M0-
+,!
K,
%
M"'/
,-" -"(',M( M
('-&"''-,M-M)+$,@M
"'
%.
"' M
%%(0,-('
M'
M%2&)"
M-"('%M+$?M
x
'-" "
M!" !K%
/
%,M( M)
+
!%(+-
M"'M,("%M
#
'-M-(MM'-"('%M)+$M
"'M
0M
1"
(M'
M
/",
M)+$M,.)
+"'-
'
'-M('M))+()+"-
M
+
,)(',
M
-"(',M.'
+M
?M
x
+/
M,MM+$M
+/"
M+
)+
,
'--"/
M('M-!
M '-
+
'
2M
+
!%(+-
M
-
+"' M(&&"--
@MM'-"('%M0(+$ +(.)?M
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters :M
M
x
/
%()
MM)+( +&M-(M
('
.
-M
'/"+('&
'-%M
(&)%"'
M.
"-,M ( M%%M
-"('%M+$,M0!"%
M,
+/"' M('MM'-"('%M0(+$ +(.)?M
x (K.-!(+
M-0(M))
+,M('M-!
M)(-
'-"%M (+M0-
+M
('-&"'-"('M +(&M-!
M
()
+-"('M( M)
+,('%M0-
+
+ -M'
M,'(0&("%
,@M-!
,
M))
+,M,
+/"' M,M-!
M
,",M (+M-!
M
/
%()&
'-M( M'-"('KM 0"
M)(%"
2M('M-!
M.,
M( M-!
,
M/
!"
%
,M
"'M-"('%M+$,?M
x ('-+".-
M-(M-!
M
+%M
.%-"K
'
2M(.+
M-
+M +
&
'-M .'
+M
-!
M%
'M-
+M
-"('M%'?M
M
%)+
+/
M,M,
'"(+M&'
&
'-M,M-!
M
'"(+M
"
'
M(%"
2M
/",(+M0"-!M-!
M??M
'/"+('&
'-%M+(-
-"('M
'
2@M
"('M=?M
-"/"-"
,M"'
%.
M-!
M (%%(0"' A M
x
/","' M-!
M
"('%M
&"'",-+-(+M'
M,
'"(+M&'
&
'-M('M
&
+ "' M
",,.
,M,.
!M,M-!
M)(-
'-"%M (+M-!
M ,(%"'
M
"-"/
M
M'
M&&('".&M
)
+
!%(+-
M-(M
('-&"'-
M
+"'$"' M0-
+M,.))%"
,?M
x !)"' MF,M'-"('%M+
,)(',
M-(M-!
,
M-!+
-,M2M,
+/"' M('M0(+$ +(.),M
'
M2M
('-+".-"' M-(M ."
'
@M"'
%.
"' M-!
M "
M( M
,
+
!M'
M
/
%()&
'-M).%"
-"('@M12
'-
,M"'M-
+AM+"-"
%M ' (+&-"('M'
M
,
+
!M
,?M
x &)+(/"' M-!
M-
!'"
%M-+"'"' M( MG,M,
"
'-" "
M'
M
' "'
+"' M,- ?M
x +'"' M'MM+('3
M
%M (+M+
)+
,
'-"' M-!
M+
"('F,M744M,
"
'-",-,M'
M
' "'
+,M"'M'
(-"-"(',M0"-!M-!
M
&"'",-+-(+M'
M,
'"(+M&'
&
'-M-(M
--
+M"'-
+-
M,
"
'-" "
M)+"'
")%
,M"'-(M-!
M)(%"
2K&$"' M)+(
,,?M
x ,-%",!"' M'-"('%M)+(-(
(%M (+M-!
M)
+M+
/"
0M( M,
"
'-" "
M
(
.&
'-,?M
M
%)+
"-!M-!
M??M(+
,-M
+/"
@M%
M"'/
,-" -"(',M-(M
-
+&"'
M!"%%,%()
M,-"%"-2M( M+
,M
)+()(,
M (+M-"&
+M!+/
,-M"'M-!
M
'-+%M+
('M(,-M'
?M)
" "
M
-"/"-"
,M"'
%.
AM
x
))"' M
(%( 2M"'M-!
M "
%
@M'
M.,
M
+"%M)!(-( +)!"
M"'-
+)+
--"('M
'
M&-!
&-"
%M&(
%,M-(M
-
+&"'
M,%()
M,-"%"-2?M
x ((+
"'-"' M+
,
+
!M0"-!M
(&&.'"-2M,-$
!(%
+,M0!(M0
+
M
('
+'
M0"-!M
'-.+%M+
,(.+
M)+(-
-"('?M
x !+
-
+"3"' M-!
M
(%( 2M( M'M*."
+M-!-M,
+/
,M,M-!
M,(%
M,(.+
M( M
+"'$"' M0-
+M (+M-!
M
"-2M( M
(+
@M+
('?M
M
,MM
(',.%-'-M0"-!M&
,M'
M
((+
@M%
M
(%( "
M"'/
,-" -"(',M( M-0(M
('-&"'-
M
,"-
,MD%-
+M%",-
M('M-!
M.)
+ .'
M
EM"'M-!
M(+-%'
@M+
('@M+
M'
MM%+
M
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters ;M
M
!3+
(.,M0,-
M,"-
M"'M
,-
+'M+
('?M.-"
,M"'
%.
M-!
M (%%(0"' AM
x .)
+/","' M2
+K%(' M
(+-M (+M,("%M'
M +(.'
0-
+M,&)%"' ? M
x ('
.
-"' M*."
+M-
,-,?M
x '/
,-" -"' M
-"/
M .%-,M
'
-!M,"-
,M)+()(,
M (+M!3+
(. ,M0,-
M
",)(,%?M
M
)+
+(&M5==4M-(M5==<@M-. !-M-M%
,-M('
M
(.+,
M)
+M,
&
,-
+M-M-!
M
(&&.'"-2M
(%%
M'
M
.'"/
+,"-2MMMMMM%
/
%,AM
x -M'M+'
",
(M--
M'"/
+,"-2@M!
%
M'M
#.'
-M
.%-2M)(,"-"('M'
M
-. !-M
(.+,
,M"'M
'/"+('&
'-%M
(%( 2@M(
'( +)!2MD%M'
M
%
-.+
E@M!2
+(
(%( 2@M'
M +(.'
0-
+M
('-&"'-"('?M
x
+/
M,MM
(&&"--
M&
&
+M (+M +
.-
M'
M.'
+ +
.-
M,-.
'-,?M
x . !-M
(.+,
,M"'M
'/"+('&
'-%M
(%( 2M'
M(
'( +)!2M-M-!
M(%%
M( M
+"'?M
x +-M-"&
M
(%( 2M"',-+.
-(+M-M(%
'M
,-M(%%
M"'M.'-"' -('M
!@M
%" (+'"M +(&M6454M-(M6458M'
M"'M645;?M
M
" +
%(+
(+
++
)+
(+
'?@M644<?M",
%(,.+
M( M3+
(.,M,-
M ,,.
,M.'
+M?M+
,
'--"('M
-(M-!
M.%"
M'/"+('&
'-%M
0M('
+
'
@M.
'
@M+
('?M
M
(+
'?@M644<?M",
%(,.+
M( M3+
(.,M,-
M ,,.
,M.'
+M?M '/"-
M
)+
,
'--"('M-(M??MM
"('M=@M'M+'
",
(@M%" (+'"?M
M
(+
''(+6449?M,
M( M%
-+('"
M-,
,M"'M'/"+('&
'-%M
.%-"('@M
(%"
2M
$"' M'
M.%"
M+-"
")-"('?M+(0' "
%
,M6449@M
'/
+@M(%(+
(?M
M
(+
''(+6448?M
+
!%(+-
M('-&"'-"('M( M-!
M(%(+
(M"/
+M'
M &)
-,M-(M
+"'$"' M-
+M"'M
/
M'
M-!
M(.-!0
,-
+'M??M+
,
'--"(' M-(MM&
-"' M( M-!
M
&
+"
'M +(.'
0-
+M +.,-@M
,M
,@M M D,
+/
M ('M
('
+
'
M (+ '"3"' M
(&&"--
E?M
M
(+
''@M6448?M '/"-
M-
,-"&('2M-(MM%" (+'"M
'-
M
(&&"--
M
!
+"' M('M"+M-(1"',M-M,
!((%,M"'M(.-!
+'M%" (+'"@M
(,M'
%
,?M
M
+(0'@M?@M++(0@M
?@M+2@M?M'
M(+
'@M6448?M'M,-"&-
M( M(,-,M-(M
+
,,M
M
%
,
,M +(&M'
+ +(.'
M-(+
M'$,M'
M-!
M
,.%-"' M &)
-M-(M
+"'$"' M-
+M
%%,?M
+
,
'--"('M-(M-!
M+(.'
M-
+M'
M'/"+('&
'-%M
0M('
+
'
@M-"('%M
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters <M
M
+(.'
0-
+M,,(
"-"('
(+
''(+6448?M
+
!%(+-
M('-&"'-"('M( M-!
M(%(+
(M"/
+M'
M &)
-,M
-(M+"'$"' M-
+M"'M+"3('M'
M-!
M(.-!0
,-
+'M??M+
,
'--"('M-(MM&
-"' M ( M-!
M
&
+"
'M+(.'
0-
+M+.,-@M!(
'"1@MMD,
+/
M('M
('
+
'
M(+ '"3"' M
(&&"--
E?M
M
(+
''(+6447?M
+
!%(+-
M('-&"'-"('M( M-!
M(%(+
(M"/
+M'
M &)
-,M
-(M+"'$"' M-
+M"'M-!
M(.-!0
,-
+'M??M '/"-
M)+
,
'--"('M-(MM,)
"%M
(&&"--
M
&
-"' M( M-!
M-"('%M
&2M( M
"
'
,@M +/"'
@M?M
M
(+
'?@M6447?M
+
!%(+-
M('-&"'-"('M( M-!
M(%(+
(M"/
+?M '/"-
M
)+
,
'--"('M-(MM-+"%MM&
-"' @M
!' @M?M
M
(+
'?@M6447?M
+
!%(+-
M('-&"'-"('M( M-!
M(%(+
(M"/
+?M '/"-
M
)+
,
'--"('M-(MM&
-"' M( M-+"%M+
)+
,
'--"/
,@M+$
+@M?M
M
(+
'?@M6447?M &)
-M( M
+
!%(+-
M('M-!
M(%(+
(M"/
+M'
M,,(
"-
M
+"'$"' M-
+M.))%"
,?M '/"-
M)+
,
'--"('M-(M-!
M '-
+K+"%M
-"' @M(++
,M
+-"'
3M+"
?M
M
(+
'?@M6447?M!
M&
+
'
M( M
+
!%(+-
M,MM"
,)+
M+"'$"' M
-
+M('-&"''-?M '/"-
M)+
,
'--"('M-(M-!
M??MM
"('M=?M
M
(+
'?@M6447?MM
.
-"/
M))+(
!M-(M-!
M,,
,,&
'-M( M
+
!%(+-
M
('-&"'-"('?M '/"-
M)+
,
'--"('M-(M-!
M%" (+'"M,,
&%2M-.+%M
,(.+
,M
(&&"--
?M
M
(+
'?@M6447?M
+
!%(+-
AMM(%
M+M
2M"'M+"'$"' M-
+?M
+
,
'--"('M-(MM&
-"' M( M-!
M-"('%M+(.'
0-
+M,,(
"-"('?M
M
(+
'?@M6446?M+(&M'$M-(M)AMM!+('(%( 2M( M
M"'M+(.'
0-
+?M
+
,
'--"('M-(MM&
-"' M( M-!
M-"('%M+(.'
0-
+M,,(
"-"('?M
M
(+
'?@M6446?MM!+('(%( 2M( M
M"'M+(.'
0-
+M'
M'M,-"&-
M( M
(,-,M-(M
+
,,M &)
-,M-(M+(.'
0-
+?M+
,
'--"('M-(M-!
M''.%M&
-"' M( M-!
M
(
"
-2M( M'/"+('&
'-%M
(.+'%",-,?M
M
(+
'?@M6446?M'M,-"&-
M( M-!
M(,-M-(M
+
,,M
M('-&"'-"('M"'M
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters =M
M
+(.'
0-
+MD'
M!(M"%%M2E?M+
,
'--"('M-(MM&
-"' M( M-!
M-"('%M
+(.'
0-
+M,,(
"-"('?M
M
(+
'?@M6446?M'M,-"&-
M( M(,-,M-(M
+
,,M
M
%
,
,M +(&M
'
+ +(.'
M-(+
M'$,M'
M-!
M
,.%-"' M &)
-M-(M+"'$"' M-
+M
%%,?M
+
,
'--"('M-(MM&
-"' M( M-!
M??MM'
M--
M'
+ +(.'
M-(+
M'$M
+( +&M&'
+,?M
+
(+
'?@M6445?M+(&M'$M-(M)AMM!+('(%( 2M( M
M"'M
+(.'
0-
+?M').%",!
M+
)(+-?M
M
(+
'?@M6445?M,-"&-
M%
'.)M(,-M (+M
M"'M+(.'
0-
+M,
M, M
+"'$"' M-
+?M').%",!
M+
)(+-?M
M
(+
'?@M6445?M,-"&-
M(,-,M-(M
+
,,M
M
%
,
,M +(&M
$"' M
'
+ +(.'
M-(+
M'$,?M').%",!
M+
)(+-?M
M
(+
'?@M '
M '
(.0
+"$@M
?@M 5===?M(-
'-"%M-
+M('
+',M
%-
M-(M'(0&("%
M,
?M-
+M
,(.+
,M"/","('@M-"('%M+$M
+/"
@M
!'"
%M
)(+-?M
M
'
(.0
+"$@M
?M'
M(+
'?M5===@M-
+M.%"-2M('
+',M
%-
M-(M
+,('%M-
+
+ -M,
?M-
+M
,(.+
,M"/","('@M-"('%M+$M
+/"
@M
!'"
%M
)(+-?M
M
(+
'?@M5===@M ,M"%.-"('M-!
M(%.-"('M-( M(%%.-"('M"'M-"('%M+$ ,CM!
M
(+
M+" !-M(
"
-2M"''.%M
-"' @M,!
/"%%
@M(+-!M+(%"'?M
M
(+
'?@M5==;@M!
M(-
'-"%M (+M
M-(M ('-&"'-
M+(.'
0-
+?M??M
M.)
+ .'
M+(.'
0-
+M
!'"
%M(+.&M''.%M
-"' @M
,M
,@M
/
?M
M
(+
'?@M'
M"%%@M
?@M5==:@M &)
"&
'-,M -(M '-+"',"
M
&
"-"('@M
(
--M
"
%
M/%M"+M--"('@M('
+
'
M('M '-+"',"
M
&
"-"('M( M!%(+"'-
M2
+(
+(',@M
%-M
$
M"-2?M
M
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters 54M
M
(+
'?@M.$.' @M?
?@M5==:@M!
M.%'
+"%"-2M( M+(.'
0-
+M-(M
'-!+()(
'"
M('-&"''-,M('M-!
M ,%'
M( M
."@M0""?M0""M-
+M(+$,M
,,(
"-"('M''.%M
-"' @M
."@M
-(
+M5==:?M
M
(+
'+?@M.$' @M?M
?@M5==:@M'$"' M+(.'
0-
+M.%'
+"%"-2M"'M
'-+%M
!.@M
0""?M+(
"' ,@M
( +)!"
M ' (+&-"('M2,-
&,M"'M'/"+('&
'-%M
,(.+
,M
'
&
'-@M"+M'
M,-
M
'
&
'-M,,(
"-"('M.%"
-"('M K:5?M
M
(+
'?@M5==8?M+(.'
0-
+M!M+M
M-
M+M"M3MM-M"M(M'M'
M%M
'M.)MM-M%(,"' M
"%"-+2M ,
,M"'M%" (+'"?M+(
"' ,@M%" (+'"M+(.'
0-
+M
,(.+
,M
,,(
"-"('M
-"' ?M
M
(+
'?M'
M(%@M
??@M5==7?M(%
M( M-!
M??MM"'M-!
M" !M%" ',M--
,M
+(.'
0-
+M
!+
M
&(',-+-"('M +( +&?M +(
"' ,@M "1-!M "
''"%M
2&)(,".&M('M-!
M+-" "
"%M
!+
M( M+(.'
0-
+?M
M
(+
'?@M5==7?M??MM(%"
2M('M-!
M
!'"
%M &)+
-"
"%"-2M( M-!
M
%
'.)M( M
K
('-&"'-
M+(.'
0-
+?M%" (+'"M+(.'
0-
+M
,(.+
,M
,,(
"-"('M
-"' ?M M
+
(+
'?@M5==6?M
',
M('*.
(.,M!,
M
"*."
M('-&"'-"('M( M
+(.'
0-
+AM'M.'
M( M+
/
'-"('???M+(
"' ,@M,,(
"-"('M( M' "'
+"' M
(%( ",-,M''.%M
-"' @M/?M79?M
M
+ $
)+
%
-
M,M,.#
-M&--
+M
1)
+-M (+M-!
M%" (+'"M+(
,,"(' %M
(%( ",-M%"
',"' M
1&"'-"(',@M644=K6455?M
M
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters
-+!#2!41$*0$
0'/$
!*/!+*'"!!('%+-*'!
//*
!0(
+.$*%$(#
&
$(
!3
)!'(,-+.$*%$(#.2!,$"+)
SWAPE 1 Rosenfeld CV
ȱ
ȱ
ȱ
ȱ
ȱ
ȱ ȱȱȱȱ
ȱ
ȱ
ȱ ȱ ȱ
ȱȱ
ȱ
ȱ
ȱ
,,ȱ
ȱ
"#!(-ȱ
%!"#(ȱ ȱ"
#
-ȱ)+++,ȱ""!##
ȱ
ȱ ȱ
#!#
,ȱ
,
,ȱ
%!
#
ȱ
-ȱ,,ȱ!
(-ȱ)++*,ȱ
""ȱ
ȱ !
ȱ&"#ȱ
",
,,ȱ
%!
#
ȱ
#$"-ȱ,,ȱ
#ȱ!!-ȱ)++),ȱȱ
""ȱ
ȱ&"#&#!ȱ#!#
#,ȱ
ȱ
ȱ
!,ȱ
"
ȱ"ȱ#ȱ
%!
#
ȱ
"#ȱ#ȱ
ȱ#!ȱ!ȱ
! ##
ȱ
#! !"ȱ/
0,ȱ"ȱ $"ȱ"ȱ
#ȱ#ȱ
ȱ#!
" !#ȱ ȱ
%!
#
ȱ
#
#"-ȱ!"ȱ""""
#-ȱ
ȱ
ȱ!"# !#
,ȱȱ"ȱ
! #ȱ' !
ȱ!
"ȱ!
ȱ
# !
ȱ
ȱ
ȱ ȱ
$#
ȱ" $!"ȱ"ȱ#(ȱ!
#ȱ# ȱ$
ȱ
ȱ
ȱ
#,ȱ!,ȱ
"
ȱ"ȱ
%"##ȱ
ȱ"
ȱ!
#
ȱ ! !
"ȱ
ȱ!"ȱ
""""
#"ȱ !ȱ
#
#ȱ "#"ȱ
#
-ȱ #!
$
-ȱ #ȱ
ȱ $
ȱ '(
#"-ȱ
!
#ȱ
"
%
#"-ȱ "#"-ȱ! #%ȱ&"#-ȱ
"-ȱ
"-ȱ '
"-ȱ$!
"-ȱ%
#
ȱ !
"-ȱ"
Ȭ%
#
ȱ
!
"-ȱ !
!#-ȱ%(ȱ
#
"-ȱ""# "-ȱ
-ȱ$
$"$
ȱ
(
!"-ȱ
ȱ !,ȱȱ
#ȱ ! #"ȱ
! !
ȱ(ȱ!,ȱ
"
ȱ
$ȱ#ȱ
&
.ȱ
ȱ
ȱ
Client: Nexsen Pruet, LLC (Charleston, South Carolina)
Serving as expert in chlorine exposure in railroad tank car accident where approximately 120,000 pounds of chlorine were released.
Client: Buzbee Law Firm (Houston, Texas)
Serving as expert in catalyst release and refinery emissions cases against BP Texas City . One case settled regarding worker exposure, but ongoing litigation re mains involving ~21,500 plaintiffs who have health claims and are seeking remediation from chemicals released from BP facility.
Client: Girardi Keese (Los Angeles, California)
$WWDFKPHQW)
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters
SWAPE 2 Rosenfeld CV
Serving as expert investigating hy drocarbon exposure and property dama ge for ~600 individuals and ~280 properties in Carson, California, where homes were constructed above a large tank farm formerly owned by Shell.
Client: Brent Coon Law Firm (Cleveland, Ohio)
Served as expert calculating an environmental exposure to benzene, PAHs, and VOCs from a Chevron Refinery in Hooven Ohio. Ran AERMOD to calculate cumulative dose.
Client: Girardi Keese (Los Angeles, California)
Served as expert testifying on hydro carbon exposure to a woman who worked on a fuel barge operated by Chevron.
Demonstrated that the plaintiff was exposed to excessive amounts of benzene.
Client: Lundy Davis (Lake Charles, Louisiana)
Served as consulting expert on an oil field case represen ting the lease holder of a contaminated oil field. Conducted field work evaluating oil field contamin ation in Sulfur, Louisiana. Property is owned by Conoco Phillips, but leased by Yellow Rock, a small oil firm.
Client: Cox Cox Filo (Lake Charles, Louisiana)
Serving as testifying expert on multimillion gallon oil spill in Lake Charles which occurred on June 19, 2006, resulting in hydrocarbon vapor exposure to hundreds of workers and resi dents. Prepared air model and calculated dose. Demonstrated that petroleum odor alone can result in significant health harms.
Client: Cotchett Pitre & McCarthy (San Francisco, California) Served as testifying expert representing homeowners who unknowingly purchased homes built on an old oil field in Santa Maria, California. Properties have high concentrations of petroleum hydrocarbons in subsurface soils resulting in diminished property value.
Client: Baron & Budd (Dallas, Texas) & Weitz & Luxenberg (New York, NY) Serving as consulting expert in MTBE Federal Multi District Litigation (MDL) in Ne w York. Consolidated ground water data, created maps for test cases, constructed damage model, evaluated taste and odor threshold levels.
Client: Law Offices Of Anthony Liberatore P.C. (Los Angeles, California) Served as testifying expert representing individuals who rented homes on the Inglewood Oil Field in California.
Plaintiffs were exposed to hydrocar bon contaminated water and air, and experienced health harms associated with the petroleum exposure.
Client: Baron & Budd P.C. Dallas Texas and Korein Tillery (Madison, County) Illinois, Private Wells Analysis: Coordina ted data acquisition and GIS analysis evaluating private well proximity to leaking underground storage tanks to sup port litigation noting that private well owners should be compensated for MTBE testing.
Client: Orange County District Attorney (Orange County, California) P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters
SWAPE 3 Rosenfeld CV
Coordinated a review of 143 ARCO gas stations in Orange County to assist the District Attorney’s prosecution of CCR Title 23 and California Health and Safety Code violators.
Client: Environmental Litigation Group (Birmingham, Alabama) Serving as testifying expert in a health effects ca se against ABC Coke/Drummond Co for polluting a community with PAHs, benzene, particulate matter, heavy metals, and coke oven emis sions. Created air dispersions models and conducted attic dust sampling, exposure modeling, and risk assessment for plaintiffs.
Client: Masry Vitatoe (Westlake V illage, CA), Engstrom Lipscomb Lack (Los Angeles, CA) & Baron & Budd (Dallas Texas).
Served as consulting expert in Propos ition 65 lawsuit filed against the major oil companies for benzene and toluene releases from gas stations and refineries which contamin ated groundwater. Settlement included over $110 million dollars in injunctive relief.
Client: Tommy Franks Law Firm (Austin, Texas)
Served as expert evaluating groundwater contamination which resulted from the hazardous waste injection program and negligent actions of Morton Thiokol and Rohm Hass. Interpreted drinking water contamination and community exposure.
Client: Baron & Budd (Dallas Texas) and Sher Leff (San Francisco, California) Serving as consulting expert for se veral California cities which have filed defective product cases against Dow Chemical and Shell for 1,2,3-trichloropropane groundwater contamination. Generated maps showing capture zones of impacted wells for various municipalities.
Client: Baron & Budd (Dallas Texas) and Korein Tillery (Madison County, Illinois) Serving as consulting expert for a Class Action defective product Atrazine claim filed in Madison County, Illinois against Syngenta and five other manufactures. The plai ntiff class representative is Holiday Shores Water System which is evaluating health issu es associated with atrazine, costing out treatment for filtration of public drinking water supplies.
Client: Weitz & Luxenberg (New York, NY)
Serving as expert on Property Damage and Nuisance claims resulting from emissions from the Countywide Landfill in Ohio. The landfill had an exothermic reaction or fire resulting from aluminum dross dumping, and the EPA fined the landfill $10,000,000 dollars.
Client: Baron & Budd (Dallas Texas)
Serving as consulting expert for a groundwater contamin ation case in Pensacola Florida where fluorinated compounds contaminated wells operated by Escambia County.
Client: Environmental Litigation Group (Birmingham, Alabama) P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters
SWAPE 4 Rosenfeld CV
Serving as an expert on property damage, medical monitoring and toxic tort claims that have been filed on behalf of over 12,000 plaintiffs who were exposed to PCBs and di oxins/furans resulting from emissions from Monsanto and Cerro Copper’s operations in East Sauget, Illinois.
Client: Environmental Litigation Group (Birmingham, Alabama) Served as an expert on groundwater case when Exxon Mobil and Helena Chemical released ethylene dichloride into groundwater resulting in a large plume. Prepared report on the appropriate treatment technology and cost, and flaws with the proposed on site remedy.
Client: Environmental Litigation Group (Birmingham, Alabama) Serving as an expert on air emissions released when a Bartlo Packaging Incorpora ted facility in West Helena Arkansas exploded resulting in community exposure to pesticides and smoke from combustion of pesticides.
Client: Omara & Padilla (San Diego, Califorinia)
Served as testifying expert on nuisance case against Nutr o Dogfood Company that constructed a large dog food processing facility in the middle of a re sidential community in Victorville Californi a with no odor co ntrol devices.
The facility has undergone significant modifications including installation of a regenerative thermal oxidizer.
Client: Environmental Litigation Group (Birmingham, Alabama) Serving as an expert on property damage and medical mo nitoring claims that have been filed against International Paper resulting from chemical emissions from facilities located in Bastrop Louisiana, Prattville, Alabama, and Georgetown South Carolina.
Client: Estep and Shafer (West Virginia)
Served as expert running various air models to calcula te acid emissions dose to resi dents resulting from emissions from a coal fired power plant in West Virginia.
Client: Watts Law Firm (Austin, Texas), Woodfill Pressler (Houston, Texas), Woska & Ass. (Oklahoma) Served as testifying expert on commun ity and worker exposure to CCA, creo sote, PAHs, and dioxins/furans from a BNSF and Kopper’s Facility in Somerville, Texas. Conducted field sampling, risk assessment, dose assessment and air modelling to quantify exposure to workers and community members.
Client: Environmental Litigation Group (Birmingham, Alabama) Served as expert regarding community exposure to CCA, creosote, PAHs, and dioxins/furans from a Louisiana Pacific wood treatment facility in Florala, Alabama. Cond ucted blood sampling and environmental sampling to determine environmental exposure to dioxins/furans and PAHs.
Client: Sanders Law (Colorado Springs, Co) and Vamvoras & Schwartzberg (Lake Charles, Louisiana) Serving as expert calculating chemical e xposure to over 500 workers from lar ge ethylene dichlo ride spill in Lake Charles, Louisiana, at the Conoco Phillips Refinery.
Client: Baron & Budd P.C. (Dallas, Texas)
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters
SWAPE 5 Rosenfeld CV
Served as consulting expert in a de fective product lawsuit against Dow Agroscience focusi ng on Clopyralid, a recalcitrant herbicide that damaged numerous compost facilities across the United States.
Client: Sullivan Papain Block McGrath & Cannavo (NY, NY) and The Cochran Firm (Dothan, MS) Served as expert regarding community exposure to meta ls, PAHs PCBs, and dioxins/furans from the burning of Ford Paint Sludge and municipal solid waste in Ringwood, New Jersey.
Client: Rose, Klein Marias (Los Angeles, CA)
Serving as expert in Proposition 65 cases, each one citing an individual facility in the Port of Oakland. Prepared air dispersion and risk models to demonstrate that each facility emits diesel particulate matter that results in risks exceeding 1/100,000, hence violating the Proposition 65 Statute.
Client: Rose, Klein Marias (Los Angeles, CA)
Serving as expert in 55 Proposition 65 cases, each one citing an individual facility in the Port of Los Angeles and Port of Long Beach as the defendant. Prepared air dispersion and risk models to demonstrate that each facility emits diesel particulate matter that results in risks exceeding 1/100,000, hence violating the Proposition 65 Statute.
Client: Graham & Associates (Calabasas, CA)
Served as expert in a case in which General Motors is the plaintiff and BP Arco is the defendant. Conducted air models to demonstrate that sulfur emissions from the BP Arco facility formed sulfuric acid, destroying paint on over 350 automobiles.
Client: Rose, Klien Marias (Los Angeles, CA) and Environmental Law Foundation (San Francisco, CA) Served as expert in a Proposition 65 case against potato chip manufacturers. Conducted an analysis of several brands of potato chips for acrylamide concentration and found that all samples exceeded Proposition 65 No Significant Risk Levels.
Client: Gonzales & Robinson (Westlake Village, CA)
Served as testifying expert in a toxic tort case against Chevron (Ortho) for allowing a community to be contaminated with lead arsenate pesticide. Created air dispersion models, soil vadose zo ne transport models, and evaluated bioaccumulation of lead arsenate in food.
Client: Environment Now (Santa Monica, CA)
Served as expert for Environment Now to convince the State of California to file a nuisance claim against the automobile manufactures to recover MediCal damages from expenditures on asthma-related health care costs.
Client: Trutanich Michell (Long Beach, California)
Served as expert representing San Pedro Boat Works in the Port of Los Angeles. Prepared air dispersion, particulate air dispersion, and storm water discharge models to demonstrate that Kaiser Bulk Loading is responsible for copper concentrate accumulating in the bay sediment.
Client: Azurix of North America (Fort Myers, Florida)
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters
SWAPE 6 Rosenfeld CV
Provided expert opinions, reports an d research pertaining to a proposed County Ordinance requiring biosolids applicators to measure VOC and odor concentrations at application sites’ boundaries.
Client: MCP Polyurethane (Pittsburg, Kansas)
Provided expert opinions and reports regarding metal-laden landfill runoff that damaged a running track by causing the reversion of the polyurethane due to its catalytic properties.
Risk Assessment And Modeling
Client: ABT-Haskell (San Bernardino, California)
Prepared air dispersion model for a proposed state-of-the-art enclosed com post facility. Developed odor detection limits to predict 1, 8, and 24-hour off-s ite concentrations of sulfur, ammonia, and amine as well as prepared a traffic analysis.
Client: Jefferson PRP Group (Los Angeles, California)
Evaluated exposure pathways for chlorinated solvents an d hexavalent chromium for human health risk assessment of Los Angeles Academy (formerly Jefferson New Middl e School) operated by Los Angeles Unified School District.
Client: Covanta (Susanville California)
Prepared human health risk assessment for Covanta Energy focusing on agricultural worker exposure to caustic fertilizer.
Client: CIWMB (Sacramento California)
Used dispersion models to estima te traveling distance and VOC concentr ations downwind from a composting facility for the California Integrated Waste Management Board.
Client: Carboquimeca (Bogotá, Columbia)
Evaluated exposure pathways for human health risk a ssessment for a confidential client focusing on significant concentrations of arsenic and chlorinated solvents contaminating groundwater used for drinking water.
Client: Navy Base Realignment and Closure Team (Treasure Island, California) Used Johnson-Ettinger model to estimate indoor air PCB concentrations and compared estimated values with empirical data collected in homes. Negotiated action levels with DTSC.
Client: San Diego State University (San Diego California) Measured CO 2 flux from soils amended with different quantities of biosolids compost at Camp Pendleton to determine CO2 credit values for coastal sage under fertilized and non-fertilized conditions.
Client: Navy Base Realignment and Closure Team (MCAS Tustin, California) Evaluated cumulative risk of a multiple pathway scenario with a child resident and a construction worker’s exposure to air and soil via particulate and vapor inhalation, incidental soil ingestion, and dermal contact with soil.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters
SWAPE 7 Rosenfeld CV
Client: MCAS Miramar (San Diego, California)
Evaluated exposure pathways of metals in soil, comparing site data to background data. Risk assessment incorporated multiple pathway scenarios assuming child resi dent and construction worker exposure to particulate and vapor inhalation, soil ingestion, and dermal soil contact.
Client: Naval Weapons Station (Seal Beach, California) Used a multiple pathway model to generate dust emission factors from automobiles driving on dirt roads. Calculated bioaccumulation of metals, PCBs, dioxin congeners and pesticides to estimate human and ecological risk.
Client: King County, Douglas County (Washington State) Measured PM10 and PM 2.5 emissions from windblown soil treated with biosolids and a polyacrylamide polymer in Douglas County Washington. Used Pilat Mark V impactor for measurement and compared data to EPA particulate regulations.
Client: King County, Seattle, Washington.
Conducted emission inventory for several compost and wa stewater facilities comparing VOC, particulate, and fungi concentrations to NIOSH values estimating risk to workers and individuals at neighboring facilities.
Air Pollution Investigation and Remediation
Client: Republic Landfill (Santa Clarita, CA)
Managed a field investigation of odor around a landfill duri ng 30+ events. Using hedonic tone, butanol scale, dilution-to-threshold values, and odor character to evaluate odor sources and character and intensity.
Client: California Biomass (Victorville, CA)
Managed a field investigation of odor around landfill during 9+ events. Using hedonic tone, butanol scale, dilution- to-threshold values, and odor character to evaluate odor sources, character and intensity.
Client: ABT-Haskell (Redlands, California)
Assisted in permitting a compost f acility that will be completely enclosed with a complex scrubbing system using acid scrubbers, base scrubbers, biofilters, heat exchangers and chlorine to reduce VOC emissions by 99 percent.
Client: Synagro (Corona, California)
Designed and monitored 30-foot by 20-foot by 6-foot biofilter for VOC cont rol from an industrial composting facility in Corona, California, reducing VOC emissions by 99 percent.
Client: Jeff Gage, (Tacoma, Washington)
Conducted emission inventory at indu strial compost facility using GC/MS analyses for VOCs. Evaluated effectiveness of VOC and odor control systems and estimated human health risk.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters
SWAPE 8 Rosenfeld CV
Client: Daishowa America (Port Angeles Mill, Washington) Analyzed industrial pa per sludge and ash for VOCs, heavy metals an d nutrients to develop a land application program. Metals were compared to federal guidelines to determine maximum allowable land application rates.
Client: Jeff Gage (Puyallup Washington)
Measured effectiveness of biofilters at composting facility and ran EPA dispersion models to estimate traveling distance of odor and human health risk from exposure to volatile organics.
Surface Water, Groundwater, and Wastewater Investigation/Remediation
Client: Confidential (Downey, California)
Managed groundwater investigation to determine horizontal extent of 1,000 foot TCE plume associated with a metal finishing shop.
Client: Confidential (West Hollywood, California)
Designed soil vapor extraction system that is currently being installed for confidential client. Managed groundwater investigation to determine horizontal extent of TCE plume associated with dry cleaning.
Client: Synagro Technologies (Sacramento, California)
Managed groundwater investigation to determine if biosolids app lication impacted salinity and nutrient concentrations in groundwater.
Client: Navy Base Realignment and Closure Team (Treasure Island, California) Assisted in the design and remediation of PCB, chlori nated solvent, hydrocarb on and lead contaminated groundwater and soil on Treasure Island. Negotiated screening levels with DTSC and Water Board. Assisted in the preparation of FSP/QAPP, RI/FS, and RAP documents and assisted in CEQA document preparation.
Client: Navy Base Realignment and Closure Team (MCAS Tustin, California) Assisted in the design of groundwater monitoring systems for chlorinated solvents at Tustin MCAS. Contributed to the preparation of FS for groundwater treatment.
Client: MCP (Walnut, California)
Conducted forensic surface water and sediment samp ling. Designed and conducted bench scale laboratory experiments. Demonstrated that metal and organic contaminants in storm water and sedi ment from landfill flooded and chemically compromised a polyurethane track.
Client: Mission Cleaning Facility (Salinas California) Prepared a RAP and cost estimate for using an oxygen rel easing compound (ORC) and mo lasses to oxidize diesel fuel in soil and groundwater at Mission Cleaning in Salinas.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters
SWAPE 9 Rosenfeld CV
Client: King County, Washingon
Established and monitored experimental plots at a US EPA Superfund Site in wetland and upland mine tailings contaminated with zinc and lead in Smelterville, Idaho. Used organic matter and pH adjustment for wetland remediation and erosion control.
Client: City of Redmond (Richmond, Washington)
Collected storm water from compost-amended and fertilized turf to measure nutrients in urban runoff. Evaluated effectiveness of organic matte r-lined detention ponds on reduction of peak flow during storm events. Drafted compost amended landscape installation guidelines to promote storm water detention and nutrient runoff reduction.
Client: City of Seattle (Seattle, Washington)
Measured VOC emissions from Renton wa stewater treatment plant in Washington. Ran GC/MS, dispersion models, and sensory panels to characterize, quantify, control and estimate risk from VOCs.
Client: Plumas County (Quincy, California)
Installed wetland to treat contaminated water containing 1% copper in an EPA Superfund site. Revegetated 10 acres of acidic and metal laden sand dunes re sulting from hydraulic mi ning. Installed and monitored piezometers in wetland estimating metal loading.
Client: Adams Egg Farm (St. Kitts, West Indies)
Designed, constructed, and main tained 3 anaerobic digesters at Springfiel d Egg Farm, St. Kitts. Digesters treated chicken excrement before effluent discharged into sea. Chicken waste was converted into methane cooking gas.
Client: BLM (Kremmling Colorado)
Collected water samples for monitoring program along upper stretch of the Colorado River. Rafted along river, protecting water quality by digging and repairing latrines.
Soil Science and Restoration Projects
Client: Kinder Morgan (San Diego County California)
Designed and monitored the restoration of a 110-acre project on Camp Pendleton along a 26-mile pipeline. Managed crew of 20, planting coastal sage, riparian, wetland, nativ e grassland, and marsh ecosystems. Negotiated with the CDFW concerning species planting list and success standards.
Client: NAVY BRAC (Orote Landfill, Guam)
Designed and monitored pilot landfill cap mimicking limestone forest. Measur ed different species’ root-penetration into landfill cap. Plants were used to evapotranspirate water, reducing water leaching through soil profile.
Client: LA Sanitation District Puente Hills Landfill (Whittier, California) Monitored success of upland and wetland mitigation at Puente Hills Landfill operated by Sanitation Districts of Los Angeles. Negotiated with the Army Corps of Engineers and CDFG to obtain an early sign-off.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters
SWAPE 10 Rosenfeld CV
Client: City of Escondido (Escondido California)
Designed, managed, installed, and monitored a 20-acre co astal sage scrub restoration project at Kit Carson Park, Escondido, California.
Client: Home Depot (Encinitas, California)
Designed, managed, installed and monitored a 15-acre coas tal sage scrub and wetland re storation project at Home Depot in Encinitas, California.
Client: Alvarado Water Filtration Plant (San Diego, California) Planned, installed and monitored 2-acre riparian and coastal sage scrub mitigation in San Diego California.
Client: Monsanto and James River Corporation (Clatskanie Oregon) Served as a soil scientist on a 50,000-a cre hybrid poplar farm. Worked on ge netically engineering study of Poplar trees to see if glyphosate resistant poplar clones were economically viable.
Client: World Wildlife Fund (St. Kitts, West Indies)
Managed 2-year biodiversity study, quan tifying and qualifying the various flora and fauna in St. Kitts' expanding volcanic rainforest. Collaborated with skilled botanists, ornithologists and herpetologists.
Publications
Rosenfeld, P.E. & Feng, L. (2011). The Risks of Hazardous Waste, Amsterdam: Elsevier Publishing.
Cheremisinoff, N.P., & Rosenfeld, P.E. (2011). Handbook of Pollution Prevention and Cleaner Production: Best Practices in the Agrochemical Industry, Amsterdam: Elsevier Publishing.
Gonzalez, J., Feng, L., Sutherland, A., Waller, C., Sok, H., Hesse, R., Rosenfeld, P. (2011). PCBs and Dioxins/Furans in Attic Dust Collected Near Former PCB Production and Secondary Copper Facilities in Sauget, IL.
Procedia Environmental Sciences 4(2011):113-125.
Feng, L., Wu, C., Tam, L., Sutherland, A.J., Clark, J.J., Rosenfeld, P.E., (2010). Dioxin and Furan Blood Lipid and Attic Dust Concentrations in Populations Living Near Four Wood Treatmen t Facilities in the United States. Journal of Environmental Health 73(6):34-46.
Cheremisinoff, N.P., & Rosenfeld, P.E. (2010). Handbook of Pollution Prevention and Cleaner Production: Best Practices in the Wood and Paper Industries, Amsterdam: Elsevier Publishing.
Cheremisinoff, N.P., & Rosenfeld, P.E. (2009). Handbook of Pollution Prevention and Cleaner Production: Best Practices in the Petroleum Industry, Amsterdam: Elsevier Publishing.
Wu, C., Tam, L., Clark, J., Rosenfeld, P. (2009). ‘Dioxin and furan blood lipid concentrations in populations living near four wood treatment facilities in the United S tates’, in Brebbia, C.A. and Popov, V., eds., Air Pollution XVII:
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters
SWAPE 11 Rosenfeld CV
Proceedings of the Seventeenth International Conference on Modelling, Monitoring and Management of Air Pollution, Tallinn, Estonia. 20-22 July, 2009, Southampton, Boston. WIT Press.
Tam L. K.., Wu C. D., Clark J. J. and Rosenfeld, P.E. (2008) A Statistical Analysis Of Attic Dust And Blood Lipid Concentrations Of Tetrachloro-p-Dibenzodioxin (TCDD) Toxicity Equivalency Quotients (TEQ) In Two Populations Near Wood Treatment Facilities. Organohalogen Compounds, Volume 70 (2008) page 002254.
Tam L. K.., Wu C. D., Clark J. J. and Rosenfeld, P.E. (2008) Methods For Collect Samples For Assessing Dioxins And Other Environmental Contaminants In Attic Dust: A Review. Organohalogen Compounds, Volume 70 (2008) page 000527.
Hensley, A.R. A. Scott, J. J. J. Clark, P. E. Rosenfeld (2007) “Attic Dust and Human Blood Samples Collected near a Former Wood Treatment Facility” Environmental Research. 105, pp 194-197.
Rosenfeld, P.E., J . J . J . C l a r k , A . R . H e n s l e y , M . S u f f e t . ( 2 0 0 7 ) “ T h e U s e o f a n O d o r W h e e l C l a s s i f i c a t i o n f o r Evaluation of Human Health Risk Criteria for Compost Facilities” –Water Science & Technology 55(5): 345-357.
Rosenfeld, P. E., M. Suffet. (2007) “The Anatomy Of Odour Wheels For Odours Of Drinking Water, Wastewater, Compost And The Urban Environment ” Water Science & Technology 55(5): 335-344.
Sullivan, P. J. Clark, J.J.J., Agardy, F. J., Rosenfeld, P.E., (2007) “Toxic Legacy, Synthetic Toxins in the Food, Water, and Air in American Cities,” Elsevier Publishing, Boston Massachusetts.
Rosenfeld P.E., and Suffet, I.H. (Mel) (2007) “Anatomy Of An Odor Wheel” Water Science and Technology, In Press.
Rosenfeld, P.E., Clark, J.J.J., Hensley A.R., Suffet, I.H. (Mel) (2007) “The use of an odor wheel classification for evaluation of human health risk criteria for compost facilities.” Water Science And Technology, In Press.
Hensley A.R., Scott, A., Rosenfeld P.E., Clark, J.J.J. (2006) “Dioxin C ontaining Attic Dust And Human Blood Samples Collected Near A Former Wood Treatment Facil ity.” The 26th International Symposium on Halogenated Persistent Organic Pollutants – DIOXIN2006, August 21 – 25, 2006. Radisson SAS Scandinavia Hotel in Oslo Norway.
Rosenfeld, P.E., and Suffet I.H. (2004) "Control of Compost Odor Using High Carbon Wood Ash", Water Science and Technology, Vol. 49, No. 9. pp. 171-178.
Rosenfeld, P.E., Clark J. J. and Suffet, I.H. (2004) "Value of and Urban Odor Wheel.” (2004). WEFTEC 2004.
New Orleans, October 2 - 6, 2004.
Rosenfeld, P.E., and Suffet, I.H. (2004) "Understanding Odorants Associated With Compost, Biomass Facilities, and the Land Application of Biosolids" Water Science and Technology. Vol. 49, No. 9. pp 193-199.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters
SWAPE 12 Rosenfeld CV
Rosenfeld, P.E., and Suffet I.H. (2004) "Control of Compost Odor Using High Carbon Wood Ash", Water Science and Technology, Vol. 49, No. 9. pp. 171-178.
Rosenfeld, P. E ., Grey, M. A., Sellew, P. (2004) Measuremen t of Biosolids Odor and Odorant Emissions from Windrows, Static Pile and Biofilter. Water Environment Research. 76 (4): 310-315 JUL-AUG 2004.
Rosenfeld, P. E., Grey, M., (2003) Two stage biof ilter for biosolids composting odo r control. Seventh International In Situ And On Site Bioremediation Symposium. Batelle Conference Orlando Florida. June 2 and June 6, 2003.
Rosenfeld, P.E., Grey, M and Suffet, M. 2002. “Controlling Odors Using High Carbon Wood Ash.” Biocycle, March 2002, Page 42.
Rosenfeld, P.E., Grey, M and Suffet, M. (2002). “Compost Demonstration Project, Sacramento, California Using High-Carbon Wood Ash to Control Od or at a Green Materials Composting Facility Integrated Waste Management Board Public Affairs Office, Publications Clearinghouse (MS–6), Sacramento , CA Publication #44 2-02-008. April 2002.
Rosenfeld, P.E., and C.L. Henry. 2001. Characterization of odor emissions from three different biosolids. Water Soil and Air pollution. Vol. 127 Nos. 1-4, pp. 173-191
Rosenfeld, P.E., and Henry C. L., 2000. Wood ash control of odor emissions from biosolids application. Journal of Environmental Quality. 29:1662-1668.
Rosenfeld, P.E., C.L. Henry and D. Bennett. 2001. Wastewater dewatering polymer affect on biosolids odor emissions and microbial activity. Water Environment Research. 73: 363-367.
Rosenfeld, P.E., and C.L. Henry. 2001. Activated Carbon and Wood Ash Sorption of Wastewater, Compost, and Biosolids Odorants Water Environment Research, 73: 388-392.
Rosenfeld, P.E., and Henry C. L., 2001. High carbon wood ash effect on biosolids mic robial activity and odor.
Water Environment Research. Volume 131 No. 1-4, pp. 247-262
Rosenfeld, P.E, C.L. Henry, R. Harrison. 1998. Oat and Gras s Seed Germination and Nitrogen and Sulfur Emissions Following Biosolids Incorporation With High -Carbon Wood-Ash. Water E nvironment Federation 12th Annual Residuals and Biosolids Management Conference Proceedings. Bellevue Washington.
Chollack, T. and P. Rosenfeld. 1998. Compost Amendment Handbook For Landscaping. Prepared for and distributed by the City of Redmond, Washington State.
P. Rosenfeld. 1992. The Mount Liamuiga Crater Trail. Heritage Magazine of St. Kitts, Vol. 3 No. 2.
P. Rosenfeld. 1993. High School Biogas P roject to Prevent Defores tation On St. Kitts. Biomass Users Network, Vol. 7, No. 1, 1993.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters
SWAPE 13 Rosenfeld CV
P. Rosenfeld. 1992. British West Indies, St. Kitts. Surf Report, April issue.
P. Rosenfeld. 1998. Characterization, Quantification, and Control of Odor Emissions From Biosolids Application To Forest Soil. Doctoral Thesis. University of Washington College of Forest Resources.
P. Rosenfeld. 1994. Potential U tilization of Small Diameter Trees On Sierra County Public Land. Masters thesis reprinted by the Sierra County Economic Council. Sierra County, California.
P. Rosenfeld. 1991. How to Build a Small Ru ral Anaerobic Digester & Uses Of Biogas In The First And Third World. Bachelors Thesis. University of California.
England Environmental Agency, 2002. Landfill Gas Control Technologies. P ublishing Organization Environment Agency, Rio House, Waterside Drive, Aztec West, Almondsbury BRISTOL, BS32 4UD
Presentations
Sok, H.L.; Waller, C.C.; Feng, L.; Gonzalez, J.; Sutherland, A.J.; Wisdom-Stack, T.; Sahai, R.K.; Hesse, R.C.; Rosenfeld, P.E. "Atrazine: A Persistent Pesticide in Urban Drinking Water." Urban Environmental Pollution, Boston, MA, June 20-23, 2010.
Feng, L.; Gonzalez, J.; Sok, H.L.; Sutherland, A.J.; Wa ller, C.C.; Wisdom-Stack, T.; Sahai, R.K.; La, M.; Hesse, R.C.; Rosenfeld, P.E. "Bringing Environmental Justice to East St. L ouis, Illinois." Urban Environmental Pollution, Boston, MA, June 20-23, 2010.
Rosenfeld, P.E . (2009) “Perfluoroctanoic Acid (PFOA) and Perfluoroactane Sulfonate (PFOS) Contamination in Drinking Water From the Use of Aqueous Film Formi ng Foams (AFFF) at Airport s in the United States” Presentation at the 2009 Ground Water Summit and 2009 Ground Water Pr otection Council Spring Meeting, April 19-23, 2009. Tuscon, AZ.
Rosenfeld, P.E. (2009) “Cost to Filter Atrazine Contamination from Drinking Water in the United States” Contamination in Drinking Water From the Use of Aqueous Film Forming Foam s (AFFF) at Airports in the United States” Presentation at the 2009 Ground Water Summit and 2009 Ground Water Protection Council Spring Meeting, April 19-23, 2009. Tuscon, AZ.
Rosenfeld, P. E. (2007) “Moss Point Community Exposure To Contaminants From A Releasing Facility” Platform Presentation at the 23 rd Annual International Conferenc es on Soils Sediment and Water, October 15-18, 2007.
University of Massachusetts, Amherst MA.
Rosenfeld, P. E. (2007) “The Repeated Trespass of Tritium-Contam inated Water Into A Surrounding Community Form Repeated Waste Spills From A Nuclear Power Plant” Platform Presentation at the 23 rd Annual International Conferences on Soils Sediment and Water, October 15-18, 2007. University of Massachusetts, Amherst MA.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters
SWAPE 14 Rosenfeld CV
Rosenfeld, P. E. (2007) “Somerville Community Ex posure To Contaminants F rom Wood Treatment Facility Emissions” Poster Presentation at the 23 rd Annual International Confe rences on Soils Sediment and Water, October 15-18, 2007. University of Massachusetts, Amherst MA.
Rosenfeld P. E. “Production, Chemical Properties, Toxicolo gy, & Treatment Case Studies of 1,2,3- Trichloropropane (TCP)” – Platform Presentation at the Asso ciation for Environmental Health and Sciences (AEHS) Annual Meeting, San Diego, CA, 3/2007
Rosenfeld P. E. “Blood and Attic Sampling for Dioxin/Furan, PAH, and Metal Exposure in Florala, Alabama” – Platform Presentation at the AEHS Annual Meeting, San Diego, CA, 3/2007
Hensley A.R., Scott, A., Rosenfeld P.E., Clark, J.J.J. (2006) “Dioxin Cont aining Attic Dust And Human Blood Samples Collected Near A Former W ood Treatment Facility.” APHA 134 Annual Meeting & Exposition, Boston Massachusetts. November 4 to 8th, 2006.
Paul Rosenfeld Ph.D . “Fate, Transport and Persistence of PFOA and Related Chemicals.” Mealey’s C8/PFOA Science, Risk & Litigation Conference” October 24, 25. The Rittenhouse Hotel, Philadelphia.
Paul Rosenfeld Ph.D . “Brominated Flame Retardants in Groundwater: Pathways to Human Ingestion, Toxicology and Remediation PEMA Emerging Contaminant Conference. September 19. Hilton Hotel, Irvine California.
Paul Rosenfeld Ph.D . “Fate, Transport, Toxicity, And Persistence of 1,2,3-TCP.” PEMA Emerging Contaminant Conference. September 19. Hilton Hotel in Irvine, California.
Paul Rosenfeld Ph.D. “Fate, Transport and Persistence of PDBEs.” Mealey’s Groundwater Conference. September 26, 27. Ritz Carlton Hotel, Marina Del Ray, California.
Paul Rosenfeld Ph.D. “Fate, Transport and Persistence of PFOA an d Related Chemicals.” International Society of Environmental Forensics: Focus On Emerging Contaminants. June 7,8. Sheraton Oceanfront Hotel, Virginia Beach, Virginia.
Paul Rosenfeld Ph.D . “Rate Transport, Persistence and Toxicology of PFOA and Related Perfluorochemicals”. 2005 National Groundwater Associatio n Ground Water And Environmental Law Conference. July 21-22, 2005.
Wyndham Baltimore Inner Harbor, Baltimore Maryland.
Paul Rosenfeld Ph.D . “Brominated Flame Retardants in Groundwater: Pathways to Human Ingestion, Toxicology and Remediation.” 2005 National Groundwater Association Ground Water And Environmental Law Conference.
July 21-22, 2005. Wyndham Baltimore Inner Harbor, Baltimore Maryland.
Paul Rosenfeld, Ph.D. and James Clark Ph.D. and Rob Hesse R.G. Tert-butyl Alcohol Liability and Toxicology, A National Problem and Unquantified Liability. National Groundwater Association. Environmental Law Conference.
May 5-6, 2004. Congress Plaza Hotel, Chicago Illinois.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters
SWAPE 15 Rosenfeld CV
Paul Rosenfeld, Ph.D., 2004. Perchlorate Toxicology. Presen tation to a meeting of the American Groundwater Trust. March 7th, 2004. Pheonix Arizona.
Hagemann, M.F., Paul Rosenfeld, Ph.D. and Rob Hesse, 2004. Perchlorate Contamination of the Colorado River.
Invited presentation to a meeting of tribal representatives, Parker, AZ.
Paul Rosenfeld, Ph.D. A National Damage Assessment Model For PCE and Dry Cleaners. Drycleaner Symposium.
California Ground Water Association. Radison Hotel, Sacramento, California. April 7, 2004.
Paul Rosenfeld, Ph.D. and James Clark Ph.D. Understanding Histor ical Use, Chemical Properties, Toxicity and Regulatory Guidance of 1,4 Dioxan e. National Groundwater Association. Southwest Focus Conference. Water Supply and Emerging Contaminants. February 20-21, 2003. Hyatt Regency Phoenix Arizona.
Paul Rosenfeld, Ph.D. Underground Storage Tank Litiga tion and Remediation. Califor nia CUPA Forum. Marriott Hotel. Anaheim California. February 6-7, 2003.
Paul Rosenfeld, Ph.D . Underground Storage Tank Litigation and Re mediation. EPA Unde rground Storage Tank Roundtable. Sacramento California. October 23, 2002
Rosenfeld, P.E . and Suffet, M. 2002. Understa nding Odor from Compost, Wastewater and Industrial Processes.
Sixth Annual Symposium On Off Flav ors in the Aquatic Environment. Inter national Water Association. Barcelona Spain. October 7- 10.
Rosenfeld, P.E . and Suffet, M. 2002. Using High Carbon Wood Ash to Control Compost Odor. Sixth Annual Symposium On Off Flavors in the Aquatic Environment. International Water Association. Barcelona Spain. October 7- 10.
Rosenfeld, P.E. and Grey, M. A. 2002. Biocycle Composting Fo r Coastal Sage Restoration. Northwest Biosolids Management Association. Vancouver Washington. September 22-24.
Rosenfeld, P.E . and Grey, M. A. 2002. Soil Science Society Annual Conference. Indianapolis, Maryland.
November 11-14.
Rosenfeld. P.E. 2000. Two stage biofilter for biosolids compostin g odor control. Water Environment Federation.
Anaheim California. September 16, 2000.
Rosenfeld. P. E. 2000 . Wood ash and biofilter control of compost odor. Biofest. October 16, 2000.Ocean Shores, California
Rosenfeld, P. E. 2000 . Bioremediation Using Organic Soil Amendments. California Resource Recovery Association. Sacramento California.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters
SWAPE 16 Rosenfeld CV
Rosenfeld, P.E ., C.L. Henry, R. Harrison. 1998. Oat and Gras s Seed Germination and Nitrogen and Sulfur Emissions Following Biosolids Incorporation With High -Carbon Wood-Ash. Water E nvironment Federation 12th Annual Residuals and Biosolids Management Conference Proceedings. Bellevue Washington.
Rosenfeld, P.E., and C.L. Henry. 1999. An evaluation of ash in corporation with biosolids for odor reduction. Soil Science Society of America. Salt Lake City Utah.
Rosenfeld, P.E. , C.L. Henry, R. Harrison. 1998. Comparison of Microbial Activity and Odor Emissions from Three Different Biosolids Applied to Forest Soil. Brown and Caldwell, Seattle Washington.
Rosenfeld, P.E. , C.L. Henry. 1998. Characterization, Quan tification, and Control of Odor Emissions from Biosolids Application To Forest Soil. Biofest Lake Chelan, Washington.
Rosenfeld, P.E. , C.L. Henry, R. B. Harrison, and R. Dills. 1997. Comparison of Odor Emissions From Three Different Biosolids Applied to Forest Soil. Soil Science Society of America, Anaheim California.
Professional History
Soil Water Air Protection Enterprise (SWAPE); 2003 to present; Founding And Managing Partner UCLA School of Public Health; 2007 to present; Lecturer (Asst Res) UCLA School of Public Health; 2003 to 2006; Adjunct Professor UCLA Environmental Science and Engineering Program; 2002-2004; Doctoral Intern Coordinator UCLA Institute of the Environment, 2001-2002; Research Associate Komex H2O Science, 2001 to 2003; Senior Remediation Scientist National Groundwater Association, 2002-2004; Lecturer
San Diego State University, 1999-2001; Adjunct Professor Anteon Corp., San Diego, 2000-2001; Remediation Project Manager Ogden (now Amec), San Diego, 2000-2000; Remediation Project Manager Bechtel, San Diego, California, 1999 – 2000; Risk Assessor King County, Seattle, 1996 – 1999; Scientist
James River Corp., Washington, 1995-96; Scientist
Big Creek Lumber, Davenport, California, 1995; Scientist Plumas Corp., California and USFS, Tahoe 1993-1995; Scientist Peace Corps and World Wildlife Fund, St. Kitts, West Indies, 1991-1993; Scientist Bureau of Land Management, Kremmling Colorado 1990; Scientist
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters
SWAPE 17 Rosenfeld CV
Teaching Experience
UCLA Department of Environmental Health (Summer 2003 through 2010) Teach Environmental Health Science 100 to students, including un dergrad, medical doctors, public hea lth professionals and nurses. Course focuses on the health effects of environmental contaminants.
National Ground Water Association, Successful Remediation Technologies . Custom Course In Sante Fe, New Mexico. May 21, 2002. Focused on fate and transport of fuel contaminants associated with underground storage tanks.
National Ground Water Association; Successful Remediation Technologies Course in Chicago Illinois. April 1, 2002. Focused on fate and transport of contaminants associated with Superfund and RCRA sites.
California Integrated Waste Management Board, April and May, 2001. Alternative Landfill Caps Seminar in San Diego, Ventura, and San Francisco. Focused on both prescriptive and innovative landfill cover design.
UCLA Department of Environmental Engineering, February 5 2002 Seminar on Successful Remediation Technologies focusing on Groundwater Remediation.
University Of Washington, Soil Science Program, Teaching Assistant for several courses including: Soil Chemistry, Organic Soil Amendments, and Soil Stability.
U.C. Berkeley, Environmental Science Program Teaching Assistant for Environmental Science 10.
Academic Grants Awarded
California Integrated Waste Management Board . $41,000 grant awarded to UCLA Institute of the Environment.
Goal: To investigate effect of high carbon wood ash on volatile organic emissions from compost. 2001.
Synagro Technologies, Corona California : $10,000 grant awarded to San Diego State University. Goal:
investigate effect of biosolids for restoration and remediation of degraded coastal sage soils. 2000.
King County, Department of Research and Technology, Washington State . $100,000 grant awarded to University of Washington: Goal: To investigate odor emissions from bios olids application and the effect of polymers and ash on VOC emissions. 1998.
Northwest Biosolids Management Association, Washington State. $20,000 grant awarded to investigate effect of polymers and ash on VOC emissions from biosolids. 1997.
James River Corporation, Oregon : $10,000 grant was awarded to investigate the success of genetically engineered Poplar trees with resistance to round-up. 1996.
United State Forest Service, Tahoe National Forest : $15,000 grant was awarded to investigating fire ecology of the Tahoe National Forest. 1995.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters
SWAPE 18 Rosenfeld CV
Kellogg Foundation, Washington D.C. $500 grant was awarded to construct a large anaerobic digester on St. Kitts in West Indies. 1993.
ȱ
Cases that Dr. Rosenfeld Provided Deposition or Trial Testimony
In the Court of Common Pleas for the Second Judicial Circuit, State of South Carolina, County of Aiken David Anderson, et al., Plaintiffs, vs. Norfolk Southern Corporation, et al., Defendants.
Case Number: 2007-CP-02-1584
In the Circuit Court of Jefferson County Alabama
Jaeanette Moss Anthony, et al., Plaintiffs, vs. Drummond Company Inc., et al., Defendants Civil action No. CV 2008-2076
In the Ninth Judicial District Court, Parish of Rapides, State of Louisiana Roger Price, et al., Plaintiffs, vs. Roy O. Martin, L.P., et al., Defendants.
Civil Suit Number 224,041 Division G
In the United States District Court, Western District Lafayette Division Ackle et al., Plaintiffs, vs. Citgo Petroleum Corporation, et al., Defendants.
Case Number 2:07CV1052
In the United States District Court for the Southern District of Ohio Carolyn Baker, et al., Plaintiffs, vs. Chevron Oil Company, et al., Defendants.
Case Number 1:05 CV 227
In the Fourth Judicial District Court, Parish of Calcasieu, State of Louisiana Craig Steven Arabie, et al., Plaintiffs, vs. Citgo Petroleum Corporation, et al., Defendants.
Case Number 07-2738 G
In the Fourteenth Judicial District Court, Parish of Calcasieu, State of Louisiana Leon B. Brydels, Plaintiffs, vs. Conoco, Inc., et al., Defendants.
Case Number 2004-6941 Division A
In the District Court of Tarrant County, Texas, 153
rd Judicial District
Linda Faust, Plaintiff, vs. Burlington Northern Santa Fe Rail Way Company, Witco Chemical Corporation A/K/A Witco Corporation, Solvents and Chemicals, Inc. and Koppers Industries, Inc., Defendants.
Case Number 153-212928-05
In the Superior Court of the State of California in and for the County of San Bernardino Leroy Allen, et al., Plaintiffs, vs. Nutro Products, Inc., a California Corporation and DOES 1 to 100, inclusive, Defendants.
John Loney, Plaintiff, vs. James H. Didion, Sr.; Nutro Products, Inc.; DOES 1 through 20, inclusive, Defendants.
Case Number VCVVS044671
In the United States District Court for the Middle District of Alabama, Northern Division James K. Benefield, et al., Plaintiffs, vs. International Paper Company, Defendant.
Civil Action Number 2:09-cv-232-WHA-TFM
In the Superior Court of the State of California in and for the County of Los Angeles Leslie Hensley and Rick Hensley, Plaintiffs, vs. Peter T. Hoss, as trustee on behalf of the Cone Fee Trust; Plains Exploration & Production Company, a Delawa re corporation; Rayne Water Conditioning, Inc., a P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters
SWAPE 19 Rosenfeld CV
California corporation; and DOES 1 through 100, Defendants.
Case Number SC094173
In the Superior Court of the State of California in and for the County of Santa Barbara, Santa Maria Branch Clifford and Shirley Adelhelm, et al., all individually, Plaintiffs, vs. Unocal Corporation, a Delaware Corporation; Union Oil Company of California, a California corporation; Chevron Corporation, a California corporation; ConocoPhillips, a Texas corporation; Kerr-McGee Corporation, an Oklahoma corporation; and DOES 1 though 100, Defendants.
Case Number 1229251 (C onsolidated with case number 1231299)
In the United States District Court for Eastern District of Arkansas, Eastern District of Arkansas Harry Stephens Farms, Inc, and Harry Stephens, individual and as managing partner of Stephens Partnership, Plaintiffs, vs. Helena Chemical Company, and Exxon Mobil Corp., successor to Mobil Chemical Co., Defendants.
Case Number 2:06-CV-00166 JMM (Consolidated with case number 4:07CV00278 JMM)
In the United States District Court for the Western District of Arkansas, Texarkana Division Rhonda Brasel, et al., Plaintiffs, vs. Weyerhaeuser Company and DOES 1 through 100, Defendants.
Civil Action Number 07-4037
In The Superior Court of the State of California County of Santa Cruz Constance Acevedo, et al. Plaintiffs Vs. California Spray Company, et al. Defendants Case No CV 146344
In the District Court of Texas 21
st Judicial District of Burleson County
Dennis Davis, Plaintiff, vs. Burlington Northern Santa Fe Rail Way Company, Defendant.
Case Number 25,151
ȱ
ȱ
ȱ
ȱ
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters July 22, 2021
City of Riverside
Planning Department
3900 Main Street
Riverside, CA 92522
Attention: Veronica Hernandez Re: Sycamore Hills Distribution Center Project APN 263-060-002, 263-060-024,
263-060-026, NOA of a DEIR
The Riverside County Flood Control and Water Cons ervation District (District) does not normally recommend conditions for land divisions or other land use cases in incorporated cities. The District also does not plan check City land use cases or provide S tate Division of Real Estate letters or other flood hazard reports for such cases. District comments/recommendations for such cases are normally limited to items of specific interest to the District includi ng District Master Drainage Plan facilities, other regional flood control and drainage facilities which could be considered a logical component or extension of a master plan system, and District Area Drainage Plan fees (development mitigation fees). In addition, information of a general nature is provided.
The District's review is based on the above-referen ced project transmittal, received June 7, 2021. The District has not reviewed the proposed project in detail, and the following comments do not in any way constitute or imply District approval or endorsement of the proposed project with respect to flood hazard, public health and safety, or any other such issue:
܈This project would not be impacted by District Master Drainage Plan facilities, nor are other facilities of regional interest proposed.
☐ This project involves District proposed Master Drainage Plan facilities, namely ________, _________________. The District will accept ownership of such facilities on written request of the City. Facilities must be constructed to District standards, and District plan check and inspection will be required for District acceptan ce. Plan check, inspection, and administrative fees will be required.
☐ This project proposes channels, storm drains 36 inch es or larger in diameter, or other facilities that could be considered regional in nature and/or a logical extension of the adopted Master Drainage Plan. The District would consider accepting ownership of such facilities on written request of the City. Facilities must be constructed to District standards, and District plan check and inspection will be required for District acceptance. Plan check, inspection, and administrative fees will be required.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters ☐ This project is located within the limits of th e District's _______ Area Drainage Plan for which drainage fees have been adopted. If the projec t is proposing to create additional impervious surface area, applicable fees should be paid by cashier's check or money order only to the Flood Control District or City prior to issuance of grading or building permits. Fees to be paid should be at the rate in effect at the time of issuance of the actual permit. ☐ An encroachment permit shall be obtained for any construction related activities occurring within District right of way or facilities, namely, ____________________. For further information, contact the District's Encroachment Permit Section at 951.955.1266. ܈The District's previous comments are still valid (see attached letter dated August 20, 2020).
GENERAL INFORMATION
This project may require a National Pollutant Discharge Elimination System (NPDES) permit from the State Water Resources Control Board. Clearance for grading, recordation, or other final approval should not be given until the City has determined that the project has been granted a permit or is shown to be exempt.
If this project involves a Federal Emergency Management Agency (FEMA) mapped floodplain, then the City should require the applicant to provide all studies, calculations, plans, and other information required to meet FEMA requirements, and should further require that the applicant obtain a Conditional Letter of Map Revision (CLOMR) pri or to grading, recordation, or othe r final approval of the project and a Letter of Map Revision (LOMR) prior to occupancy.
If a natural watercourse or mapped floodplain is impac ted by this project, the City should require the applicant to obtain a Section 1602 Agreement from the California Department of Fish and Wildlife and a Clean Water Act Section 404 Permit from the U.S. Army Corps of Engineers, or written correspondence from these agencies indicating the project is exempt from these requirements. A Clean Water Act Section 401 Water Quality Certification may be required from the local California Regional Water Quality Control Board prior to issuance of the Corps 404 permit.
Very truly yours,
DEBORAH DE CHAMBEAU
Engineering Project Manager
Attachment
ec: Riverside County Planning Department
Attn: Phayvanh Nanthavongdouangsy
SLJ:blm
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters -XO\QG
7R
9HURQLFD+HUQDQGH]6HQLRU3ODQQHU&LW\RI5LYHUVLGH )URP
/HRQDUG1XQQH\IRU)ULHQGVRI5LYHUVLGH¶V+LOOV
)5+
5H
5HVSRQVHWR6\FDPRUH+LOOV'LVWULEXWLRQ&HQWHU'UDIW(,56WDWH&OHDULQJKRXVH1R
7KHSURSRVHGSURMHFWVLWHLVLQDYHU\HQYLURQPHQWDOO\VHQVLWLYHDUHDDWWKHVRXWKHUQHGJHRI 6\FDPRUH&DQ\RQ:LOGHUQHVV3DUN
6&:3
DSDUNRIDSSUR[LPDWHO\DFUHV7KLVQDWXUDO
RSHQVSDFHDUHDLVDFULWLFDOFRPSRQHQWLQWKHFRQVHUYDWLRQRIELRGLYHUVLW\LQ:HVWHUQ5LYHUVLGH &RXQW\DQGDVVXFKLVDFRUHDUHDZLWKLQWKH:HVWHUQ5LYHUVLGH&RXQW\0XOWLSOH6SHFLHV +DELWDW&RQVHUYDWLRQ3ODQ
WKH06+&3
%HLQJZLWKLQWKH&LW\RI5LYHUVLGHLWLVDOVRLPSRUWDQW WRWKHHQMR\PHQWRIQDWXUDORSHQVSDFHE\UHVLGHQWVRIWKHDUHDDQGYLVLWRUV7KHFRQFHUQV GRFXPHQWHGLQWKLVOHWWHUIRFXVRQWKHVHWZRLVVXHV
WKHVHQVLWLYLW\RIWKHDUHDUHTXLUHVYHU\
FDUHIXOO\FRQVWUXFWHGPLWLJDWLRQPHDVXUHV
)ULHQGVRI5LYHUVLGH¶V+LOOV
)5+
LVD
F
QRQSURILWJURXSGHGLFDWHGWRWKHSUHVHUYDWLRQ
DQGHQKDQFHPHQWRIWKHTXDOLW\RIOLIHRIWKHUHVLGHQWVRI5LYHUVLGHE\PDLQWDLQLQJWKHQDWXUDO EHDXW\RIWKH&LW\DQGE\SURPRWLQJWKHHVWDEOLVKPHQWRIDQHWZRUNRIOLQNHGQDWXUDORSHQ VSDFHDUHDVLQWKH&LW\RI5LYHUVLGHDQGLQWKHVXUURXQGLQJDUHD ,QSUHVHQWLQJWKHFRQFHUQVRI)5+,QHHGWRSRLQWRXWWKDW,DPDSURIHVVRUDWWKH8QLYHUVLW\RI &DOLIRUQLD5LYHUVLGHDQGRQHDVSHFWRIP\UHVHDUFKFRQFHUQVWKHDELOLW\RIVPDOOSRSXODWLRQVWR DYRLGH[WLQFWLRQ)RUH[DPSOHWZRRIP\HDUO\
V
SHHUUHYLHZHGVFLHQWLILFSDSHUV
$VVHVVLQJPLQLPXPYLDEOHSRSXODWLRQVL]H
GHPRJUDSK\PHHWVSRSXODWLRQJHQHWLFVDQG
(VWLPDWLQJWKHHIIHFWLYHSRSXODWLRQVL]HRIFRQVHUYHGSRSXODWLRQV KDYHEHHQFLWHGDQG
WLPHVUHVSHFWLYHO\DFFRUGLQJWR*RRJOH6FKRODU
DVRIWRGD\
$VDUHVXOWRIP\H[SHUWLVH,
EHFDPHDPHPEHURIWKH6FLHQWLILF$GYLVRU\3DQHOWKDWZDVLQYROYHGLQWKHHVWDEOLVKPHQWRIWKH 06+&3
$HVWKHWLFV
7KUHVKROG$
:RXOGWKH3URMHFWKDYHDVXEVWDQWLDODGYHUVHHIIHFWRQDVFHQLFYLVWD" 7KH'(,5VWDWHVWKHUHZRXOGEHDOHVVWKDQVLJQLILFDQWLPSDFWZLWKRXWPLWLJDWLRQ+RZHYHUWKH '(,5IDLOHGWRFRQVLGHUWKHVLJQLILFDQWLPSDFWRQWKHPDQ\LQGLYLGXDOVXVLQJWKHDGMRLQLQJQDWXUDO VSDFHZLOGHUQHVVDUHD6&:37KHSURMHFWGRHVLQFRUSRUDWHDIHDWXUHWRPLWLJDWHWKLVHIIHFW D
´FDEOHIHQFHZLWKDQLQQHUILUHUHVLVWDQWERXQGDU\RIORFDOO\QDWLYHWUHHV )LJXUH$
%HFDXVHWKLVPLWLJDWLRQLVUHTXLUHGLQSHUSHWXLW\LWLVLPSRUWDQWWKDWDPLWLJDWLRQPHDVXUHEH DGGHGWKDWUHTXLUHVWKHFDEOHIHQFLQJDQGYHJHWDWLRQEHPDLQWDLQHGLQWRWKHIXWXUH,QSDUWLFXODU LWQHHGVWREHUHTXLUHGWKDWDQ\WUHHVRUSODQWVWKDWGLHPXVWEHUHSODFHGZLWKDVLPLODUORFDOO\ QDWLYHWUHHVRUSODQWV
$LU4XDOLW\
7KUHVKROG$
:RXOGWKH3URMHFWFRQIOLFWZLWKRUREVWUXFWLPSOHPHQWDWLRQRIWKHDSSOLFDEOH DLUTXDOLW\SODQ"
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters 7KUHVKROG%
:RXOGWKH3URMHFWUHVXOWLQDFXPXODWLYHO\FRQVLGHUDEOHQHWLQFUHDVHRIDQ\ FULWHULDSROOXWDQWIRUZKLFKWKHSURMHFWUHJLRQLVQRQDWWDLQPHQWXQGHUDQDSSOLFDEOH IHGHUDORUVWDWHDPELHQWDLUTXDOLW\VWDQGDUG"
%RWKDUHFRQVLGHUHGLQWKH'(,5DV6LJQLILFDQWZLWKRXW0LWLJDWLRQ+RZHYHUWKHPLWLJDWLRQ FRQGLWLRQ00$,5
SURKLELWPDQXIDFWXULQJXVH
GRHVQRWDGGUHVVWKHSULPDU\VRXUFHRIDLU
SROOXWLRQUHVXOWLQJIURPWKHSURMHFWZKLFKLVWKHGLHVHOSDUWLFXODWHSROOXWLRQIURPWUXFNVDUULYLQJ DWLGOLQJDQGOHDYLQJIURPWKHZDUHKRXVHIDFLOLW\RUIURPWKHPRWRUL]HGHTXLSPHQWLQYROYHGLQ VXFKDFWLYLWLHVDVORDGLQJWKHWUXFNV,WLVVWDWHGWKDWLGOLQJZLOOEHOLPLWHGWRPLQXWHV '(,5VHF
KRZHYHUXQOHVVWKLVLVDPLWLJDWLRQPHDVXUHLWLVQRWHQIRUFHDEOHDQGFDQEHLJQRUHGLQ WKHIXWXUH6XFKDPLWLJDWLRQPHDVXUHQHHGVWREHDGGHGVLQFHZLWKRXWLWWKHUHPD\EHD VLJQLILFDQWLPSDFWRQDLUTXDOLW\
%LRORJLFDO5HVRXUFHV
7KUHVKROG$
:RXOGWKH3URMHFWKDYHDVXEVWDQWLDODGYHUVHHIIHFWHLWKHUGLUHFWO\RU WKURXJKKDELWDWPRGLILFDWLRQVRQDQ\VSHFLHVLGHQWLILHGDVDFDQGLGDWHVHQVLWLYHRU VSHFLDOVWDWXVVSHFLHVLQORFDORUUHJLRQDOSODQVSROLFLHVRUUHJXODWLRQVRUE\WKH &DOLIRUQLD'HSDUWPHQWRI)LVKDQG*DPHRU86:LOGOLIH6HUYLFH" 6LJQLILFDQWZLWKRXWPLWLJDWLRQ
KRZHYHUWKHPLWLJDWLRQLVLQDGHTXDWHWRDFKLHYHWKHVWDWHGJRDORI OHVVWKDQVLJQLILFDQW
00%,2FRQFHUQVWKHSDQLFXODWHWDUSODQWDQG5RELQVRQ¶VSHSSHUJUDVVDQGUHOLHVRQ UHVWRUDWLRQEDVHGRQRQVLWHVHHGFROOHFWLRQRUWKHUHWHQWLRQRIWRSVRLO:HKRSHWKDWVHHG FROOHFWLRQKDVDOUHDG\RFFXUUHGLQDJRRGUDLQIDOO\HDU,WLVXQOLNHO\WKDWPDQ\SODQWVZRXOG KDYHJURZQRUVHWYLDEOHVHHGLQWKLVFXUUHQWVHYHUHGURXJKW,IVHHGVKDYHQRW\HWEHHQ FROOHFWHGWKH\ZRXOGQHHGWREHFROOHFWHGGXULQJWKHDSSURSULDWHVHHGLQJVHDVRQIRUWKHVH SODQWVLQWKHQH[WUHDVRQDEO\JRRGUDLQIDOO\HDU7KDWZRXOGEHLQWKHVSULQJIRUWKHSHSSHU JUDVVDQGPLGVXPPHUWRIDOOIRUWKHWDUSODQW8QIRUWXQDWHO\WKHPLWLJDWLRQPHDVXUHE\DOORZLQJ WKHRSWLRQRIRQO\XVLQJVWRUHGWRSVRLOSURYLGHVQRJXDUDQWHHRIVXFFHVVDQGWKHVHHG FROOHFWLRQE\IDLOLQJWRVSHFLI\WKHQXPEHURISDUHQWSODQWVFRQWULEXWLQJWRWKHVHHGFROOHFWLRQ DOVRIDLOVWRSURYLGHPXFKJXDUDQWHHRIVXFFHVV7KXV00%,2GRHVQRWSURYLGHDGHTXDWH PLWLJDWLRQDVGHILQHG$WDPLQLPXPLIVKRXOGUHTXLUHRQVLWHVHHGFROOHFWLRQ RULIQHFHVVDU\
IURPQHDUE\ORFDWLRQVDVGHILQHGEHORZ
DQGWKHXVHRIVWRUHGRQVLWHWRSVRLOZLWKVRPH
TXDQWLILHGPLQLPDSODFHGRQWKHVHWZRFRPSRQHQWV
0012,FRQFHUQVOHDVW%HOO¶VYLUHRZLWKLQIW
LQ6&:3
RUZLWKLQIW
LQVLGHWKHSURMHFW
ERXQGDULHV
RISURMHFWGHYHORSPHQW7KHSULPDU\PLWLJDWLRQVWUDWHJ\LVDIWKLJKQRLVH UHGXFLQJIHQFH8QIRUWXQDWHO\WKLVPLWLJDWLRQPHDVXUHIDLOVWRUHTXLUHWKHLGHQWLILFDWLRQRI QHVWLQJDFWLYLW\ZKLFKVKRXOGUHVXOWLQDFHVVDWLRQRIDFWLYLW\ZLWKLQWKHVWDWHGERXQGDULHVXQWLO QHVWLQJLVFRPSOHWH,QDQ\HYHQWWKHPLWLJDWLRQPHDVXUHIDLOVWRPHQWLRQDPLQLPXPGLVWDQFH FRQVLGHUHGWRRFORVHIRUFRQVWUXFWLRQDFWLYLW\)RUH[DPSOHLIDELUGFDQEHVHHQVLQJLQJZLWKLQ IWRISURMHFWDFWLYLW\DVRXQGZDOOZLOOEHWRWDOO\LQHIIHFWLYHDWSURWHFWLQJWKDWELUGIURPQRLVH 7KHDSSURSULDWHPLWLJDWLRQVWUDWHJ\LVWRSODQWKHFRQVWUXFWLRQRXWVLGHRIWKHWLPHZLQGRZRI QHVWLQJDFWLYLW\
URXJKO\PLG0DUFKWRWKHHQGRI$XJXVW
EXWDWWKHYHU\OHDVWWRUHTXLUH
FRQVWUXFWLRQDFWLYLW\WRRFFXUGXULQJWKDWSHULRGDWOHDVWIWDZD\IURPWKHULSDULDQDUHDV7KLV UHFRPPHQGDWLRQOLQNVLQZLWK
DQGXVHVWKHVDPHJHQHUDOSULQFLSOHVDV
WKHOHVVUHVWULFWLYH00
%,2
WKDWUHODWHVWRDOOELUGVSHFLHV
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters 6HHDOVRFRQFHUQVRYHUQRLVHPLWLJDWLRQOLVWHGEHORZ
7KUHVKROG%
:RXOGWKH3URMHFWKDYHDVXEVWDQWLDODGYHUVHHIIHFWRQDQ\ULSDULDQKDELWDW RURWKHUVHQVLWLYHQDWXUDOFRPPXQLW\LGHQWLILHGLQORFDORUUHJLRQDOSODQVSROLFLHV UHJXODWLRQVRUE\WKH&DOLIRUQLD'HSDUWPHQWRI)LVKDQG*DPHRU86)LVKDQG:LOGOLIH 6HUYLFH"
7KUHVKROG&
:RXOGWKH3URMHFWKDYHDVXEVWDQWLDODGYHUVHHIIHFWRQ)HGHUDOO\SURWHFWHG ZHWODQGVDVGHILQHGE\6HFWLRQRIWKH&OHDQ:DWHU$FW LQFOXGLQJEXWQRWOLPLWHGWR
PDUVKYHUQDOSRROFRDVWDOHWF
WKURXJKGLUHFWUHPRYDOILOOLQJK\GURORJLFDO
LQWHUUXSWLRQRURWKHUPHDQV"
%RWKVLJQLILFDQWZLWKRXWPLWLJDWLRQ
KRZHYHUDOORIWKHPLWLJDWLRQPHDVXUHVUHODWHRQO\WRWKH FRQVWUXFWLRQSKDVHRIWKHSURMHFWDQGQRWWRWKHFRQWLQXLQJSRWHQWLDOLPSDFWVWRWKHULSDULDQ KDELWDWZLWKLQDQGQHDUWRWKHSURMHFWVLWH
7KUHVKROG)
:RXOGWKH3URMHFWFRQIOLFWZLWKWKHSURYLVLRQVRIDQDGRSWHG+DELWDW &RQVHUYDWLRQ3ODQ1DWXUDO&RPPXQLW\&RQVHUYDWLRQ3ODQRURWKHUDSSURYHGORFDO UHJLRQDORUVWDWHKDELWDWFRQVHUYDWLRQSODQ"
7KHUHDUHVRPHJRRGDQGLPSRUWDQWPLWLJDWLRQPHDVXUHVUHTXLUHGKHUHSDUWLFXODUO\WKRVH SUHYHQWLQJDQ\OLJKWLQWUXVLRQLQWR6&:3ERWKGXULQJFRQVWUXFWLRQDQGEH\RQG+RZHYHUDJDLQ PRVWRIWKHELRORJLFDOPLWLJDWLRQPHDVXUHV
00%,2
DGGUHVVLVVXHVUHODWHGWRFRQVWUXFWLRQ00
%,2LVDGGHGKHUHDQGFRQWLQXHVWKLVSDWWHUQRIDYRLGLQJLPSDFWVWKDWFDQRFFXUDIWHU FRQVWUXFWLRQ,WLVQRWHGWKDW³7HPSRUDU\LPSDFWVVKDOOEHUHWXUQHGWRSUHH[LVWLQJFRQWRXUVDQG UHYHJHWDWHGZLWKDSSURSULDWHQDWLYHVSHFLHV´,WVKRXOGEHDGGHGWKDWWKHPDWHULDOXVHGLQ UHYHJHWDWLRQVKRXOGEHFROOHFWHGZLWKLQ6&:3RUZLWKLQWKHORFDOHFRUHJLRQ HJZLWKLQ0%N
6HFWLRQ
6RXWKHUQ&DOLIRUQLD0RXQWDLQVDQG9DOOH\V6XEVHFWLRQ
3HUULV9DOOH\DQG+LOOVDQG
0%M6HFWLRQ
6RXWKHUQ&DOLIRUQLD0RXQWDLQVDQG9DOOH\V6XEVHFWLRQ
)RQWDQD3ODLQDQG
&DOLPHVD7HUUDFHV
RWKHUZLVHWKHUHXVDGDQJHURILQWURGXFLQJPDODGDSWHGJHQRW\SHVWKDWFDQ QHJDWLYHO\DIIHFWWKHORFDOSRSXODWLRQ
7KHUHTXLUHPHQWVRIWKH06+&3XUEDQZLOGODQGVLQWHUIDFHUHTXLUHFDUHIXOHYDOXDWLRQRIWKH SODQWSDOHWWHWREHXVHG$QDSSURSULDWHSDOHWWHZDVSURYLGHGE\'U0RQWDOYRDQH[SHUWLQ
UHVWRUDWLRQ
KRZHYHUZHILQGWKDWDQXPEHURILQDSSURSULDWHSODQWVKDYHEHHQUHWDLQHG7KHVH FDQUHVXOWLQDVLJQLILFDQWLPSDFWDQGVKRXOGEHUHPRYHG (QHUJ\
7KUHVKROG%
:RXOGWKH3URMHFWFRQIOLFWZLWKRUREVWUXFWDVWDWHRUORFDOSODQIRU UHQHZDEOHHQHUJ\RUHQHUJ\HIILFLHQF\"
7KUHVKROG&
:RXOGWKH3URMHFWDFKLHYHWKHJRDORIHQHUJ\FRQVHUYDWLRQE\WKH IROORZLQJ"
'HFUHDVLQJRYHUDOOSHUFDSLWDHQHUJ\FRQVXPSWLRQ
'HFUHDVLQJUHOLDQFHRQIRVVLOIXHOVVXFKDVFRDOQDWXUDOJDVDQGRLO DQG
,QFUHDVLQJUHOLDQFHRQUHQHZDEOHHQHUJ\VRXUFHV
7KHVHDUHOLVWHGDVOHVVWKDQVLJQLILFDQWIDFWRUV
KRZHYHUZKLOHWKHSURMHFWGRHVJRVRPHZD\
WRDFKLHYHHQHUJ\HIILFLHQF\XQGHU&DOLIRUQLD¶V*UHHQ%XLOGLQJ&RGH7LWOHVWDQGDUGVWKHUHLV RQHDUHDWKDWQHHGVWREHPLWLJDWHGWRHQVXUHSURJUHVVWRZDUGV&DOLIRUQLD¶VJRDORIDFKLHYLQJ P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters FDUERQQHXWUDOLW\E\LQFUHDVLQJUHOLDQFHRQUHQHZDEOHHQHUJ\,WLVVWDWHGWKDWWKHEXLOGLQJVZLOO ³KDYH³VRODUUHDG\´URRIVWKDWZLOOVWUXFWXUDOO\DFFRPPRGDWHODWHULQVWDOODWLRQRIURRIWRSVRODU SDQHOVDQGWKDWEXLOGLQJRSHUDWRUVSURYLGLQJURRIWRSVRODUSDQHOVZLOOVXEPLWSODQVIRUVRODU SDQHOVSULRUWRRFFXSDQF\´
'(,5VHF
8QIRUWXQDWHO\QRZKHUHLVWKHUHDQHQIRUFHDEOH
PLWLJDWLRQPHDVXUHWKDWHQVXUHVVRODUSDQHOVZLOOHYHUEHLQVWDOOHGRQDQ\EXLOGLQJ(YHQWKH TXRWHGVHFWLRQGRHVQRWVWDWHWKDWRSHUDWRUVZLOOSURYLGHURRIWRSSDQHOV$VVXFKWKHUHLVD SRWHQWLDOO\VLJQLILFDQWLPSDFWWKDWFDQHDVLO\EHPLWLJDWHGEXWDWSUHVHQWLVQRW 1RLVH
7KUHVKROG$
:RXOGWKH3URMHFWUHVXOWLQWKHJHQHUDWLRQRIDVXEVWDQWLDOWHPSRUDU\RU SHUPDQHQWLQFUHDVHLQDPELHQWQRLVHOHYHOVLQWKHYLFLQLW\RIWKHSURMHFWLQH[FHVVRI VWDQGDUGVHVWDEOLVKHGLQWKHORFDOJHQHUDOSODQRUQRLVHRUGLQDQFHRUDSSOLFDEOH VWDQGDUGVRIRWKHUDJHQFLHV"
7KUHVKROG%
:RXOGWKH3URMHFWUHVXOWLQWKHJHQHUDWLRQRIH[FHVVLYHJURXQGERUQH YLEUDWLRQRUJURXQGERUQHQRLVHOHYHOV"
$
6LJQLILFDQWZLWKRXWPLWLJDWLRQ
%
1RWVLJQLILFDQW+RZHYHU0012,RQO\DSSOLHVGXULQJ FRQVWUXFWLRQ$ORQJWHUPFRQFHUQDSSOLHVWRQLJKWWLPHQRLVHDQGYLEUDWLRQOHYHOVDURXQGWKH ZHVWHUQQRUWKHUQDQGQRUWKHDVWHUQORDGLQJED\VRI%XLOGLQJ$DVODUJHWUXFNVFRPHDQGJR 7KHSRWHQWLDOHIIHFWRIYLEUDWLRQRQDQLPDOVOLYLQJLQEXUURZV VXFKDV6WHSKHQ¶VNDQJDURRUDW
ZDVQRWFRQVLGHUHGEXWWKHYLEUDWLRQFRPLQJIURPODUJHWUXFNVZLOOWUDYHODVLJQLILFDQWGLVWDQFH 6HYHUDOPLWLJDWLRQPHDVXUHVDUHSRVVLEOH
RQHLVWRHOLPLQDWHRUVLJQLILFDQWO\UHGXFHWKHVRXQG RIEDFNXSZDUQLQJVGXULQJQLJKWWLPHKRXUV$QRWKHULVWRSURKLELWQLJKWWLPHXVHGXULQJDIHZ KRXUVHDFKQLJKWVRWKDWWKHUHLVDSHULRGRIFRQWLQXRXVTXLHWGXULQJHDFKQLJKWZKHQDQLPDOV DUHXQGLVWXUEHG
7KDQNVIRU\RXUDWWHQWLRQWRWKHVHLVVXHV
5HJDUGV
/HQ1XQQH\IRU)ULHQGVRI5LYHUVLGH¶V+LOOV
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters Sycamore Hills Distribution Center- Comments on Proposed Landscaping and Revegetation Plan (2/4/2021 comments)
Native plants form the backbone of wild plant communities and wildlife habitat. In the wildland-urban interface, landscaping, restoration, and revegetation plans need to be reviewed to ensure they engage practices that protect the integrity of adjacent plant populations, the native vegetation communities, and the diversity of wildlife supported. This is especially important for development plans adjacent to reserves such as the Sycamore Canyon Wilderness
Park and Reserve because the choice of plants for planting projects can have long-lasting effects on the reserve. In this period of rapid climate change, the ecological source of plant species, seeds, and other propagules can be especially critical to the establishment and long-term success of the plants used and their ability to reproduce over time. It is important to determine which plants are native to the target planting site and reserve (especially for restoration, water quality, and mitigation plantings) and which plants could potentially escape ornamental landscaping and become invasive within the reserve.
Steps can be taken to ensure that native plant materials for the project are appropriately adapted to the harsh inland environment. S
eeds for seeding and container plant production should
be obtained from wild populations of the local ecoregion or amplified from seeds sourced from within the interior valleys and foothills (below 2,500 ft. elevation) of Western Riverside County (within the Southern California Inland Mountains and Valleys ecological region). Sourcing of seeds and plant materials is best guided by experts with knowledge of the ecology, genetics, species distributions, and patterns of climate change over the landscape.
Here a few guidelines with regard to choices of plants for landscaping and mitigation areas:
x In mitigation areas, habitat plantings, and areas immediately adjacent to habitat, use native taxa that are actually local to this region of California, including varieties and subspecies.
x All plant materials used in landscaping adjacent to the Reserve, and which are not native to the local region, must be known to be non-invasive and unlikely to naturalize in the adjacent native habitat.
x Substitutions of California plant species, varieties or subspecies sourced from more coastal or higher rainfall regions should not occur.
Online tools are available to explore what plants are native and the potential of horticultural plants to invade wildlands. Local experts can also be consulted. It is no longer sufficient to exclude only the invasive plants noted in the Western Riverside County MSHCP
1. Since the time
that the MSHCP was signed, additional plants have been found to naturalize and become invasive in wildlands. One can easily consult the California Invasive Plant Council2 website and search the Consortium of California Herbaria3 (CCH) and CalFlora4 databases to see if non- native plants from horticulture are being recorded as naturalized in local wildlands. The latter two databases can be used in concert with the Jepson e-flora 5 and plant profiles of important
restoration plants6 to determine what taxa are native to the area and appropriate to use.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters For my review of the plant palettes for this project, I consulted the references noted above together with my personal experience. I have over 25 years of experiences in restoration practice and research involving southern California native plants and vegetation communities.
Location of project site relative to Sycamore Canyon Wilderness Park Reserve
Developments on the edge of habitat reserves have an opportunity and a special responsibility to use plant species in their landscaping and restoration plans that are compatible with the plants and wildlife of the adjacent reserve lands. This is especially true when there is sensitive habitat within the reserve.
The current project overlaps and is adjacent to the Sycamore Canyon Wilderness Park and Reserve in Riverside, California (Reserve). There is sensitive riparian habitat (California State jurisdictional waters) and Steven’s Kangaroo Rat Habitat adjacent to the project site. The project will also temporarily impact some habitat and there are plans to revegetate impacted areas. In addition to landscaping next to the Reserve, the plan includes revegetated slopes, water quality basins, and a parking area with native P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters landscaping. The use of appropriate plant materials is feasible for this site and can be done by providing adequate notice to native plant and seed suppliers. The following review of the plant palettes is provided for the special case of development and planting in the vicinity of sensitive reserve lands.
I have attached an excel spreadsheet with 8 tabs containing notes about the plant palettes provided to me on the landscaping plans in July 2020. Tabs in the spreadsheet refer to the following information regarding the landscaping plan:
x Summary of plant palettes covered (general comments on each palette and general recommendations)
x Plants to remove from palettes (provides links to websites and evidence of invasiveness) x Hydroseeding palette revisions (detailed comments; palette reworked using PLS pounds and alternative taxa)
x Bio-Retention container plants (detailed comments as to which plants to replace and suggested replacement plants)
x Park Landscape – in DG (comments on each plant taxon and potential replacements) x Fuel Modification Area (suggest one taxon be replaced owing to flammability issue; provide list of slower to ignite natives good for this zone)
x Trees (comments on trees, which ones should be replaced, and suggested substitutions) x Shrubs (list of shrubs to replace and replacement suggestions) Please provide questions in writing. We can always schedule an online meeting to discuss options.
Arlee Montalvo, Ph.D.
Plant Restoration Ecologist
[email protected]
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters 10c. FRH summary plant palettes covered
Summary of Plant Palette review. See individual tabs for details on each palette See invasive plants tab for details.
Use of 5 gal. containers is not necessary for the shrubs and ground covers. Use 1 gal and save dollars.
Palette Name comment summary
Accents
No invasiveness issues and no recommended changes. Not adjacent to reserve. Non-native palette with succulents and Lantana 'Gold Mound' Trees
Remove invasive tree Rhus lancea . Recommendations for substitutions are provided.
Shrubs
Remove the Texas privet and Baccharis pilularis ' Centenial' which can invade reserve. Potential substitutions are provided.
Groundcover No issues. OK as is.
Fuel Modification Area
Artemisia californica is quick to ignite and should be replace with a plant with slower ignition potential. Potential substitutions are provided.
Bio Retention Area
All species need to be native to this area because it drains into native areas and non-native plants are likely to disperse downstream. Some species are inappropriate for the site and can invade native streams.
Substitutions are provided that make more sense for this hot summer, inland area.
Park Landscape- for DG
Try substituting Eriogonum fasciculatum var. polifolium for the dwarf coyote brush. The Keckiella cordifolia tends to occur in somewhat higher rainfall areas in our region and may not survive well at this hot, exposed location; two potential replacement plants include Solanum xanti and Epilobium canum var. canum .
Seed for hydroseeding
There are multiple problems with this seeding palette. It includes some inappropriate taxa for this site and it lacks a specification for Pure Live Seed (PLS). Recommended changes are provided including specification for PLS pounds that will probably save dollars.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters 10c. FRH plants to remove from palettes
Plants to Remove from Plant Palettes. Removal requested because they can be invasive into Scientific name Common Name Problems
Ligustrum lucidum Texas privet, tree privet Plants produce copious berry- like fruits that are dispersed
by birds and water. The plant
can invade riparian areas.
Rhus lancea African sumac Use male trees or replace.
Fruits from female trees are
bird dispersed and plants can
be invasive in landscaping and
riparian areas and ephemeral
drainages of the adjacent
reserve and other
landscaping Pollen fromBaccharis pilularis 'Centenial' Centenial co yote bush Will likely invade reserve. This is a horticultural selection of
Baccharis pilularis var.
consanguinea. The species
occurs naturally in more
coastal and northern habitats.
When planted in our area, it
can invade riparian areas.
Baccharis pilularis has often
been misspecified for planting
in our region.
Elaeagnus pungens silverberry Plant only away from reserve to prevent spread into
reserve. The related E.
angustifolia , Russion olive is
invasive into seasonally moist
places in California. E.
pungens invades wildlands
throughout the southeastern
USA. DO NOT substitute with
E. angustifolia
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters 10c. FRH plants to remove from palettes
Cassia phyllodenia
(=Senna artemisioides)
silverleaf cassia Seeds itself readily into
landscaped areas and
potentially into adjacent
natural areas were moisture
exists. Plant away from
reserve edges to insure it
does not invade reserve.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters 10c. FRH plants to remove from palettes
o wildlands.
Links to sites that descrip
invasiveness
Calflora Map-
naturalized
Normal range of parent
taxon (if California plant)
https://www.cal-
ipc.org/plants/profile/ligustr
um-lucidum-profile/
https://en.wikipedia.o
rg/wiki/Privet_as_an_i
nvasive_plant
https://www.calfl
ora.org/cgi-
bin/species_query
.cgi?where-
http://www.public.asu.edu/
~camartin/plants/Plant%20
html%20files/searsialancea.
html
https://www.fs.fed.us
/r3/resources/health/i
nvasives/shrubsTrees/
africanSumac.shtml
https://www.calfl
ora.org/cgi-
bin/species_query
.cgi?where-
calrecnum=12012
Personal observations in
and near Riverside.
https://www.calflora.or
g/cgi-
bin/species_query.cgi?w
here-calrecnum=11369
https://www.invasiveplanta
tlas.org/subject.html?sub=4
526
https://www.calfl
ora.org/cgi-
bin/species_query
.cgi?where-
calrecnum=2897
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters 10c. FRH plants to remove from palettes
Personal observation and
observations in CalFlora in
wildlands.
https://www.calfl
ora.org/cgi-
bin/species_query
.cgi?where-
calrecnum=8576
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters 10c. FRH hydroseed palette revisions
Comments on hydroseeding mix for Park Landscape - planted in decomposed granite A. Hydroseeding mix in plan document that needs to be revised:
ID Botanical Name Common Name
bulk
Lbs/
Acre
PLS
lb/ac
Aristica purpurea purple three-awn 3
Artemisia california California sage brush 4
Encelia farinosa brittlebush, encensio 5
Eriogonum fasciculatum California buckwheat 12
Mimulus aurantiacus orange bush monkeyflo
w 2
Salvia apiana white sage 2
Salvia mellifera black sage 2
Acmispon glaber (Lotus scoparius) deerweed 5
Eschscholzia californica California poppy 3
Lupinus truncatus collard annual lupine 3
Salvia columbariae chia 1
Plantago erecta 4
Festuca microstachys (Vulpia microstachys) 3
46 B. Recommended revised list:
shrubs/subshrubs common name
PLS
lb/acre
in mix
example
% purity/
% germ
resulting
bulk lb
Acmispon glaber var. brevialatus inland deerweed 0.70 60/90 1.30 Artemisia california California sage brush 0.08 50/15 1.07 Encelia farinosa brittlebush 0.30 60/40 1.25
Eriogonum fasciculatum var. foliolosum California buckwheat 0.70 65/10 11.67 Diplacus longiflorus monkey flower 0.05 55/15 0.61
Salvia apiana white sage 0.70 50/70 2.00
Salvia mellifera black sage 0.60 50/70 1.71
3.13 19.60
annuals, perennials, and grasses
Eriophyllum confertiflorum var. confertiflorum golden yarrow 0.20 60/30 1.11 Eschscholzia californica (inland form) California poppy 0.10 75/98 0.14 Lupinus truncatus collard annual lupine 1.10 85/90 1.44 Phacelia distans common phacelia 0.30 90/70 0.48
Phacelia minor California bells 0.10 90/30 0.37
Plantago erecta dotseed plantain 1.20 90/80 1.67
Salvia columbariae chia 0.50 90/50 1.43
Stipa pulchra (or S. lepida ) purple needle grass 1.00 70/60 2.38 Vulpia microstachys (= Festuca microstachys) small fescue 0.75 90/70 1.19
5.25 10.20
other possible substitutions/additions (early annuals):
Acmispon strigosus strigose lotus
Phacelia ramosissima branching phacelia
Lasthenia gracilis ( might list as L. californica) slender goldfields Lupinus bicolor miniature lupine
Poa secunda Sandberb bluegrass
The seed mix is being used adjacent to conservation areas or the wildland park reserve. As such, it should use plants that a
correct subspecies and varieties and all seed should come from the local ecoregion.
The list A below should be replaced with List B which is appropriate for the location. List B provides taxa adapted to our ex pounds so that in the total mix, between 25 and 50 live seeds would be deposited per square foot, depending on seeding m seed lot data for the proportion that is live seeds and non-seed material. For example, if a bulk lb. of seed has a 80% germ the example seed lot, a PLS pound weighs 2.5 pounds. This assures you are getting the recommended numbers of live see Seed should originate from inland southern California region (not coast or mountains) last modified: 8/28/2020 printed: 07/29/2021P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters 10c. FRH hydroseed palette revisions
Notes: A target purity and germination needs to be
provided when you give bulk pounds. Use PLS pounds.
See table below with revised mix.
Not from this habitat. Replace with local perennial
bunchgrass such as Stipa pulchra, Melica imperfecta
taxon OK, but use PLS pounds
taxon OK, but use PLS pounds
use var. foliolosum or var. polifolium ( not the coastal var. fasciculatum) Wrong species for here. Use Diplacus longiflorus
OK
OK
use var. brevialatus (never the coastal var. glaber ) OK- use native annual seeds, not domesticated seeds
OK
OK
OK use to balance seeds:
OK *43560 sq ft /acre
S&S guide in mix target
seeds/ PLS
lb
live
seeds/ sq
ft*
158,840 2.6
5,500,000 10.1
450,000 3.1
500,000 8.0
12,000,000 13.8
325,000 5.2
529,000 7.3
subtotal shrubs 50.1
good perennial plant for early growth, suggest add 2,750,000 12.6 Use local annual. There are a lot of seeds/lb. 1,000,000 2.3 40,000 1.0
very common here- suggest adding 510,000 3.5
very common here- suggest adding 1,453,600 3.3
250,000 6.9
550,000 6.3
subbed for the Aristida 125,000 2.9
300,000 5.2
subtotal herbs/grasses 44.0
total seeds/sq ft 94.1
400,000
perennial 550,000
make sure if listed as L. californica, it comes from SoCal. 4,000,000 100,000
are NATIVE to the area. There should be designation of treme, inland area. It also considers Pure Live Seed (PLS) method. A PLS pound is adjusted from bulk pounds by the ination but is only 50% pure, the PLS of the lot is 40%. For ds/sq foot applied to the location.
last modified: 8/28/2020 printed: 07/29/2021P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters 10c. FRH Bio-Retention container plants
Bio-Retention Area-
This empties into Sycamore Canyon's streams so needs to use locally appropriate natives Remove species in red and replace with those in blue or from the "other local species of moist initial plan- revise for Sycamore Canyon -- use plants that occur in western Riverside County, local eco Scientific name common name life form
1 Rosa californica California wild rose shrub
2 Baccharis pilularis coyote bush shrub
3 Sambucus mexicana Mexican elderberry tall shrub
4 Mimulus cardinalis scarlet monkeyflower perennial herb 5 Aristida purpurea purple three awn bunch grass
6 Deschampsia caespitosa tufted hairgrass perennial grass 7 Distichlis spicata salt grass perennial grass
8 Juncus patens California grey rush perennial rush
9 Muhlenbergia rigens deergrass bunch grass
revised palette using plants actually native to Sycamore Canyon (use inland sources of plant material s
Scientific name common name
1 Rosa californica California wild rose shrub
2 Frankenia salina alkali heath perennial herb
3 Sambucus nigra ssp. caerulea blue elderberry tall shrub 4 Mimulus cardinalis (=Erythranthe c. ) scarlet monkeyflower perennial herb 5 Sporobolus airoides alkali sacaton bunch grass
6 Anemopsis californica yerba mansa perennial herb
7 Distichlis spicata salt grass perennial grass
8 Juncus mexicanus/ or Juncus balticus Mexican rush/ baltic rus h perennial rush
9 Muhlenbergia rigens deergrass bunch grass
other local species of moist sites (e.g., floodplains, ephemeral drainages) that could be substituted for Artemisia douglasiana California mugwort perennial herb Baccharis salicina (aka B. emoryi) willow baccharis shrub Isocoma menziesii var. vernonioides Menzie's goldenbush shrub Cyparus eragrostis tall flatsedge perennial herb
Stachys ajugoides var. rigida rigid hedge nettle perennial herb Verbena lasiostachys var. scabrida robust vervain perennial herb Elymus triticoides trailing wild rye tall perennial grass Elymus condensatus giant wild rye tall perennial grass
Urtica dioica ssp. holosericea stinging nettle tall perennial herb P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters 10c. FRH Bio-Retention container plants
sites" shown at bottom.
region
comments
ok
No. Not native here and too invasive. Replace with
Baccaris salicina (aka. B. emoryi) and limit use.
Better yet, use Frankenia salina .
name changed (=S. caerulea ssp. nigra)
ok- name changed to Erythranthe cardinalis
No. Not here. Replace with Sporobolus airoides?
No. Not native here, replace.
ok
no. Replace with J. mexicanus or J. balticus
ok
, NOT coastal)
comments
can use seeds
can use seeds and/or containers
use inland source, not coastal. Mycorrhizal.
this is the one that grow in park, not J. patens
from seeds or containers
r unavailable taxa or added as needed
Plants srpead once established.
can take over, use few plants.
don't over use.
Seeds in on its own. Can be overly competitive if added to seed palette.
Establishes well from seed in first year.
difficult to obtain seed from this region.
difficult to obtain seed from this region.
seeds
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters Park Landscape-planted in decomposed granite.
Riverside
Scientific name common name life form WULCOLS IV
1 Sphaeralcea ambigua desert mallow shrub L
2 Baccharis pilularis 'Pigeon Po int' dwarf coyote bush low shrub L 3 Encelia farinosa brittlebush shrub VL
4 Keckiella cordifolia heart-leaved penstemon shrub L
See WULCOLS IV https://ucanr.edu/sites/WUCOLS/
Water Use Classification of Landscape Species has been updated.
WUCOLS IV provides evaluations of the irrigation water needs for over 3,500 taxa (taxonomic p P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters comments
Not native here. OK on inside of walls but not
directly by park.
Only plant males or it will spread into park.
Perhaps replace with Eriogonum fasciculatum
var. polifolium. Also consider Epilobium canum
var. canum.
ok
for Riverside, WULCOS says L, not VL. K.
antirrhinoides is the species in the park. It
survives our summers better, but becomes
completely summer dormant and looks dead.
Perhaps replace with Solanum xanti.
plant groups) used in California landscapes.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters 10c. FRH Fuel Modification Area
Fuel Modification Area- corrected
Replace species listed here on plan RIVERSIDE
Scientific name common name WULCOLS WULCOLS IV
1 Artemisa california California sagebrush (not m uVL VL 2 Cercocarpus betuloides mountain mahogany VL VL
3 Heteromeles arbutifolia toyon VL L
4 Rhamnus crocea spiny redberry VL L
Substitutions: Use plants native to the reserve or shrubs that do not disperse seeds into the wildland an d
1 Prunus ilicifolia ssp. ilicifolia hollyleaf cherry
other good plants for this plant palette:
Frangula californica (=Rhamnus
californica) coffee berry L
Rhamnus ilicifolia redberry L
Rhus ovata sugarbush L
See WULCOLS IV https://ucanr.edu/sites/WUCOLS/
Water Use Classification of Landscape Species has been updated.
WUCOLS IV provides evaluations of the irrigation water needs for over 3,500 taxa (taxonomic plant P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters 10c. FRH Fuel Modification Area
comments
Replace. Too quick to ignite for fuel modification
area
ok
WULOLS input not correct for Riverside.
WULOLS input not correct for Riverside.
d become invasive.
evergreen plant, longer time to ignite for low fuel zone evergreen plant, longer time to ignite for low fuel zone evergreen plant, longer time to ignite for low fuel zone evergreen plant, longer time to ignite for low fuel zone t groups) used in California landscapes.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters 10c. FRH Trees
Trees-
Non-native trees that produce seeds that invade both landscaping and park must be replace Riverside
Scientific name common name WULCOLS WULCOLS IV
1 Chilopsis linearis desert willow L L
2 Chitalpa tashkentensis chitalpa L L
3 Cercis occidentalis western redbud M L
4 Heteromeles arbutifolia toyon L L
5 Platanus racemosa California sycamore M Mod/Med
6 Quercus agrifolia coast live oak M L
7 Rhus lancea (=Searsia lancea) African sumac L L
8 Tristania conferta (=Lophostemon
confertus) Brisbane box M Mod/Med
Substitutions: Use native trees/ tall shrubs or trees that do not disperse seeds into the wi Prunus ilicifolia ssp. ilicifolia hollyleaf cherry L
Rhus ovata sugarbush L
Ceanothus 'Ray Hartman'
Ray Hartman
ceanothus L
Quercus engelmannii
Engelmann oak,
mesa oak L
See WULCOLS IV https://ucanr.edu/sites/WUCOLS/
Water Use Classification of Landscape Species has been updated.
WUCOLS IV provides evaluations of the irrigation water needs for over 3,500 taxa (t P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters 10c. FRH Trees
ed
comments
ok
ok
ok but sensitive to extreme heat
ok
ok-- NEVER replace with other sycamores
ok
DO NOT USE. This tree has naturalized and is
invading natural habitats in southern California.
For example, it has spread outward from
landscaping around the museum at Lake Perris.
More and more records are showing up in
CalFlora. Birds and mamals disperse the seeds.
https://w
ww.calflor
a.org/cgi-
bin/specie
s_query.c
gi?where-
calrecnum
USDA Plants database. Not listed as naturalized
in Calif. Biogenic emissions may be high.
ldland and become invasive.
These would be good replacements
These would be good replacements
updated and corrected for Riverside
axonomic plant groups) used in California landscapes.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters
SHRUBS-
Replace species listed here.
Scientific name common name WULCOLS
1 Baccharis pilulars 'Centenial' Coyote bush L
2 Ligustrum lucidum (=L. j. Texanum) Texas privet, tree privet M 3 Elaeagnus pungens silverberry L
4 5
6 7
8 Suggestions for substitutions
Substitutions: Use shrubs that are native or that do not disperse seeds into the wildland and beco m
Ceanothus 'Ray Hartman' Ray Hartment ceanothus
Rhus ovata sugarbush
Prunus ilicifolia ssp. ilicifolia hollyleaf cherry
Simmondsia chinensis jojoba
Peritoma arborea bladderpod
see WULCOLS IV search below for trees/shrubs with low water uses for Riverside https://ucanr.edu/sites/WUCOLS/Plant_Search/?step=results&city_id=328&plant_name=& w
See WULCOLS IV https://ucanr.edu/sites/WUCOLS/
Water Use Classification of Landscape Species has been updated.
WUCOLS IV provides evaluations of the irrigation water needs for over 3,500 taxa (taxonomi P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters Riverside
WULCOLS IV comments
L not native here and will invade wildland reserve
M invasive into riparian areas of reserve
L potentially invasive
me invasive.
L
L
L
VL
L
water_use=VL&water_use=LO&water_use=M&plant_type=S&plant_type=T c plant groups) used in California landscapes.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters July 23, 2021
Veronica Hernandez
Senior Planner
City of Riverside
3900 Main Street, 3rd Floor
Riverside, California 92522
[email protected]
Dear Veronica Hernandez:
Thank you for providing the California Air Resources Board (CARB) with the opportunity to comment on the Sycamore Hills Distribution Center (Project) Draft Environmental Impact Report (DEIR), State Clearinghouse No. 2020079023. The Project consists of the construction and operation of two transload short-term warehouse buildings totaling 603,100 square feet, primarily for the short-term storage and/or consolidation of manufactured goods prior to their distribution to retail locations or other warehouses. The Project is expected to generate approximately 847 daily vehicle trips, including 274 daily heavy-duty truck trips, along local roadways. The Project is proposed within the City of Riverside (City), California, which is the lead agency for California Environmental Quality Act (CEQA) purposes.
CARB submitted a comment letter, which is attached to this letter, on the Notice of Preparation (NOP) for the DEIR released in July 2020. CARB’s comments, dated August 27, 2020, highlighted the need for preparing a health risk assessment (HRA) for the Project and encouraged the City and applicant to implement all existing and emerging zero emission technologies to minimize exposure to diesel particulate matter (diesel PM) and nitrogen oxides (NOx) emissions for all neighboring communities, and to minimize the greenhouse gases that contribute to climate change. Due to the Project’s proximity to residences already disproportionately burdened by multiple sources of pollution, CARB’s comments expressed concerns with the potential cumulative health risks associated with the construction and operation of the Project.
The DEIR Did Not Model Mobile Air Pollutant Emissions Using CARB’s 2021 Emission Factor Model (EMFAC2021)
The City and applicant modeled the Project’s air pollutant emissions using mobile emission factors obtained from CARB’s 2014 Emission Factors model (EMFAC2014). Since the public release of EMFAC2014 in May 2015, CARB has made many updates to the EMFAC model.
These updates are reflected in EMFAC2017, released in May 2018, and EMFAC2021, released in January 2021. Some of the updates to the EMFAC model included updates to the heavy-duty truck activity and emission rates, and implementation of CARB’s latest regulations.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters EMFAC2014 underestimated diesel PM emission rates from diesel heavy-duty trucks due to limited in-use test data for engine model year 2010 and newer, thus the Project’s mobile source diesel PM emissions are likely underestimated in the DEIR. CARB urges the City and applicant to model and report the Project’s air pollution emissions from mobile sources using emission factors found in CARB’s latest EMFAC2021. Mobile emission factors can be easily obtained by running the EMFAC2021 Web Database: https://arb.ca.gov/emfac/emissions- inventory.
The DEIR Did Not Account for Air Pollutant Emissions from Heavy Duty Trucks During On Site Grading
The DEIR did not account for mobile source air pollutant emissions from grading operations during the Project’s construction phase. Based on CARB’s review of the California Emissions Estimator Model (CalEEMod) outputs found in Appendix B (Air Quality Studies) of the DEIR, the City and applicant assumed that no heavy-duty truck trips would be required to import or export soil during the on-site grading. Furthermore, the DEIR does not explicitly state the quantity of soil needed to grade the Project site that would support this assumption. If the Project site cannot be graded using existing on-site soil, the soil will need to be imported into the Project site. If that is the case, a large number of heavy-duty truck trips may be required to transport soil.
CARB urges the City and applicant to remodel the Project’s construction air pollutant emissions using accurate heavy duty truck trip estimates. Residences and other sensitive receptors (e.g., daycare facilities, senior care facilities, and schools) located near construction haul routes could be exposed to diesel exhaust emissions that were not evaluated in the DEIR. The DEIR should clearly state the total number of heavy-duty truck trips expected during Project construction so the public can fully understand the potential environmental effects of the Project on their communities.
The Final Environmental Impact Report Should Restrict the Operation of Transport Refrigeration Units within the Project Area Chapter 3.2 (Project Characteristics) of the DEIR states that the proposed Project would not include the operation of on-site cold storage uses. Consequently, air pollutant emissions associated with cold storage operation were not included in the DEIR. Should the Project later include cold storage uses, residences near the Project-site could be exposed to significantly higher levels of toxic diesel PM and nitrogen oxides (NO x), and greenhouse
gases than trucks and trailers without TRUs. To ensure TRUs will not operate within the Project site without first quantifying and mitigating their potential impacts, CARB urges the City to include one of the following design measures in the Final Environmental Impact Report (FEIR):
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters x A Project design measure requiring contractual language in tenant lease agreements that prohibits tenants from operating TRUs within the Project-site; or x A condition requiring a restrictive covenant over the parcel that prohibits the applicant’s use of TRUs on the property, unless the applicant seeks and receives an amendment to its conditional use permit allowing such use.
If the City later chooses to allow TRUs to operate within the Project site, CARB urges the County to re-model the Project’s air quality impact analysis and HRA to account for potential health risks. The updated air quality impact analysis and HRA should include the following air pollutant emission reduction measures:
x Include contractual language in tenant lease agreements that requires all loading/unloading docks and trailer spaces to be equipped with electrical hookups for trucks with TRU or auxiliary power units. This requirement will substantially decrease the amount of time that a TRU powered by a fossil-fueled internal combustion engine can operate at the Project-site. Use of zero-emission all-electric plug-in TRUs, hydrogen fuel cell transport refrigeration, and cryogenic transport refrigeration are encouraged and can also be included in lease agreements. 1 x Include contractual language in tenant lease agreements that requires all TRUs entering the project site to be plug-in capable
The Final Environmental Impact Report Should Include More Mitigation Measures to Further Reduce the Project’s Air Pollution Emissions
The DEIR concluded that the Project would not exceed the South Coast Air Quality Management District’s significance thresholds and potential impacts are expected to be less than significant. Therefore, the Project has no mitigation measures specific to air quality except for Mitigation Measure MM AIR-1, which is required to ensure that the actual use of the site is consistent with the use described in the Project Description and analyzed in the project specific air quality analyses. However, the community near the Project site is already exposed to toxic diesel PM emissions from freight operations at existing industrial buildings and vehicular traffic on East Alessandro Boulevard and Interstate 215 (I-215). Due to the Project’s proximity to residences and schools, CARB is concerned with the potential cumulative health impacts associated with the construction and operation of the Project. To further reduce the Project’s air pollutant emissions, CARB urges the City and applicant to implement the emissions reduction measures listed in CARB’s attached comment (Attachment A) on the NOP for the DEIR in the Final Environmental Impact Report. 1 CARB’s Technology Assessment for Transport Refrigerators provides information on the current and projected development of TRUs, including current and anticipated costs. The assessment is available at:
https://www.arb.ca.gov/msprog/tech/techreport/tru_07292015.pdf.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters Conclusion
CARB is concerned about the potential public health impacts should the City approve the Project. To fully understand the Project's environmental impacts, the HRA should be revised in the FEIR using mobile and idling PM
10 emission factors obtained from the latest version of EMFAC (i.e., EMFAC2021). If heavy-duty trucks are required to import or export soil from the site during Project construction, the Project’s air quality analysis and HRA should be updated to reflect such activities. The FEIR should include a design measure restricting the operation of TRUs within the Project site. Should the City allow the proposed warehouse building to be used for cold storage, the City should update the Project's air quality analysis and HRA to account for the increase in air pollution and cancer risks resulting from trucks and trailers with TRUs visiting the Project site. Lastly, to reduce the Project’s impact on public health, CARB encourages the City to implement the measures listed in Attachment A of this comment letter.
Given the breadth and scope of projects subject to CEQA review throughout California that have air quality and greenhouse gas impacts, coupled with CARB’s limited staff resources to substantively respond to all issues associated with a project, CARB must prioritize its substantive comments here based on staff time, resources, and its assessment of impacts.
CARB’s deliberate decision to substantively comment on some issues does not constitute an admission or concession that it substantively agrees with the lead agency’s findings and conclusions on any issues on which CARB does not substantively submit comments.
CARB appreciates the opportunity to comment on the DEIR for the Project and can provide assistance on zero-emission technologies and emission reduction strategies, as needed. If you have questions, please contact Michaela Nucal, Air Pollution Specialist, via email at [email protected].
Sincerely,
Robert Krieger, Branch Chief, Risk Reduction Branch
Attachment
cc: See next page.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters cc: State Clearinghouse
[email protected]
Carlo De La Cruz, Senior Campaign Representative, Sierra Club [email protected]
Lijin Sun, Program Supervisor, CEQA Intergovernmental Review, South Coast Air Quality Management District
[email protected]
Morgan Capilla, NEPA Reviewer, U.S. Environmental Protection Agency,Air Division, Region 9
[email protected]
Marven Norman, Policy Specialist, Center for Community Action and Environmental Justice
[email protected]
Taylor Thomas, Research and Policy Analyst, East Yard Communities for Environmental Justice
[email protected]
Michaela Nucal, Air Pollution Specialist, Risk Reduction Branch
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters Attachment A
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters August 27, 2020
Veronica Hernandez
Senior Planner
City of Riverside
3900 Main Street, 3
rd Floor
Riverside, California 92522
Submitted via email: [email protected]
Dear Veronica Hernandez:
Thank you for providing the California Air Resources Board (CARB) with the opportunity to comment on the Notice of Preparation (NOP) for the Sycamore Hills Distribution Center Project (Project) Draft Environmental Impact Report (DEIR), State Clearinghouse No. 2020079023. The Project includes the development of two warehouse buildings totaling 603,100 square feet. The proposed warehouses will be used for short-term transloading operations, primarily for the short-term storage and/or consolidation of manufactured goods. The Project is located within the City of Riverside, California, which is the lead agency for California Environmental Quality Act (CEQA) purposes.
Freight facilities, such as warehouse and distribution facilities, can result in high daily volumes of heavy-duty diesel truck traffic and operation of on-site equipment (e.g., forklifts and yard tractors) that emit toxic diesel emissions, and contribute to regional air pollution and global climate change.
1 CARB has reviewed the NOP and is
concerned about the air pollution and health risk impacts that would result should the City approve the Project.
I. The Project Would Increase Exposure to Air Pollution in Disadvantaged Communities
The Project, if approved, will expose nearby disadvantaged communities to elevated levels of air pollution. Residences are located approximately 350 feet south of the Project’s southern boundary. In addition to residences, four schools (Taft Elementary School, John F. Kennedy Elementary School, Benjamin Franklin Elementary School, and Edgemont Elementary School) and a daycare center (Little Angels Daycare) are located within 2 miles of the Project. The community near the Project site is already exposed to toxic diesel particulate matter (diesel PM) emissions from freight operations
1. With regard to greenhouse gas emissions from this project, CARB has been clear that local governments and project proponents have a responsibility to properly mitigate these impacts. CARB’s guidance, set out in detail in the Scoping Plan issued in 2017, makes clear that in CARB’s expert view, local mitigation is critical to achieving climate goals and reducing greenhouse gases below levels of significance.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters at existing industrial buildings, and vehicular traffic on East Alessandro Boulevard and Interstate 215 (I-215). Due to the Project’s proximity to residences, schools, and daycares already burdened by multiple sources of air pollution, CARB is concerned with the potential cumulative health impacts associated with the construction and operation of the Project.
The State of California has placed additional emphasis on protecting local communities from the harmful effects of air pollution through the passage of Assembly Bill 617 (AB 617) (Garcia, Chapter 136, Statutes of 2017). AB 617 is a significant piece of air quality legislation that highlights the need for further emission reductions in communities with high exposure burdens, like those in which the Project is located. Diesel PM emissions generated during the construction and operation of the Project would negatively impact the community, which is already impacted by air pollution from existing industrial facilities and vehicular traffic on East Alessandro Boulevard and I-215.
II. The DEIR Should Quantify and Di scuss the Potential Cancer Risks at Residential and Other Sensitive Receptors in the Vicinity of the Proposed Industrial Building
The Project, as proposed in the NOP, will not include refrigerated storage. The operation of cold storage warehouses would include trucks with transportation refrigeration units (TRU)
2 that emit significantly higher levels of toxic diesel PM emissions, oxides of nitrogen (NOx), and greenhouse gases than trucks without TRUs.
To ensure TRUs will not operate within the Project site, CARB urges the City to include one of the following design measures in a revised DEIR:
x A Project design measure requiring contractual language in tenant lease agreements that prohibits tenants from operating TRUs within the Project site; or
x A condition requiring a restrictive covenant over the parcel that prohibits the applicant’s use of TRUs on the property, unless the applicant seeks and receives an amendment to its conditional use permit allowing such use.
If the City chooses to allow TRUs within the Project site, CARB urges the City to model air pollutant emissions from on-site TRUs, as well as prepare a health risk assessment (HRA) that shows the potential health risks. The DEIR should also include the air pollutant reduction measures listed in Attachment A.
In addition to the health risk associated with operations, construction health risks should be included in the air quality section of the DEIR and the Project’s HRA. Construction of the Project would result in short-term diesel emissions from the use of both on-road and off-road diesel equipment. The Office of Environmental Health Hazard Assessment’s
2. TRUs are refrigeration systems powered by diesel internal combustion engines that protect perishable goods during transport in an insulated truck and trailer vans, rail cars, and domestic shipping containers.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters (OEHHA) guidance recommends assessing cancer risks for construction projects lasting longer than two months. Since construction would very likely occur over a period lasting longer than two months, the HRA prepared for the Project should include health risks for existing residences near the Project site during construction.
The HRA prepared in support of the Project should be based on the latest OEHHA guidance (2015 Air Toxics Hot Spots Program Guidance Manual for Preparation of Health Risk Assessments),
3 and the South Coast Air Quality Management District’s (SCAQMD) CEQA Air Quality Handbook.4 The HRA should evaluate and present the existing baseline (current conditions), future baseline (full build-out year, without the Project), and future year with the Project. The health risks modeled under both the existing and the future baselines should reflect all applicable federal, state, and local rules and regulations. By evaluating health risks using both baselines, the public and City planners will have a complete understanding of the potential health impacts that would result from the Project.
III. Conclusion
To reduce the exposure of toxic diesel PM emissions in disadvantaged communities already disproportionally impacted by air pollution, the final design of the Project should include all existing and emerging zero-emission technologies to minimize diesel PM and NO
x emissions, as well as the greenhouse gases that contribute to climate change.
CARB encourages the City and applicant to implement the measures listed in Attachment A of this comment letter to reduce the Project’s construction and operational air pollution emissions.
Given the breadth and scope of projects subject to CEQA review throughout California that have air quality and greenhouse gas impacts, coupled with CARB’s limited staff resources to substantively respond to all issues associated with a project, CARB must prioritize its substantive comments here based on staff time, resources, and its assessment of impacts. CARB’s deliberate decision to substantively comment on some issues does not constitute an admission or concession that it substantively agrees with the lead agency’s findings and conclusions on any issues on which CARB does not substantively submit comments.
3. Office of Environmental Health Hazard Assessment (OEHHA). Air Toxics Hot Spots Program Guidance Manual for Preparation of Health Risk Assessments. February 2015. Accessed at: https://oehha.ca.gov/media/downloads/crnr/2015guidancemanual.pdf.
4. SCAQMD’s 1993 Handbook can be found at: http://www.aqmd.gov/home/rules-compliance/ceqa/air-quality-analysis-handbook.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters CARB appreciates the opportunity to comment on the NOP for the Project and can provide assistance on zero-emission technologies and emission reduction strategies, as needed. Please include CARB on your State Clearinghouse list of selected State agencies that will receive the DEIR as part of the comment period. If you have questions, please contact Michaela Nucal, Air Pollution Specialist, via email at [email protected].
Sincerely,
Richard Boyd, Chief
Risk Reduction Branch
Transportation and Toxics Division
Attachment
cc: See next page.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters cc: State Clearinghouse
[email protected]
Carlo De La Cruz
Senior Campaign Representative
Sierra Club
[email protected]
Lijin Sun
Program Supervisor
CEQA Intergovernmental Review
South Coast Air Quality Management District
[email protected]
Morgan Capilla
NEPA Reviewer
U.S. Environmental Protection Agency
Air Division, Region 9
[email protected]
Taylor Thomas
Research and Policy Analyst
East Yard Communities for Environmental Justice
[email protected]
Andrea Vidaurre
Policy Analyst
Center for Community Action and Environmental Justice
[email protected]
Michaela Nucal
Air Pollution Specialist
Risk Analysis Section
Transportation and Toxics Division
[email protected]
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters
ATTACHMENT A
Recommended Air Pollution Emission Reduction Measures
for Warehouses and Distribution Centers
The California Air Resources Board (CARB) recommends developers and government planners use all existing and emerging zero to near-zero emission technologies during project construction and operation to minimize public exposure to air pollution. Below are some measures, currently recommended by CARB, specific to warehouse and distribution center projects. These recommendations are subject to change as new zero-emission technologies become available.
Recommended Construction Measures
1. Ensure the cleanest possible construction practices and equipment are used.
This includes eliminating the idling of diesel-powered equipment and providing the necessary infrastructure (e.g., electrical hookups) to support zero and near-zero equipment and tools.
2. Implement, and plan accordingly for, the necessary infrastructure to support the zero and near-zero emission technology vehicles and equipment that will be operating on site. Necessary infrastructure may include the physical (e.g., needed footprint), energy, and fueling infrastructure for construction equipment, on-site vehicles and equipment, and medium-heavy and heavy-heavy duty trucks.
3. In construction contracts, include language that requires all off-road diesel-powered equipment used during construction to be equipped with Tier 4 or cleaner engines, except for specialized construction equipment in which Tier 4 engines are not available. In place of Tier 4 engines, off-road equipment can incorporate retrofits, such that, emission reductions achieved equal or exceed that of a Tier 4 engine.
4. In construction contracts, include language that requires all off-road equipment with a power rating below 19 kilowatts (e.g., plate compactors, pressure washers) used during project construction be battery powered.
5. In construction contracts, include lan guage that requires all heavy-duty trucks entering the construction site, during the grading and building construction phases be model year 2014 or later. All heavy-duty haul trucks should also meet CARB’s lowest optional low-oxides of nitrogen (NO
x) standard starting in the year
2022.1
1. In 2013, CARB adopted optional low-NOx emission standards for on-road heavy-duty engines. CARB encourages engine manufacturers to introduce new technologies to reduce NOx emissions below the current mandatory on-road heavy-duty diesel engine emission standards for model year 2010 and later. CARB’s optional low-NOx emission standard is available at:
https://www.arb.ca.gov/msprog/onroad/optionnox/optionnox.htm.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters
6. In construction contracts, include language that requires all construction equipment and fleets to be in compliance with all current air quality regulations.
CARB is available to assist in implementing this recommendation.
Recommended Operation Measures
1. Include contractual language in tenant lease agreements that requires tenants to use the cleanest technologies available, and to provide the necessary infrastructure to support zero-emission vehicles and equipment that will be operating on site.
2. Include contractual language in tenant lease agreements that requires all loading/unloading docks and trailer spaces be equipped with electrical hookups for trucks with transport refrigeration units (TRU) or auxiliary power units. This requirement will substantially decrease the amount of time that a TRU powered by a fossil-fueled internal combustion engine can operate at the project site. Use of zero-emission all-electric plug-in TRUs, hydrogen fuel cell transport refrigeration, and cryogenic transport refrigeration are encouraged and can also be included in lease agreements.
2 3. Include contractual language in tenant lease agreements that requires all TRUs entering the project site be plug-in capable.
4. Include contractual language in tenant lease agreements that requires future tenants to exclusively use zero-emission light and medium-duty delivery trucks and vans.
5. Include contractual language in tenant lease agreements requiring all TRUs, trucks, and cars entering the Project site be zero-emission.
6. Include contractual language in tenant lease agreements that requires all service equipment (e.g., yard hostlers, yard equipment, forklifts, and pallet jacks) used within the project site to be zero-emission. This equipment is widely available.
7. Include contractual language in tenant lease agreements that requires all heavy-duty trucks entering or on the project site to be model year 2014 or later, expedite a transition to zero-emission vehicles, and be fully zero-emission beginning in 2030.
2. CARB’s Technology Assessment for Transport Refrigerators provides information on the current and projected development of TRUs, including current and anticipated costs. The assessment is available at:
https://www.arb.ca.gov/msprog/tech/techreport/tru_07292015.pdf.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters
8. Include contractual language in tenant lease agreements that requires the tenant be in, and monitor compliance with, all current air quality regulations for on-road trucks including CARB’s Heavy-Duty (Tractor-Trailer) Greenhouse Gas Regulation,
3 Periodic Smoke Inspection Program (PSIP),4 and the Statewide Truck and Bus Regulation.5
9. Include contractual language in tenant lease agreements restricting trucks and support equipment from idling longer than 5 minutes while on site.
10. Include contractual language in tenant lease agreements that limits on-site TRU diesel engine runtime to no longer than 15 minutes. If no cold storage operations are planned, include contractual language and permit conditions that prohibit cold storage operations unless a health risk assessment is conducted, and the health impacts fully mitigated.
11. Include rooftop solar panels for each proposed warehouse to the extent feasible, with a capacity that matches the maximum allowed for distributed solar connections to the grid.
12. Including language in tenant lease agreements, requiring the installing of vegetative walls
6 or other effective barriers that separate loading docks and people living or working nearby.
3. In December 2008, CARB adopted a regulation to reduce greenhouse gas emissions by improving the fuel efficiency of heavy-duty tractors that pull 53-foot or longer box-type trailers. The regulation applies primarily to owners of 53-foot or longer box-type trailers, including both dry-van and refrigerated-van trailers, and owners of the heavy-duty tractors that pull them on California highways. CARB’s Heavy-Duty (Tractor-Trailer) Greenhouse Gas Regulation is available at:
https://www.arb.ca.gov/cc/hdghg/hdghg.htm.
4. The PSIP program requires that diesel and bus fleet owners conduct annual smoke opacity inspections of their vehicles and repair those with excessive smoke emissions to ensure compliance. CARB’s PSIP program is available at:
https://www.arb.ca.gov/enf/hdvip/hdvip.htm.
5. The regulation requires that newer heavier trucks and buses must meet particulate matter filter requirements beginning January 1, 2012. Lighter and older heavier trucks must be replaced starting January 1, 2015. By January 1, 2023, nearly all trucks and buses will need to have 2010 model year engines or equivalent. CARB’s Statewide Truck and Bus Regulation is available at:
https://www.arb.ca.gov/msprog/onrdiesel/onrdiesel.htm.
6. Effectiveness of Sound Wall-Vegetation Combination Barriers as Near-Roadway Pollutant Mitigation Strategies (2017) is available at: https://ww2.arb.ca.gov/sites/default/files/classic//research/apr/past/13-306.pdf.
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters 3985 University Avenue, Riverside, CA 92501 • Phone: (951) 683-7100 • Fax: (951) 683-2670 www.riverside-chamber.com
GREATER RIVERSIDE
CHAMBERS OF COMMERCE
__________________________________________________
The Chamber…building a stronger local economy
July 26, 2021
Chair Richard Kirby
Planning Commission
City of Riverside
3900 Main Street,
Riverside, CA 92501
Subject: Sycamore Hills Distribution Center Project - SUPPORT Dear Chair Kirby and Members of the Planning Commission, On behalf of the Greater Riverside Chambers of Co mmerce, representing over 1,200 local employers and 110,000 jobs in the Inland Southern Ca lifornia region, we respectfully SUPPORT KB Development’s proposed development of the Sycamore Hills Distribution Center on East Alessandro Boulevard.
The Chamber’s EastHills Business Council met with KB Development and voted in unanimous support of the project due to the investment and connectivity this de velopment will bring to the EastHills area. The project will bring two 400,000 and 200,000 square foot centers to the currently vacant zoned commercial land. The buildings and landscaping will complement the surrounding area with natural aesthetics and colors.
In preservation of the surrounding trails and wild landsca pe, the development proposed to build out a parking lot adjacent to the Sycamore Canyon trails to allow reside nts to safely park without impeding on the land and to encourage healthy outdoor activities . The proposed project will also be built out 500 feet away from the conservation areas.
The Sycamore Hills Distribution Center will also bring needed jobs to the region. With the after-effects of COVID-19, the introduction of ne w employment opportunities in the ar ea will boost the region towards economic growth and trajectory.
For these reasons, the Chamber requests your support of the proposed developmen t of the Sycamore Hills Distribution Center on East Alessandro Boulevard.
Thank you for your consideration. Should you have any ques tions, please do not hesitate to contact me at 951- 683-7100.
Respectfully,
Cindy Roth
President/CEO
CR/jd
P20-0025, P19-0626, P19-0627, P20-0258, P20-0282, P20-0024, Exhibit 11 - Public Comment Letters