectionwithCompanybusiness.

Subjecttotheprovisionsofapplicablelawsandregulations, weprohibitthepossessionoruse ofanyfirearms,otherweapons, explosivedevicesand/ordangerousmaterialswhileconductingCompanybusiness, attheworkplaceorinaCompanyvehicle.ABMhasspecificsafetypoliciesand procedures related to:

Management Plan
35 Section C
Alcoholic Beverages and Drugs
Vehicle Safe
Workplace Safety
OSHA Requirements
Accident Illness and Prevention Plan
Personal Protective Equipment
Emergency Procedures
Wehaveprovidedasamplingbelowofsomeofthespecificgeneralworkrulesrelatedto AlcoholicBeveragesandDrugsandVehicleSafetytoprovideSMFwithamorein-depthlookat oursafetyprogram.FurtherguidanceonmaintainingasecureworkplacecanbefoundwithintheABMInjuryandIllnessPreventionProgramManual-acompletelistingofABM'sHealthand SafetypoliciesisavailableintheOccupationalSafetyandEnvironmentalManagementPolicy ManualfromABM'sSafetyServicesDepartmentat
http:[/appsi.abm.com/Corporate/Safe!y/osem.nsf
GeneralWorkRules: AlcoholicBeveragesandDrugs
ABMisconcernedabouttheuseofalcohol, illegaldrugs, orcontrolledsubstances, asitaffects theworkplace.Theuseorpossessionofthesesubstancesonthejobconstitutesapotential dangertothewelfareandsafetyofotheremployeesandexposestheCompanytotherisksof propertylossordamage, orinjurytootherpersons. ThefollowingrulesandstandardsofconductapplytoallemployeeseitheronCompanypropertyorduringtheworkday(including mealsandrestperiods). BehaviorthatviolatesCompanypolicyincludes:

Possessionoruseofanillegalorcontrolledsubstance, orbeingundertheinfluenceof an illegalor controlledsubstancewhileonthe job;
DrivingaCompanyvehiclewhileundertheinfluenceofalcohol; and Distribution, sales, orpurchaseofanillegalorcontrolledsubstancewhileonthejob.

Violationoftheserulesandstandardsofconductwillnotbetolerated. TheCompanyreserves therighttoinspectemployees,theirpossessions, andtheirworkspacesandtoimplementother measuresnecessarytoenforcethispolicyagainstalcoholandillegaldrug Off-the-jobdruguse, possessionorsalewhichhasadverseeffectontheCompany'scustomers,otheremployees,thepublicortheCompany'sreputationorimagecanalsobeconsidereda violationofthispolicy. Indecidingwhatactiontotake, theCompanywilltakeintoconsiderationthenatureoftheconductandtheemployee'spresentassignmentandrecordwiththe Company.

Additionally, anyemployeewhoistakingprescriptionand/orover-the-counterdrugswhichimpairtheemployee'sabilitytoworkinasafeorproductivemanner, mustnotifyasupervisorof suchuseimmediatelybeforestarting,orresumingwork.Allemployeesmustsubmittoapost- accidentdrugtest, ifanon-the-jobinjurycausescatastrophicinjuryorpropertydamage, orifCompanyreasonablysuspectstheemployeeisundertheinfluenceofdrugsoralcohol. ConsenttodrugoralcoholtestingwhenrequestedbytheCompanyisaconditionofcontinuedemploymentandrefusalisinsubordination. Violationsofthispolicy, includingrefusaltoconsent tomedicaltesting, willresultintheimmediatesuspensionoftheemployeependingan investigation.
36 Management Plan
Section C
r,
HealthandSafety: VehicleSafetyRules
ABMhasmadea commitmentofsafety,service,andqualityto bothouremployeesandour customers.As partof ourdedicationto providinga safeand healthfulwork environment,all employeesarerequiredto complywithVehicleSafetyRules. Failuretocomplymayresultin revocationof drivingprivilegesand otherdisciplinaryactions.

Seat Belts
Alloccupantsmustwearseatbeltswheneverthevehicleisinmotionorotherwiserequiredbylaw.

Mobile Devices
Anyemployeewhodriveson Companybusinessmay notusea mobiledeviceto reador send emailsortextmessageswhileoperatinga motorvehicle. Employeesshouldsafelypulltothe sideoftheroadorintoaparkinglotinordertoremovethemselvesfromtheflowoftrafficprior toemailing, texting, orwhenreceivingormakingcallswithoutahands-freedevice.Talkingona cellphonewithoutahands-freedevicewhiledrivingoncompanybusinessisalsoprohibitedand all stateandlocallaws regardingtheuse of cell phonesinvehiclesmustbe followed.

I
37 Management Plan
Section C

PARKING MANAGEMENT CONTRACT AT PALM SPRINGS INTERNATIONAL AIRPORT

EXHIBIT F
ATTACHMENT" C" Part 1 of 3

MANAGEMENT FEE PROPOSAL

THISFORMMUSTBECOMPLETED, SIGNEDANDSUBMITTEDINASEPARATELYSEALED ENVELOPE#2" ManagementFee",MOTwith Envelope#1, ManagementPlan') REQUEST FOR PROPOSAL( RFP# 06- 20)

PARKINGMANAGEMENTSERVICESATPALMSPRINGSINTERNATIONALAIRPORT RespondingtoRequestforProposalNo. 06-20forParkingManagementServicesatPalmSprings InternationalAirport, IIWEwill acceptas full paymentthe followingfeesfor providingall labor, supervision, services, materials, equipment, supplies, training, andanyothermiscellaneousitems requiredtoperformtheParkingManagementServices. TheundersignedProposerproposesand agreestoprovideallworkandservicesnecessarytodelivertheParkingManagementServicesas defined in the Scope of Work herein.

Contractoris expectedto followall applicableFederaland StateEmploymentlaws, rules and regulations. Invoices shall be submitted to the City on a Monthly Basis for actual services rendered, notin advanceor anticipationof services "to be rendered" andare payablebythe City within thirty( 30) days.

Management Fee( labor only") Schedule for Five( 6) Years:

Currentlytheemployeesdo notneedto bebadged. Employeesdonotpayto parkin the designated employee parking lot. Vendorsare to familiarizethemselveswith, and take into consideration, currentCalifornialegislationaffectingMinimumWagerequirementsthrough2022.

Management Fees( labor only, note ANNUAL COST
minimum hours in Attachment H'):

On- site Manager& Assist.

Mgr.( Supervisor) 146, 432
Parking Attendant 164, 031
TEO( s) Off- Season 46, 904
Taxi Starter( s) approx. 21 28, 393
weeks
TEO( s) Peak 153, 056
Taxi Starter( s) Season 64, 352
approx. 31
weeks
ANNUAL COST: Year 1 ( February 1, 603, 168
2020— Janua 3LM
Year 2( February 1, 2021— January 31, 2022) $ 642178 Year ( February 1, 2022— January 31, 2023) $ 681 231 Year 4( February 1, 2023— January 31, 2024) $ 706 847 Year 5( February 1, 2024— January 31, 2025) $ 738, 976 Five( 5) Year Grand Total: 3, 372, 400
24 ATTACHMENT " C"
Part 2 of 3
Proposedequipmentreplacementor upgradesnecessaryfor thecontractterm Theequipmentmaintenancewill be the responsibilityof the Contractorover the ten" of this agreement, the cost should be includedin the managementfee. TheAirport doesnot have details for the historical maintenance of the equipment.

Thecostfor all miscellaneoussupplies/equipmentsuchas radios, handheldunitfor daily vehicleinventorles,phonelines, datalines, tickets, receipts, equipmentmaintenance, signage and uniforms.

Cleaningtheparkingofficesandallparkingboothsis theresponsibilityof thecontractor.

Majorgroundsandparking,lotclean-upIstheresponsibilityoftheAirportstaff.

Holidayoverflowparking, thecostofthe27daysat20hoursdailyshouldbeincludedIntothemanagementfee. Thehourlyquoteshouldbefor hoursin excessofthebaseamount. The hourly costIs to includeall costsof theshuttleoperation.

Creditcardfeeswill be the responsibilityof the CityandshouldNOTbe includedin the management fee.

Thelistprovidedwillincludeallapprovedequipmenttobeamortizedoverthefive (5)yearcontract term. To be includedrin the management fee.

Equipment Location Make I Model
PSP Airport SkiData Revenue Control Equipment
PSP Airport SkiData Upgrade ( Refresh Care)
PSP Airport SkiData Upgrade ( P2P)
PSP Airport 4 Person Golf Cart
PSP Airport SkiData Maintenance contract (extended)
Other Equipment
Handheld radios
Computers
25 ATTACHMENT" C"
Part 3of3
HOURLY RATES:

Shuttle Operation, Hourly Charge ............$ 22. 45 / hour.

Hourly Charge for Cashier. .....................$ 20. 00 / hour.

Hourly Charge for TEO, for special events.........$ 21. 56 ( hour.

TobeapprovedbytheCitywhenapplicableinadditiontothetotalmanagementfee. (Thiswouldbe forspecialeventsorserviceprovidedInadditiontochargesaslistedintheScopeofServices, item L).

TOTAL PROPOSEDANNUALMANAGEMENTFEE
Note: ThemanagementfeeproposalSHALLincludea paymentto bemadetotheCityof Palm Springsfor$79,405.00bythesuccessfulbidder, nolaterthanJanuary31, 2020. Thispaymentwill fundtheremainingbalanceowedfortheexistingrevenuecontrolsystem. Thesuccessfulbidder will be responsibleto maintainthe.Skidatasystem, softwarelicensing, repairs, parts, maintenance andall otherscoststo operatethefullyoperational, PCIcompliantrevenuecontrolequipment through the term of the agreement.

InclusiveofALLlabor,payroll,materials, equipment,operatingexpensesandfacilityInvestment- To be amortized over five( 5) years:

Year 1 ( February 1, 2020— January 31, 2021) $ 780, 888 Year 2( February 1, 2021 — January 31, 2022) $ 808, 838 Year 3( February 1, 2022— January 31, 2023) $ 856 779 Year 4( February 1, 2023— January 31, 2024) $ 891, 047 Year 6 ( February 1, 2024- January 31, 2026) $ 933, 244 Grand Total Management Fee for five ( 5) Years $ 4, 270, 796 Fourmillion, twohundredseventythousand, sevenhundredandninety-sixdollars. write the Grand Total amount in words on line above)
NAMEOFFIRM: ABMAviation, Inc.

AUTHORIZED
SIGNATURE:

PRINTEDNAME: D. ScottHutchison
TITLE: SeniorVicePresident
26 PARKING MANAGEMENT CONTRACT AT PALM SPRINGS INTERNATIONAL AIRPORT

EXH IBIT G
a
t
0 EXHIBIT " G"

FEDERAL AVIATION ADMINISTRATION REQUIRED PROVISIONS

1. Licensee, as a part of the consideration for this License, covenants and aggress " as a covenant running with its interest in property" that in the event facilities are constructed, maintained, or otherwise operated on the Property of the License Areas for a purpose for which a Department of Transportation (" DOT") program or activity is extended or for another purpose involvingthe provisionof similarservices or benefits, the Licensee shall maintain and operate such facilities and services in compliance with all other requirements imposed pursuant to Title 49, Code of Federal Regulations DOT, Part 23, Nondiscriminationin FederallyAssisted Programsof the Department of Transportation- Effectuation of Title VI of the Civil Rights Act of 1964, as such regulations may be amended from time to time.

2. This agreement is subject to the requirements of the U.S. Department of Transportation' s regulations, 49 CFR Part 23. The concessionaire or contractor agrees that it will not discriminate against any business owner because of the owner' s race, color, national origin or sex in connection with the award or performance of any concession agreement, management contract, or subcontract, purchase or lease agreement or other agreement covered by 49 CFR Part 23.

3. The concessionaire or contractor agrees to include the above statements in any subsequent concession agreement or contract covered by 49 CFR Part 23, that it enters and causes those businesses to similarly include the statements in further agreements.

4. In the event of a breach of the covenants specified in Subsection 10. 1 and 10. 2 of this License, City shall have the right to terminatethe License and to reenter and repossess the License Areas and the facilities thereon and hold the same as if said License had never been made or issued. This provision does not become effective until the procedures of Title 49, Code of Federal Regulations, Part 23 are followed and completed, includingtheexpirationof anyappealrights.

5. Licensee shall furnish its services on a fair, equal, and not unjustly discriminatory basis to all users thereof and it shall charge fair, reasonable, and not unjustly discriminatory prices for its services; provided that Licensee may be allowed to make reasonable and nondiscriminatorydiscounts, rebates, or other similartype of price reductionsto volume purchases or other rational, reasonable basis. Non-compliancewith this provision shall constitute a material breach of this License and in the event of such non- compliance, City shall have the right to terminate this License and any interest in property created without liability or at the election of the City or the United States either or both Governmentsshall havethe right to judicially enforcethis provision.

6. Licensee agrees that it shall insert the above five ( 5) provisions in any agreement or contract by which Licensee grants a right or privilege to any person partnership, or corporation to render services to the public on the Lease Areas pursuant to this License.

Nothing in this provision shall be construed as waiving any obligations or requirements of the Licenseepursuantto Subsection4.3 of this Licenseor abrogatethe rightsofthe City pursuant to such subsection.
81 7. TheLicenseshallbesubordinatetotheprovisionsandrequirementsofanyexistingor futureagreementbetweentheCityandtheUnitedStatesrelativetothedevelopment, operation, or maintenance of the Property.

8. ThisLicense, andallprovisionshereof, shallbesubjecttowhateverrightthe United StatesGovernmentnowhasorinthefuturemayhaveoracquire, affectingthe control, operation, regulation, andtakingoverof the Propertyor the exclusiveor non-exclusive useofthePropertybytheUnitedStatesduringatimeofwarornationalemergency.

End of Attachment" K" (sample contract services agreement) ThisisalsothelastpageoftheRFPdocument, withtheexceptionofanyAddendathat may be issued during the process.
82