San Dimas City Council
July 28, 2026

ATTACHMENT 3

ATTACHMENT 4




  
 

!
"#
$#%
&#'#(%
)*+,)-(
$$
.
#
#

#&%
'%/#0#"# 1(%-2

/3%'.%.

45$'6

(#
7896

(#
:;

$ %<=2
%. (%

#%#&%
(
%
(%
%/#6

(#

#(#"#&2
%((
%
3>%
%
%= $

#%/?@,,A%/%/#2
#"
>'%A#"#$
%/'-&BCDEFGHIGJCKELMBCHHCFNKO ELGPQEGQBNKQHPGRNMNCKRCKRGDKNKOELGRCKEDQRELQMSGGKJQPGTBDCJELGUGDMCK CDRCJUQKVQFQDPGPELGRCKEDQRECDELGNDQOGKEWXLGYGINKGZREQHMCDG[\NDGM UQDENGMNKICHIGPNKM\RLRCKEDQREMECPNMRHCMGQKVRCKEDNS\ENCKMJQPGECELG]BBNRGDW XLGYGINKGZREPCGMKCEQUUHVECRCJUGENENIGHVSNPTHQSCDTUGDMCKQHGJUHCVJGKE RCKEDQREMTRCKEDQREM IQH\GP \KPGD^_`T```TRCKEDQREM SGEFGGK OCIGDKJGKE QOGKRNGMTCDRCKEDQREMFLGDGKCUQDEVDGRGNIGMBNKQKRNQHRCJUGKMQENCKW a ZWXLGYGINKGZREbcdefg`eh]ijk]XQUUHVECELNMZODGGJGKEW a lWXLGYGINKGZREbcdefg`ePCGMQUUHVECELNMZODGGJGKEQKPELGDG[\NDGP PNMRHCM\DGNMQMBCHHCFMm >

#%6

(#
'(3#
(%#&
%/#%.

45$'nA#3'%#'3#
Ao p q.

r
>(stGHRCJGECjQKhNJQMTdZuMQKPNJQMRQWOCIv p w=
$$''
#
'xtGHRCJGECjQKhNJQMTdZuMQKPNJQMRQWOCIv y/#2
%.$<=%/'(#
%
(%
'
#'2
'3#

&#%#
$=A/#%/#

#(2#%

2
%((
%
3>%
'6

(#
2 

%
'A#
=%/#


A= z>#'%
'o {|}"#.
>

.
>
(
$2.-

.2
%(2%

=#%
3#/

.
>

.
>
(
$2.-$&#.2
%((
%
3>%
'%
%=$

#%/?@,,%
.6

(#
%/#{~$
%/'2
#(#&=%/#&%#.
>'>3$%%#&.
>
2 2
'-%/#&%#.
> (
$2#%#&%/'

$-

%/#%(2%#&&%#

.
>((%

#%#&%
%/' 1=
##$#% €4oa ‚
.#'-A/(/6

(#
8';o(<

%2/#
#%
#%#
%#ƒ%| „6oa
†‡ˆ‰‰Š‹ŒŽŒ‘’“‘’”Œ•Œ‹–Œ—˜‘™™˜Š’–Œ—˜‰‰Š‹Œ˜‰‘’‘šŒ’‹”›‘’”‘•–Œ’‘–Œ–˜‘’Œ•Œ‹–Œ—˜‘™™˜Š’–Œ—˜‰‰Š‹Œ˜‰‘’‘šŒ’‹”›†œž† œŸ† œž¡žœ¢£†¤¥¦†£§£ ¢¡¨£†¥¤¤¡ £†¡†œ†œ©£ Ÿª†¥¢«£¦†¢«œ†œ† ¡¢Ÿ†œ¢¢¥¦£Ÿ†¥¦† ¥¬¢Ÿ† ¥¬­£§†®¦¥¨¡ž¡©†§£©œ§†œž¨¡ £†¢¥†¢«£†œ©£ Ÿ†¯«¥† ž¥£­†¥¢†«œ¨£†¢«£†œ¬¢«¥¦¡¢Ÿ†¢¥†°œ±£†œ†¤¡œ§†ž£ ¡­¡¥†¡†¢«£†®¦¥ ££ž¡©²†³´µ†¶†·¸¹º·»‘¼»½¼¾¼¿ÀŒ–Œ‡˜‰‰Š‹ŒŽ¡­†¤¬¦¢«£¦†ž£¤¡£ž†Á† µœ§²†µ¥ž£†Â£©­²†Ã£ ¢¡¥† ·¸¹·²
ª†¯«¡ «†­¢œ¢£­Ä†Å†¥¤¤¡ £¦†¥¤†œ†œ©£ Ÿ†¡ §¬ž£­†¥§Ÿ†¢«¥­£†®£¦­¥­†¯«¥†°œ±£ª†®œ¦¢¡ ¡®œ¢£†¡†°œ±¡©ª† ¥¦†¡†œŸ†¯œŸ†œ¢¢£°®¢†¢¥†¬­£†¢«£¡¦†¥¤¤¡ ¡œ§†®¥­¡¢¡¥†¢¥†¡¤§¬£ £†œ†ž£ ¡­¡¥†¡†¢«£†§¡ £­£ª†®£¦°¡¢ª†¥¦†£¢¡¢§£°£¢†¤¥¦†¬­£†®¦¥ ££ž¡©ª† ¥¦†¯«¥†£Æ£¦ ¡­£†œ¬¢«¥¦¡¢Ÿ†¥¦†Ç¬ž©£¢œ¦Ÿ† ¥¢¦¥§†¥¨£¦†¢«£†œ©£ Ÿ†¥¦†¥¤¤¡ £¦­†¯«¥†°œŸ†ž¥†­¥ª†œžÄ††³ Ȇ㦨£†¡†œ†£§£ ¢£ž†®¥­¡¢¡¥ª† ¡ §¬ž¡©†œ†¥¤¤¡ ¡œ§†œ®®¥¡¢£ž†¢¥†œ†£§£ ¢£ž†®¥­¡¢¡¥†ž¬£†¢¥†œ†¡¢£¦¡°†¨œ œ Ÿ†¥¦†œ†£§£ ¢¡¥†¥¢«£¦¯¡­£† œ £§£ž†Ç£ œ¬­£†¢«£† ¥¤¤¡ ¡œ§†¯œ­†¢«£†­¥§£† œž¡žœ¢£†¤¥¦†¢«£†®¥­¡¢¡¥É†³ÁȆ㦨£†œ­†œ†°£°Ç£¦†¥¤†œ†Ç¥œ¦ž†¥¦† ¥°°¡­­¡¥É†³¹È†Ã£¦¨£†œ­†¢«£† «¡£¤†£Æ£ ¬¢¡¨£†¥¤†œ† ­¢œ¢£†œ©£ Ÿª†¥¦† ¥¬¢Ÿª† ¡¢Ÿ†¥¦†ž¡­¢¦¡ ¢†¥¤†œŸ†±¡žÉ†¥¦††³¸È†Êœ¨£†ž£ ¡­¡¥†°œ±¡©†œ¬¢«¥¦¡¢Ÿ†¯¡¢«†¦£­®£ ¢†¢¥†¢«£†®¦¥ ££ž¡©†¡¨¥§¨¡©†œ† §¡ £­£ª†®£¦°¡¢ª†¥¦†¥¢«£¦†£¢¡¢§£°£¢†¤¥¦†¬­£†œž†¡­†œ§­¥†œ† œž¡žœ¢£†¤¥¦†£§£ ¢£ž†¥¤¤¡ £†¥¦†«œ­†Ç££†œ† œž¡žœ¢£†¤¥¦†£§£ ¢¡¨£†¥¤¤¡ £†¡† ¢«£† Á†°¥¢«­†®¦¡¥¦†¢¥†¢«£†®¦¥ ££ž¡©²†
Ë
Ë
ATTACHMENT 5


























 















 

!
"



#$


%



 &



'

%
(


)*+,-.

#!
/
0,&





1

2!,
-

%
#




3



4



'&

+ 
 









3


'
%
 5
#4



'''!
/
0





'
%



67
89:;9;:
<=>?@A
7?B
C=DE9F7
7?B
G>8?
G:D==
E?
H98C>?8=
E?
EI=
J9E7
G;7
FBEBD=
C?;ED9<BE9?;8
KGH=
E?
LFF9C=D8
<7
7?B
?D
7?BD
G:=;EM8N
GFE=D
EI=
HGE=
?F
89:;9;:
EI98
H98C>?8BD=
F?DKA
G;H
@9EI9;

K?;EI8
F?>>?@9;:
EI=
GOOD?PG>A
D=;=@G>A
?D
=QE=;89?;
?F
EI=
R:D==K=;ES

T
UVWV6X
JVWYTZX
[\]VW
^V\R_YX
LZ
^VW`[WX
[\]VW
YUV
_Rab
LZ
YUV
bYRYV
LZ
JR_TZLW\TR
YURY
YUV
ZLWVcLT\c
Tb
YW[V
R\]
JLWWVJYS

b9:;GEBD=d

]GE=
b9:;=Hd
^D9;E
\GK=d


Y9E>=d
J?KOG;7


&



 




%


e



f
ghiijklmnopoqrsitq uovkmwxksoykqi nhqihqhmzhqm{o|hs}mnn~ €‚mƒ„}m †
„

Agenda Item Staff Report
To: Honorable Mayor and Members of City Council
For the Meeting of July 28, 2026
From: Brad McKinney, City Manager
Prepared by: Genevieve Amaro, Management Aide
Subject: Appropriation of $911,788.00 from Fund 78 (Measure W); That total includes a Carry over of $518,829, from the Fiscal Year 2025-26 Approved Budget for Horsethief Canyon Water Quality Management Project from Fund 78 (Measure W); Award Construction Contract No. 2025-07 II – Horsethief Canyon Water Quality Management Improvements to Gentry General Engineering, Inc. for $753,378.00; Approve Overall Project Budget of $911,788.00 including Construction, Engineering Services, and Contingency; Award Professional Services Agreement to Geo-Advantec for $30,284.00; Award Professional Services Agreement to Kelsoe & Associates for $15,120.00. ____________________________________________________________________________

SUMMARY
The Horsethief Canyon Water Quality Management Improvements Project will improve water quality, drainage infrastructure, and operational functionality at the Horsethief Canyon Park with most improvements located within the Equestrian Center. The project includes installation of two underground clarifiers, new storm drains and sewer improvements, HDPE and PVC piping, catch basins, drainage swales, asphalt pavement restoration, wash rack improvements, electrical upgrades, stabilized decomposed granite pathways, handrails, landscaping, and associated site improvements. Construction has been phased to maintain access to the equestrian center and occupied horse stalls throughout the project while improving stormwater treatment and reducing long-term maintenance needs.

The project is funded through Measure W local return funds which are restricted for use on projects that improve storm water quality. Measure W funds must be spent within a five-year period on qualified projects.

RECOMMENDATION
Staff recommends that the City Council:

Award Construction Contract No. 2025-07 II – Horsethief Canyon Water Quality Management Improvements to Gentry General Engineering, Inc Page 2
For the Meeting of July 28, 2026
• Appropriate $911,788.00 from Fund 78 (Measure W) which includes a Carry over of $518,829, from the Fiscal Year 2025-26 Approved Budget for Horsethief Canyon Water Quality Management Project from Fund 78 (Measure W).
• Adopt the plans and specifications for Construction Contract No. 2025-07 II, Horsethief Canyon Water Quality Management Improvements.
• Award Construction Contract No. 2025-07 II to Gentry General Engineering, Inc., as the lowest responsive and responsible bidder, in the amount of $753,378.00, and authorize the City Manager to execute a Construction Agreement, in a form approved by the City Attorney.
• Award a Professional Services Agreement to Geo-Advantec, Inc. for geotechnical monitoring, materials testing, and inspection services in an amount not to exceed $30,284.00, and authorize the City Manager to execute the agreement in a form approved by the City Attorney.
• Award a Professional Services Agreement to Kelsoe & Associates, Inc. for construction staking and survey services in an amount not to exceed $15,120.00, and authorize the City Manager to execute the agreement in a form approved by the City Attorney. • Authorize a total project budget of $911,788.00 including construction, geotechnical testing, engineering survey and contingency
GOVERNMENT CODE §84308 APPLIES:
https://leginfo.legislature.ca.gov
Yes

FISCAL IMPACT
Construction Contract No. 2025-07 II, Horsethief Canyon Water Quality Management Improvements, is proposed to be funded through Measure W Local Return Funds (Fund 78) which are restricted to stormwater quality improvement projects. The Fiscal Year 2025-26 Capital Improvement Program budget allocated $550,000 toward this project of which $31,171 was used for design services. Approval of the construction contract, contingency and associated professional services agreements will increase the total project budget to $911,788.00. Staff recommends appropriating an additional $392,959.00 for a total 2026-27 budget of $911,788 from Measure W (Fund 78). The proposed improvements are an eligible use of Measure W funds because they provide stormwater treatment and water quality benefits. The additional costs would utilize reserves within fund 78 which would reduce the estimated ending fund balance for fiscal year 2026-27 to $933,201.

Description Amount
Construction Contract $753,378.00
Geo-Advantec – Geotechnical Monitoring & Materials
Testing $30,284.00
Kelsoe & Associates – Construction Survey $15,120.00
Construction Contingency (approximately 15%) $113,006.00 Total Project Budget $911,788.00

Award Construction Contract No. 2025-07 II – Horsethief Canyon Water Quality Management Improvements to Gentry General Engineering, Inc Page 3
For the Meeting of July 28, 2026
Description Amount
Total Project Budget $911,788.00
FY 2025-26 Budget Allocation ($518,829.00)
Additional Measure W (Fund 78) Appropriation in
addition to Carryover from FY 2025-2026 budget
$392,959.00
The project is funded through Measure W local return funds which are restricted for use on projects that improve storm water quality. Measure W funds must be spent within a five-year period on qualified projects.

BACKGROUND
The Equestrian Center, within Horsethief Canyon Park, is a City-owned recreational facility on the north side of the City. The drainage and utility infrastructure was originally constructed in the late 1990s. The proposed improvements will upgrade the existing drainage infrastructure and site amenities to current standards while reducing erosion that affects equestrian center and park operations during storm events. The improvements will also protect nearby streams by improving stormwater treatment, increasing infiltration, and supporting groundwater recharge.

The project includes asphalt paving, installation of underground clarifiers, sewer mains and associated connections, grading improvements to reduce erosion, stabilized decomposed granite pathways, canopies over two horse washing stations, curb and gutter improvements, storm drain infrastructure, and a stormwater infiltration system.

Measure W provides dedicated funding for stormwater capture, treatment, and water quality improvement projects. The City receives annual Local Return funding that is restricted to eligible projects that improve stormwater quality and reduce pollutants entering local waterways.

DISCUSSION/ANALYSIS
This project was originally bid in late April 2026. Staff previously recommended that the City Council reject the original bids to incorporate additional project controls into the construction schedule. The City Council approved that recommendation, and the project was subsequently readvertised for bid. The second round of bids were publicly opened on June 30, 2026.

Three bids were received:

Gentry General Engineering.......................................................................$753,378.00 Perry C. Thomas Construction, Inc. ...........................................................$1,011,880.00 CT&T Concrete Paving ..............................................................................$1,655,220.00 Staff reviewed the bid submitted by Gentry General Engineering and verified that the contractor possesses an active California Class A General Engineering Contractor License, maintains an active Department of Industrial Relations registration, submitted the required bid bond, acknowledged all addenda, and demonstrated successful completion of comparable public works projects. Based on this review, Staff determined that Gentry General Engineering is the lowest responsive and responsible bidder and recommends award of the construction contract.

Award Construction Contract No. 2025-07 II – Horsethief Canyon Water Quality Management Improvements to Gentry General Engineering, Inc Page 4
For the Meeting of July 28, 2026
In addition to the construction contract, Staff recommends approval of two professional services agreements necessary to support construction activities. Staff recommends approval of a Professional Services Agreement with Geo-Advantec, Inc. to provide geotechnical monitoring, materials testing, and special inspection services during construction to verify compliance with the approved plans, specifications, and applicable standards. The proposed agreement is in an amount not to exceed $30,284.00.

Staff also recommends approval of a Professional Services Agreement with Kelsoe & Associates, Inc. to provide construction surveying and staking services, including project control, field layout, and construction staking necessary to support project implementation. The proposed agreement is in an amount not to exceed $15,120.00.

Approval of these agreements will provide the professional services necessary to support construction and help ensure the project is completed in accordance with the approved plans and specifications. Construction has been phased to maintain access to occupied horse stalls, wash rack facilities, and ongoing equestrian operations while minimizing disruptions to facility users.

Upon completion, the project will improve stormwater quality, enhance drainage performance, increase public safety, support environmental compliance, and reduce long-term maintenance needs at Horsethief Canyon Park.

ALTERNATIVES
The City Council may choose not to award Construction Contract No. 2025-07 II. Delaying construction would postpone needed water quality improvements and likely increase future construction costs.

ENVIRONMENTAL REVIEW
The proposed project is Categorically Exempt under CEQA guidelines, Title 14, Article 19 Categorical Exemptions, Section 15302. Replacement or Reconstruction Class 2.

Respectfully submitted,
Genevieve Amaro
Management Aide
Attachments:

1. Construction Contract Agreement for CC2025-07 II Horsethief Canyon Water Quality Management Improvements

2. Geo-Advantec Proposal for Geotechnical Monitoring & Materials Testing

3. Kelsoe & Associates Proposal for Construction Survey

4. CC2025-07 II Plans & Specifications for CC2025-07 II Horsethief Canyon Water Quality Management Improvements

ATTACHMENT 1
CONSTRUCTION AGREEMENT NO. 2025-07 II
This construction agreement (“Agreement”), is made and effective as of ___________________, by and between the City of San Dimas ("City"), a municipal corporation, and Gentry General Engineering Inc. ("Contractor"), a corporation. City and Contractor may be referred to, sometimes individually or collectively, as “Party” or “Parties.”

RECITALS
WHEREAS, by resolution of the City Council of the City of San Dimas (the “City Council”), the Contractor was duly awarded CONSTRUCTION CONTRACT NO. 2025-07 II HORSETHIEF CANYON WATER QUALITY MANAGEMENT IMPROVEMENTS, for the work or improvement hereinafter mentioned; and
NOW, THEREFORE, in consideration of the mutual promises and covenants made by the Parties and contained herein and other consideration, the value and adequacy of which are hereby acknowledged, the parties agree as follows:

AGREEMENT
I. SCOPE OF WORK
Contractor shall perform within the time set forth herein of this Agreement and shall furnish all labor, materials, equipment, tools, utility services, and transportation and perform and complete all work required in connection with the construction of CONSTRUCTION CONTRACT NO. 2025- 07 II HORSETHIEF CANYON WATER QUALITY MANAGEMENT IMPROVEMENTS (“Project”) and as detailed in Exhibit A, “Project Schedule” attached hereto. The Project shall be performed and completed in a first class and workmanlike manner, with new and quality materials, under the supervision of and to the satisfaction of the City Engineer of the City of San Dimas (“City Engineer”).

Contractor promises and agrees that the Project shall be completed strictly in accordance with the Contract Documents, as defined below in Section XXIII, including but not limited to all plans and specifications, which are on file in the Office of the City Clerk.

The Contractor certifies and agrees that it is fully familiar with all of the terms, conditions and obligations of Contract Documents, the location of the job site, and the conditions under which the Project is to be performed based upon its investigation of all such matters.

The Contractor shall supervise and direct the work to complete the Project, using its best skill and attention, and shall be solely responsible for all construction means, methods, techniques, sequences and procedures. Unless otherwise noted, the Contractor shall be responsible for coordinating all portions of the Project, and the Contractor shall provide and pay for all labor, services, materials, installation, cartage, equipment, tools, construction equipment and machinery, water, heat, utilities, transportation, storage, taxes, insurance, and other facilities and services necessary for the proper execution of the work to complete the Project. The Contractor further promises and agrees that the materials used in the Project shall comply with the Contract Documents and be to the satisfaction of the City Engineer, and that the Contractor will timely complete the Project, and turn the Project over to the City, complete and ready for use, and

6/22 - 2 - Construction Agreement
discharged from all claims or demands on any and all materials, equipment and labor used or to be used in the Project.

As soon as possible under the provisions of this Agreement, the Contractor shall backfill all excavations and restore to usefulness, all improvements existing prior to the start of the work to complete the Project.

The Contractor also agrees that it shall be responsible for the acts and omissions of all of its employees and subcontractors, their agents and employees, and for all other persons performing any of the Project under a contract with the Contractor.

By entering into this Agreement, Contractor acknowledges there may be other contractors on the site whose work will be coordinated with that of its own. Contractor expressly warrants and agrees it will cooperate with other contractors and will do nothing to delay, hinder, or interfere with the work of other separate contractors, the City, or the utilities. Contractor also expressly agrees that, in the event its work is hindered, delayed, interfered with, or otherwise affected by a separate contractor, its sole remedy will be direct action against the separate contractor. To the extent allowed by law, the Contractor will have no remedy, and hereby expressly waives any remedy against the City, on account of delay, hindrance, interference, or other events caused by a separate contractor.

II. TIME FOR PROJECT COMPLETION
All of Contractor’s work on the Project shall be completed within durations established for the individual activities as set forth in the Contract Documents. All work shall commence five (5) calendar days after receiving a written Notice to Proceed from the City. Contractor shall refer to the invitations for bids, and Project plans and specifications, all of which, as set forth below, are incorporated herein by reference, for contractual obligations regarding individual activity durations. The aggregate sum total work of all bid items comprises the entire Project and shall be commenced and completed in conformance with the Project Schedule. The entire Project shall be completed within 75 working days.

The working hours are Monday thru Friday, with the exception of City Holidays, 7:00 a.m. to 5:00 p.m.

III. AGREEMENT SUM
City shall pay to Contractor for the performance of this Agreement, subject to any additions and deductions provided in the Contract Documents, the sum of Seven Hundred Fifty Three Thousand Three Hundred Seventy Eight Dollars and No Cents (“Agreement Sum”).

Compensation paid to Contractor for the performance of this Agreement shall be consistent with the “Bid Schedule” as set forth in Exhibit B and incorporated herein by reference. All costs of prosecuting the work under this Agreement for the completion of the Project shall be included in the Contractor’s bid.

IV. PROGRESS PAYMENTS
Based upon Invoice submitted to the City by the Contractor and approval issued by the Director of Public Works, the City shall make progress payments on account of the Agreement Sum to the Contractor as provided in the Contract Documents
This Agreement is subject to the provisions of Article 1.7 (commencing at Section 20104.50) of Division 2, Part 3 of the Public Contract Code regarding prompt payment of contractors by local

6/22 - 3 - Construction Agreement
governments. Article 1.7 mandates certain procedures for the payment of undisputed and properly submitted payment requests within 30 days after receipt, for the review of payment requests, for notice to Contractor of improper payment requests, and provides for the payment of interest on progress payment requests which are not timely made in accordance with that Article. This Agreement hereby incorporates the provisions of Article 1.7 as though fully set forth herein.

V. RETENTION OF SECURITIES
Public Contract Code section 22300 permits the substitution of securities for any monies withheld by a public agency to ensure performance under a contract, at the request and expense of the Contractor. Contractor shall notify City in writing of any election made under Public Contracts Code section 22300.

VI. WARRANTY
The Contractor warrants that all of the work pursuant to this Agreement shall be done in a first class, workmanlike manner and in accordance with Contract Documents, with new and quality materials and warrants all work performed to complete the Project and materials against defect or deviation (the “Defect”), both in the material or the workmanship, for a period of one (1) year from its completion of the Project, unless stated otherwise in the Contract Documents. If a Defect in the Project is latent, hidden or not readily observable, the Contractor's warranty shall be extended for one (1) year from the date of discovery of the Defect. The Contractor will within a reasonable time after written notice of a Defect, remedy and repair the Defect and any related damage resulting from the Defect (without any expense to the City).

VII. INDEMNIFICATION
Contractor shall indemnify, defend with legal counsel approved by City, and hold harmless City, its officers, officials, employees, and volunteers (“Indemnified Parties”) from and against all claims for and actual liabilities, losses, damages, expenses, costs (including without limitation reasonable attorney’s fees, expert fees, and all other costs and fees of litigation) of every nature relating to, arising out of or in connection with Contractor’s, its officers, agents, employees, or subcontractors (or any agency or individual that Contractor shall bear the legal liability thereof) negligence, recklessness or willful misconduct in the performance of work on and/or connected with the Project or its failure to comply with any of its obligations contained in this Agreement, except such loss or damage which is caused by the sole or active negligence or willful misconduct of the Indemnified Parties. Should conflict of interest principles preclude a single attorney from representing both City and Contractor, or should City otherwise find Contractor’s attorney unacceptable, then Contractor shall reimburse the City its costs of defense, including without limitation reasonable attorney’s fees, expert fees, and all other costs and fees of litigation. The Contractor shall promptly pay any final judgment rendered against the Indemnified Parties with respect to claims determined by a trier of fact to have been the result of the Contractor’s negligent, reckless, or wrongful act, omission or performance. It is expressly understood and agreed that the foregoing provisions are intended to be as broad and inclusive as is permitted by the law of the State of California and will survive termination of this Agreement.

Contractor’s obligations under this section apply regardless of whether or not such claim, charge, damage, demand, action, proceeding, loss, stop notice, cost, expense, judgment, civil fine or penalty, or liability was caused in part or contributed to by Indemnified Parties. However, without affecting the rights of Indemnified Parties under any provision of this Agreement, Contractor shall not be required to indemnify and hold harmless Indemnified Parties for liability attributable to the sole or active negligence or willful misconduct of Indemnified Parties, provided such sole or active negligence or willful misconduct is determined by agreement between the parties or by the

6/22 - 4 - Construction Agreement
findings of a court of competent jurisdiction. In instances where Indemnified Parties are shown to have been solely or actively negligent or to have acted with willful misconduct and where Indemnified Parties’ sole or active negligence or willful misconduct accounts for only a percentage of the liability involved, the obligation of Contractor will be for that entire portion or percentage of liability not attributable to the sole or active negligence or willful misconduct of Indemnified Parties.

VIII. PREVAILING WAGES
A. Wage rates for this Project shall be in accordance with the “General Wage Determination Made by the Director of Industrial Relations Pursuant To California Labor Code, Part 7, Chapter 1, Article 2, Sections 1770, 1773, and 1773.1", for Los Angeles County. The prevailing rate of per diem wages are on file at the City of San Dimas, Public Works Department, 245 E Bonita Ave, San Dimas CA 91773, and are available to any interested party on request. The Contractor is required to post at the job site the prevailing rate of per diem wages as determined by the Director of the Department of Industrial Relations and other notices prescribed by regulation. Wage rates shall conform with those posted at the Project site.

B. The following Labor Code sections are hereby referenced and made a part of this Agreement:

1. Section 1774 – Payment of General Prevailing Rate

2. Section 1775 - Penalty for Failure to Comply with Prevailing Wage Rates

3. Section 1777.4 - Apprenticeship Requirements

4. Section 1777.5 - Apprenticeship Requirements

5. Section 1813 - Penalty for Failure to Pay Overtime

6. Sections 1810 and 1811 - Working Hour Restrictions

7. Section 1776 - Payroll Records

8. Section 1773.8 - Travel and Subsistence Pay
IX. FURNISHING RECORDS TO CITY
The Contractor also agrees to furnish, if and when required, payroll affidavits, receipts, vouchers, release for claims for labor, material and subcontractors performing the work required to complete the Project under the Agreement, all in a form satisfactory to the City, and the Contractor also agrees that no payment shall be made, except at City's option, unless any or all of the requested documents have been furnished to the City.

X. RECORD AUDIT
In accordance with Government Code section 8546.7, records of both the City and the Contractor shall be subject to examination and audit by the Auditor General for a period of three (3) years after final payment.

XI. CERTIFICATIONS
Not Applicable
XII. FINAL PAYMENT
Final payment, constituting the entire unpaid balance of the Agreement Sum, shall be paid by City to Contractor no sooner than thirty-five (35) days after a Notice of Completion has been recorded, unless otherwise stipulated in the Notice of Completion, provided the work has then been

6/22 - 5 - Construction Agreement
completed, the Agreement fully performed, and a final payment authorization has been issued by the Director of Public Works
XIII. CONTRACTOR'S FAILURE TO PROCURE COMPLETION OF PROJECT The Contractor shall furnish all materials, tools, equipment and labor in the necessary quantity and quantity, and shall diligently prosecute the work contemplated by this Agreement to completion in a workmanlike manner.

In the event Contractor fails to furnish tools, equipment, or labor in the necessary quantity or quality, or fails to prosecute the work or any part thereof contemplated by this Agreement in a diligent and workmanlike manner, and if the Contractor for a period of three (3) calendar days after receipt of written demand from City or its designated representative to do so, fails to furnish tools, equipment, or labor in the necessary quantity or quality, or to prosecute its work and all parts thereof in a diligent and workmanlike manner, then the City may exclude the Contractor from the premises, or any portion thereof, and take possession of said premises or any portion thereof, together with all material and equipment thereon, and may complete the work contemplated by this Agreement or any portion of said work, either by furnishing the tools, equipment, labor or material necessary, or by letting the unfinished portion of said work, or the portion taken over by the City to another contractor or by a combination of such methods. In any event, the procuring of the completion of said work, or the portion thereof taken over by the City, shall be a charge against the Contractor, and may be deducted from any money due or becoming due to Contractor from City, or Contractor shall pay City the amount of said charge, or the portion thereof unsatisfied. The sureties, provided for under this Agreement, shall become liable for payment should Contractor fail to pay in full any said cost incurred by the City.

XIV. INSURANCE
Prior to the beginning of and throughout the duration of the Project, Contractor and its subcontractors shall maintain insurance in conformance with the requirements set forth below.

Contractor will use existing coverage to comply with these requirements. If that existing coverage does not meet the requirements set forth herein, Contractor agrees to amend, supplement or endorse the existing coverage to do so or to procure insurance coverage to satisfy the requirements.

Contractor acknowledges that the insurance coverage and policy limits set forth in this section constitute the minimum amount of coverage required. Any insurance proceeds available to Contractor or its subcontractors in excess of the limits and coverage identified in this Agreement and which is applicable to a given loss, claim or demand, will be equally available to City.

Without limiting Contractor’s indemnification of City and/or the Indemnified Parties and prior to commencement of the Project, Contractor shall obtain, provide, and maintain at its own expense during the term of this Agreement, policies of insurance of the type and amounts described below and in a form satisfactory to City.

General liability insurance. Contractor shall maintain commercial general liability insurance with coverage at least as broad as Insurance Services Office form CG 00 01, in an amount not less than $1,000,000 per occurrence, $2,000,000 general aggregate, for bodily injury, personal injury, and property damage, and a $2,000,000 completed operations aggregate. The policy must include contractual liability that has not been amended. Any endorsement restricting standard ISO “insured contract” language will not be accepted.

6/22 - 6 - Construction Agreement
Automobile liability insurance. Contractor shall maintain automobile insurance at least as broad as Insurance Services Office form CA 00 01 covering bodily injury and property damage for all activities of the Contractor arising out of or in connection with work to be performed under this Agreement, including coverage for any owned, hired, non-owned, or rented vehicles, in an amount not less than $1,000,000 combined single limit for each accident.

Workers’ compensation insurance. Contractor shall maintain Workers’ Compensation Insurance (Statutory Limits) and Employer’s Liability Insurance (with limits of at least $1,000,000) for Contractor ’s employees in accordance with the laws of the State of California, Section 3700 of the Labor Code In addition, Contractor shall require each subcontractor to similarly maintain Workers’ Compensation Insurance and Employer’s Liability Insurance in accordance with the laws of the State of California, Section 3700 for all of the subcontractor’s employees.

Contractor shall submit to City, along with the certificate of insurance, a Waiver of Subrogation endorsement in favor of City, its officers, agents, employees, and volunteers.

Other provisions or requirements
Proof of insurance. Contractor shall provide certificates of insurance and required endorsements to City as evidence of the insurance coverage required herein. Insurance certificates and endorsements must be approved by City’s Risk Manager prior to commencement of performance.

Current certification of insurance shall be kept on file with City for the contract period and any additional length of time required thereafter. City reserves the right to require complete, certified copies of all required insurance policies, at any time and Contractor agrees to provide the same.

Duration of coverage. Contractor shall procure and maintain for the contract period, and any additional length of time required thereafter, insurance against claims for injuries to persons or damages to property, or financial loss which may arise from or in connection with the performance of the work hereunder by Contractor, its agents, representatives, employees, subcontractors or subconsultants. Contractor must maintain general liability and umbrella or excess liability insurance for as long as there is a statutory exposure to completed operations claims. City and its officers, officials, employees, and agents shall continue as additional insureds under such policies.

Primary/noncontributing. Coverage provided by Contractor shall be primary and any insurance or self-insurance procured or maintained by City shall not be required to contribute with it. The limits of insurance required herein may be satisfied by a combination of primary and umbrella or excess insurance. Any umbrella or excess insurance shall contain or be endorsed to contain a provision that such coverage shall also apply on a primary and non-contributory basis for the benefit of City before the City’s own insurance or self- insurance shall be called upon to protect it as a named insured.

City’s rights of enforcement. In the event any policy of insurance required under this Agreement does not comply with these requirements or is canceled and not replaced, City has the right but not the duty to obtain the insurance it deems necessary, and any premium paid by City will be promptly reimbursed by Contractor or City will withhold amounts sufficient to pay premium from Contractor payments. In the alternative, City may cancel this Agreement.

Acceptable insurers. All insurance policies shall be issued by an insurance company currently authorized by the Insurance Commissioner to transact business of insurance or is on the List of Approved Surplus Line Insurers in the State of California, with an assigned policyholders’ Rating of A- (or higher) and Financial Size Category Class VII (or larger) in accordance with the latest edition of Best’s Key Rating Guide, unless otherwise approved by the City’s Risk Manager.

6/22 - 7 - Construction Agreement
Waiver of subrogation. All insurance coverage maintained or procured pursuant to this agreement shall be endorsed to waive subrogation against City, its elected or appointed officers, agents, officials, employees, and volunteers or shall specifically allow Contractor or others providing insurance evidence in compliance with these specifications to waive their right of recovery prior to a loss. Contractor hereby waives its own right of recovery against City and shall require similar written express waivers and insurance clauses from each of its subconsultants.

Enforcement of contract provisions (non estoppel). Contractor acknowledges and agrees that any actual or alleged failure on the part of the City to inform Contractor of non-compliance with any requirement imposes no additional obligations on the City nor does it waive any rights hereunder.

Requirements not limiting. Requirements of specific coverage features or limits contained in this Section are not intended as a limitation on coverage, limits or other requirements, or a waiver of any coverage normally provided by any insurance. Specific reference to a given coverage feature is for purposes of clarification only as it pertains to a given issue and is not intended by any party or insured to be all inclusive, or to the exclusion of other coverage, or a waiver of any type. If the Contractor maintains higher limits than the minimums shown above, the City requires and shall be entitled to coverage for the higher limits maintained by the Contractor. Any available insurance proceeds in excess of the specified minimum limits of insurance and coverage shall be available to the City.

Notice of cancellation. Contractor agrees to oblige its insurance agent or broker and insurers to provide the City with a thirty (30) day notice of cancellation (except for nonpayment for which a ten (10) day notice is required) or nonrenewal of coverage for each required coverage. If any of the Contractor’s insurers are unwilling t o provide such notice, then Contractor shall have the responsibility of notifying the City immediately in the event of Contractor’s failure to renew any of the required insurance coverages, or insurer’s cancellation or non-renewal.

Additional insured status. General liability, automobile liability, and umbrella/excess liability insurance policies shall provide or be endorsed to provide that City and its officers, officials, employees, agents, and volunteers shall be additional insureds under such policies.

XV. CONTRACTOR'S LICENSE
Contractor must possess at the time of commencing work and throughout the Project duration, a valid Contractor's License, issued by the State of California, which is current and in good standing.

UUContractor’s State License No. is 974279, Class A.UU Contractor shall ensure that any subcontractor working on the Project possesses at the time of commencing work and throughout the Project duration, a valid Contractor's License, issued by the State of California, which is current and in good standing.

XVI. REGISTRATION REQUIREMENTS [Applicable to Public Works projects] Pursuant to Section 1771.1(a) of the Labor Code:
“A contractor or subcontractor shall not be qualified to bid on, be listed in a bid proposal, subject to the requirements of Section 4104 of the Public Contract Code, or engage in the performance of any contract for public work, as defined in this chapter, unless currently registered and qualified to perform public work pursuant to Section 1725.5. It is not a violation of this section for an unregistered contractor to submit a bid that is authorized by Section 7029.1 of the Business and Professions Code or by Section 10164 or 20103.5 of the Public Contract Code, provided the

6/22 - 8 - Construction Agreement
contractor is registered to perform public work pursuant to Section 1725.5 at the time the contract is awarded.”
Contractor must be registered with the Department of Industrial Relations (DIR) of the State of California in order to be eligible to work on public works projects. Contractor must ensure registration with the DIR is active and in good standing.

No contractor or subcontractor may be listed on a bid proposal for a public works project (submitted on or after March 1, 2015) unless registered with the Department of Industrial Relations pursuant to Labor Code section 1725.5 [with limited exceptions from this requirement for bid purposes only under Labor Code section 1771.1(a)].

No contractor or subcontractor may be awarded a contract for public work on a public works project (awarded on or after April 1, 2015) unless registered with the Department of Industrial Relations pursuant to Labor Code section 1725.5.

This project is subject to compliance monitoring and enforcement by the Department of Industrial Relations.

The Contractor is not subject to public works requirements (including registration with the DIR) if the public works project is under $1,000, unless the City knows that the same Contractor will be awarded total project costs in excess of $1,000 for a given year.

XVII. [RESERVED]
XVIII. COMPLIANCE WITH STATUTES AND REGULATIONS
Contractor will be knowledgeable of and shall comply with all applicable federal, state, local, county, and city statutes, rules, regulations, ordinances, and orders relating to the manner of doing the work under the Agreement or to the materials supplied therein.

XIX. PROVISIONS REQUIRED BY LAW
Each and every provision of law and clause required by law to be inserted in this Agreement shall be deemed to be inserted herein and the Agreement shall be read and enforced as though it were included herein, and if through mistake or otherwise any such provision is not inserted, or is not currently inserted, then upon application of either party, the Agreement shall forthwith be physically amended to make such insertion or correction.

XX. SUBSURFACE HAZARDOUS MATERIALS
A. In the event trenches or other excavations extend deeper than four (4) feet below the surface, Contractor shall promptly, and before the following conditions are disturbed, notify City in writing of any:

1. Material that Contractor believes may be hazardous waste, as defined in Section 25117 of the Health and Safety Code, that is required to be removed to a Class I, Class II, or Class III disposal site in accordance with the provisions of existing law.

2. Subsurface or latent physical conditions at the site differing from those indicated.

3. Unknown physical conditions at the site of any unusual nature, different materially from those ordinarily encountered and generally recognized as inherent in the Project or the character provided for in the Agreement.

6/22 - 9 - Construction Agreement
B. Upon receipt of said notification, City will investigate the conditions, and if it finds that the conditions do materially so differ, or do involve hazardous waste, and cause a decrease or increase in the Contractor's cost of or the time required for performance of any part of the Project, the City will issue a change order under the procedures described in the Contract Documents.

C. In the event a dispute arises between the City and the Contractor whether the conditions materially differ, or involve hazardous waste or cause a decrease or increase in the Contractor's cost of or time required for performance of any part of the Project, the Contractor shall not be excused from any scheduled completion date provided for by the Agreement, but shall proceed with all work to be performed under the Agreement.

Contractor shall retain any and all rights provided either by agreement or by law which pertain to the resolution of disputes and protests between the contracting parties.

XXI. LIQUIDATED DAMAGES
Pursuant to Government Code section 53069.85, if work is not completed within durations established for the individual activities as set forth in the Project Schedule and per items in SP-8, it is understood, acknowledged, and agreed City will suffer damage. It is therefore agreed that Contractor shall pay to City the sum of $500.00 for each and every calendar day of delay beyond any completion schedule, construction schedule, or Project milestones established in or pursuant to the Project Schedule, or beyond the time indicated in the Project Schedule for any individual Project activity as listed in SP-8 of the project specifications.

Contractor expressly understands, acknowledges, and agrees that such liquidated damages can and shall be imposed if the Contractor does not meet each and every aspect of any activity schedule, completion schedule, construction schedule, or Project milestones established in or pursuant to the Project Schedule. If the City accepts work or makes any payment under this Agreement after a default by reason of delays, the acceptance of such work and/or payment(s) shall in no respect constitute a waiver or modification of any provisions regarding a completion schedule, the Project Schedule or the accrual of liquidated damages. In the event the same is not paid, Contractor further agrees that City may deduct the amount thereof from any money due or that may become due the Contractor under the Agreement. This article does not exclude recovery of damages under provisions of the Agreement, and is expressly in addition to the City’s ability to seek other damages.

Contractor is to refer to Contract Documents for duration of individual activities. Liquidated damages may be assessed if any individual activity duration exceeds the time indicated for that activity in the Contract Documents, unless the time for such activity has been extended by mutual agreement of the parties and confirmed in writing.

XXII. CLAIM PROCEDURES UNDER PUBLIC CONTRACT CODE SECTION 9204 Contractor shall comply with the procedure set forth in Public Contracts Code section 9204 for any claim, as that term is defined therein, for one or more of the following: 1) a time extension, including, without limitation, for relief from damages or penalties for delay; 2) payment of money or damages arising from work done pursuant to this Agreement; and/or 3) payment of an amount disputed by the City under this Agreement.

XXIII. COMPONENT PARTS OF THE AGREEMENT

6/22 - 10 - Construction Agreement
This Agreement entered into consists of the following documents (collectively, the “Contract Documents”), all of which are component parts of the Agreement as if herein set out in full or attached hereto:

Notice Inviting Bids Bid Bond
Scope of Work Summary Information Required of Bidder
Information for Bidders Contract Agreement
Bid Form Certificate Regarding Workers
Compensation
Non-Collusion Affidavit Drug-free Workplace Certification Site Visit Certification Project Plans and Specifications Faithful Performance Bond Addenda
Labor and Materials Payment Bond Addendums
General Conditions Change Orders
Supplementary General Conditions Shop Drawing Transmittals Project Construction Schedule Special Conditions
Contractor’s Certificate Regarding NonAsbestos Containing MaterialsProposed Subcontractors Standard Specifications Standard Plans
Drawings
Those documents listed in Section 1-2 of the “Greenbook” Standard Specifications for Public Works Construction combined with all of the above-named documents are included as Contract Documents and are intended to be complementary. Work required any of the above-named contract documents and not by others shall be done as if required by all.

XXIV. BONDS
The Contractor agrees to furnish bonds guaranteeing the faithful performance of this Agreement and guaranteeing payment for all labor and materials used under the Agreement, as required by the laws of the State of California. The Faithful Performance Bond shall be for an amount not less than 100% of the amount of this Contract and shall be conditioned on full and complete performance of the Agreement, guaranteeing the work against faulty workmanship or materials for a period of one year after completion and acceptance. The Labor and Materials Payment Bond shall be in an amount of not less than 100% of the amount of the Agreement, and shall be conditioned upon full payment of all labor and materials entering into or incidental to the work covered by the Agreement.

The surety on the required bonds shall be a surety company of financial resources satisfactory to the City Council and authorized to do business in the State of California.

The Faithful Performance Bond and Labor and Materials Payment Bond are attached hereto as Exhibit C.

XXV. PROHIBITION AGAINST ASSIGNMENT
The Contractor may upon reasonable advance Notice to the City assign its rights to receive payment under this Agreement, provided the Contractor also provides to the City the consent of the surety to such assignment. The Contractor may not assign or delegate its duties under this Agreement, without the prior written consent of the City, which the City may not unreasonably withhold or delay. For purposes of this Agreement, assignment shall include any change of

6/22 - 11 - Construction Agreement
control, whether by merger, acquisition or otherwise, of Contractor or any of Contractor's corporate parents. Any assignment in violation of the assignment provisions herein shall be ineffective to relieve Contractor of its responsibility to complete the Project. Should the City consent to any such assignment by the Contractor, the consent shall not constitute a waiver of any other restrictions of assignment under the Agreement and the same restrictions on assignment shall apply to each successive assignment, if any.

XXVI. CALIFORNIA LAW
This Agreement shall be interpreted, construed and governed both as to validity and to performance of the parties in accordance with the laws of the State of California. Legal actions concerning any dispute, claim or matter arising out of or in relation to this Agreement shall be instituted in the Superior Court of the County of Los Angeles, State of California, or any other appropriate court in such county, and Contractor covenants and agrees to submit to the personal jurisdiction of such court in the event of such action.

XXVII. CORPORATE AUTHORITY
The persons executing this Agreement on behalf of the parties hereto warrant that (i) such party is duly organized and existing, (ii) they are duly authorized to execute and deliver this Agreement on behalf of said party, (iii) by so executing this Agreement, such party is formally bound to the provisions of this Agreement, and (iv) the entering into this Agreement does not violate any provision of any other Agreement to which said party is bound. This Agreement shall be binding upon the heirs, executors, administrators, successors and assigns of the parties.

XXVIII. ENTIRE AGREEMENT
This Agreement constitutes the entire agreement of the parties. No other agreements or contracts, whether oral or written, pertaining to the work to be performed, exists between the parties. This Agreement can be modified only by an amendment in writing, signed by both parties. [SIGNATURES ON FOLLOWING PAGE]

6/22 - 11 - Construction Agreement

6/22 - 12 - Construction Agreement
IN WITNESS WHEREOF, the parties hereto have executed this Agreement on the date and year first-above written.

CITY:

CITY OF SAN DIMAS, CALIFORNIA
Dated ________________, 20___ By: _____________________________ City Manager
ATTEST:
________________________________
City Clerk
APPROVED AS TO FORM::
_______________________________
City Attorney
CONTRACTOR**:

Dated ________________, 20___ ________________________________ By:

Authorized Representative
Title
By:

Authorized Representative
Title
Address:

Phone:

Fax:

Email:
**Two corporate officer signatures required when Contractor is a corporation, with one signature required from each of the following groups: 1) Chairman of the Board, President or any Vice President; and 2) Secretary, any Assistant Secretary, Chief Financial Officer or any Assistant Treasurer. CONTRACTOR’S SIGNATURES SHALL BE DULY NOTARIZED, AND APPROPRIATE

6/22 - 13 - Construction Agreement

ATTESTATIONS SHALL BE INCLUDED AS MAY BE REQUIRED BY THE BYLAWS, ARTICLES OF INCORPORATION, OR OTHER RULES OR REGULATIONS APPLICABLE TO CONTRACTOR’S BUSINESS ENTITY.

6/22 - 13 - Construction Agreement

6/22 - 14 - Construction Agreement

CONSTRUCTION AGREEMENT NO.

NOTARY ACKNOWLEDGMENT
A notary public officer completing this certificate verifies only the identity of the individual who signed the document, to which this certificate is attached, and not the truthfulness, accuracy, or validity of that document.

STATE OF _______________________ )
)
COUNTY OF _____________________ )
On _____________________________, before me, _________________________________, Notary Public, personally appeared __________________________________________, who proved to me on the basis of satisfactory evidence to be the person whose name is subscribed to the within instrument and acknowledged to me that he/she executed the same in his/her authorized capacity, and that by his/her signature on the instrument the person, or the entity upon behalf of which the person acted, executed the instrument.

I certify under PENALTY OF PERJURY under the laws of the State of California that the foregoing paragraph is true and correct.

WITNESS my hand and official seal.

Signature: (Seal)

6/22 - 14 - Construction Agreement

6/22 - 15 - Construction Agreement

EXHIBIT A

PROJECT SCHEDULE
See Project Bid Specifications for
Construction Contract No. 2025-07 II Horsethief Canyon Water Quality Management Improvements

6/22 - 15 - Construction Agreement

6/22 - 16 - Construction Agreement

EXHIBIT B

BID SCHEDULE
Upon the completion of the Project both to the City Engineer’s satisfaction and in compliance with this Agreement, the City will pay, and the Contractor agrees to accept as full and final compensation for the Project, the total of all bid items, adjusted for variation of quantities at the unit prices for the materials actually used or furnished for the Project, as set forth below:

UUBASE BID
ITE
M

QTY UNIT DESCRIPTION OF BASE BID ITEM BID ITEM
TOTAL
1 1 LS
Mobilization, and NPDES/SWPPP
Requirements complete in place for the lump
sum price of: ($ 59,560.00 ) per LS
$59,560.00
2 1 LS Traffic Control for the lump sum price of:
($ 7,840.00 ) per LS $7,840.00
3 1 LS
General Earthwork and Unclassified
Excavation for the unit price of:
($ 24,141.00 ) per LS
$24,141.00
4 3 EA Remove Existing Gate/Post for the unit price of:
($ 1,485.00 ) per EA $4,455.00
5 1 EA
Remove Existing Palm Tree Stump for the
unit price of
($ 2,675.00 ) per EA
$2,675.00
6 1 EA Remove Existing Drain Hose for the unit price
of: ($ 1,114.00 ) per EA $1,114.00
7 290 SF
Remove Existing Driveway Approach for the unit
price of:
($ 20.00 ) per SF
$5,800.00
8 1 EA Remove Existing Grated Inlet for the unit price
of: ($ 4,814.00 ) per EA $4,814.00
9 1 EA
Remove Existing Restroom
Building/Concrete Pad and Cap Existing
Sewer Outlet for the unit price of:
($ 21,046.00 ) per EA
$21,046.00
10 1 LS
Remove Existing Fence and Reconstruct
Corral Fence to Clear Apron for the lump sum
of:
($ 17,506.00 ) per LS
$17,500.00
11 2 EA Relocate Existing Sign for the unit price of:
($ 2,227.00 ) per EA $4,454.00

6/22 - 17 - Construction Agreement
ITE
M

QTY UNIT DESCRIPTION OF BASE BID ITEM BID ITEM
TOTAL
12 1 EA
Adjust Existing Water Meter Box to Grade for
the unit price of:
($ 901.00 ) per EA
$901.00
13 1 EA
Tie into Existing 4” Sewer and Construct
Sewer Cleanout per SPPWC 204-3 for the unit
price of:
($ 3,325.00 ) per EA
$3,325.00
14 13 EA
Plant 24” Box Coast Live Oak Tree for the
unit price of:
($ 2,644.00 ) per EA
$34,372.00
15 3 EA
Construct Sewer Cleanout per SPPWC 204-3
for the unit price of:
($ 3,617.00 ) per EA
$10,851.00
16 1 LS
Construct Graded Swale at 2.0% Min
Around Shelter for the lump sum price of:
($ 4,024.00 ) per LS
$4,024.00
17 112 LF
Construct 42” High Metal Hand Railings
per
S.P.P.W.C. 606-3 for the unit price of:
($ 210.00 ) per LF
$23,520.00
18 2 EA
Construct Jensen Precast 750 Gallon Clarifier
for the unit price of:
($ 23,265.00 ) per EA
$46,530.00
19 610 LF Construct 4” PVC SDR35 Pipe for the unit price of: ($ 98.00 ) per LF $59,780.00
20 80 LF
Construct 2’ Wide Downdrain for the unit price
of:
($ 177.00 ) per LF
$14,160.00
21 3 EA
Construct Jensen Precast 18” x 18” Catch Basin
(Traffic Rated) for the unit price of:
($ 3,057.00 ) per EA
$9,171.00
22 55 LF
Construct 6" PVC SDR35 Pipe for the unit price
of:
($ 160.00 ) per LF
$8,800.00
23 600 TON
Construct 4” Thick B-PG 64-10 over Compacted
Native with Thickened Edge for the unit price of:
($ 222.00 ) per TON
$133,200.00
24 145 LF
Construct 8” Curb and Gutter Per S.P.P.W.C.
120- 3 for the unit price of:
($ 72.00 ) per LF
$10,440.00
25 6745 SF
Construct 4” Thick Stabilized DG Path
(STALOK) for the unit price of:
($ 4.00 ) per SF
$26,980.00

6/22 - 18 - Construction Agreement
ITE
M

QTY UNIT DESCRIPTION OF BASE BID ITEM BID ITEM
TOTAL
26 1 EA
Construct 4’ Wide Parkway Drain Per
S.P.P.W.C. 151-3 (Inlet Type 2) for the unit price
of:
($ 8,796.00 ) per EA
$8,796.00
27 1 EA Construct 4” Concrete Apron for the unit price of:
($ 5,182.00 ) per EA $5,182.00
28 1 EA
Connect to Existing Cleanout for the unit price
of:
($ 3,975.00 ) per EA
$3,975.00
29 290 SF
Construct Driveway Approach Per S.P.P.W.C.
110-2 for the unit price of:
($ 31.00 ) per SF
$8,990.00
30 300 LF
Sawcut and Remove Existing AC Pavement and
Construct Full Depth AC for the unit price of:
($ 112.00 ) per LF
$33,600.00
31 255 SF
Construct P.C.C. Alley Intersection
Per
S.P.P.W.C. 130-3 for the unit price of:
($ 33.00 ) per SF
$8,415.00
32 105 LF Construct 18” HDPE Pipe for the unit price of:
($ 151.00 ) per LF $15,855.00
33 1 EA
Construct Curb Opening Catch Basin with
3 Grates Per S.P.P.W.C. 302-4 for the unit price
of:
($ 8,404.00 ) per EA
$8,404.00
34 2 EA
Construct “Rarin to Go” 12’ H x 12’D x 24’L
Free- Standing Shelter for the unit price of:
($ 11,900.00 ) per EA
$23,800.00
35 1 EA
Construct 6’ x 41’ Contech Perforated CMP with
24” CMP Riser and 12” Stubs for the unit price
of:
($ 21,700.00 ) per EA
$21,700.00
36 130 LF Construct 12” HDPE Pipe for the unit price of:
($ 84.00 ) per LF $10,920.00
37 1 EA
Connect 12” HDPE to Existing Culvert
Per
S.P.P.W.C. 335-2, Case 3 for the unit price of:
($ 3,325.00 ) per EA
$3,325.00
38 1 EA
Construct Local Depression Per S.P.P.W.C.
313- 4, Case D for the unit price of:
($ 4,398.00 ) per EA
$4,398.00
39 550 SF
Construct Trench Repavement for the unit
price of:
($ 15.00 ) per SF
$8,250.00

6/22 - 19 - Construction Agreement
ITE
M

QTY UNIT DESCRIPTION OF BASE BID ITEM BID ITEM
TOTAL
40 290 LF Construct 4’ Wide V-Ditch for the unit price of:
($ 47.00 ) per LF $13,630.00
41 25 SF
Construct 5’ x 5’ Grouted Rip Rap Pad for the
unit price of:
($ 176.00 ) per SF
$4,400.00
42 1 LS
Remove Existing Electrical Panel in
Restroom Building for the lump sum price of:
($ 4,454.00 ) per LS
$4,454.00
43 50 LF
Install 1” PVC SCH 80 Conduit for the unit price
of:
($ 45.00 ) per LF
$2,250.00
44 1 LS
Install 100 AMP Rainproof Electrical Panel on 4”
Metal Post on 4” Thick 24” x 24” Concrete
Pad Including Relocation of Existing Timers
and Installation of New Conductor Wire for the
lump sum price of:
($ 5,238.00 ) per LS
$5,238.00
45 1 LS Construct Wash Rack for the lump sum price of:
($ 6,444.00 ) per LS $6,444.00
46 1 LS Modify Wash Rack for the lump sum price of:
($ 4,833.00 ) per LS $4,833.00
47 1 EA
Install 8" Valve Can & Sleeve over Ex.

Water Valve for the unit price of:
($ 1,566.00 ) per EA
$1,566.00
48 550 SF
Sawcut and Remove Existing Concrete for the
unit price of:
($ 10.00 ) per SF
$5,500.00
TOTAL ALL BASE BID ITEMS $753,378.00
Total Base Bid in Words: Seven Hundred Fifty-Three Thousand Three Hundred Seventy-Eight Dollars and No Cents

6/22 - 19 - Construction Agreement

6/22 - 20 - Construction Agreement

EXHIBIT C
BONDS

6/22 - 20 - Construction Agreement

6/22 - 21 - Construction Agreement

CITY OF SAN DIMAS

BOND FOR SECURITY OF LABORERS AND MATERIALMEN
CONSTRUCTION CONTRACT NO. 2025-07
Whereas, The City Council of the City of San Dimas (the "City"), State of California and Gentry General Engineering, Inc. (the "Principal") have entered into an Agreement (the "Agreement") dated __________________, 2026, whereby Principal agrees to install and complete the following public improvements: CITY OF SAN DIMAS CONSTRUCTION CONTRACT NO. 2025-07 II HORSETHIEF CANYON WATER QUALITY MANAGEMENT IMPROVEMENTS. The Agreement is incorporated herein by reference.

Whereas, under the terms of the Agreement, the Principal is required before entering upon the performance of the work, to file a good and sufficient payment bond with the City to secure payment of the claims to which reference is made in Title 15 (commencing with Section 3082) of part 4 of Division 3 of the Civil Code of the State of California.

Now, therefore, the Principal and the undersigned ______________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________ UU, as corporate surety (the "Surety"), are held firmly bound unto the City and all contractors, subcontractors, laborers, materialmen, and other persons employed or providing materials in the performance of the Agreement and referred to in aforesaid Civil Code in the sum of SEVEN HUNDRED FIFTY THREE THOUSAND THREE HUNDRED SEVENTY EIGHT DOLLARS AND NO CENTS ($753,378) for materials furnished or labor thereon of any kind, or for amounts due under the Unemployment Insurance Act with respect to such work or labor. Further, Surety will pay the same in an amount not exceeding the amount hereinabove set forth, and also in case suit is brought upon this Bond, will pay, in addition to the face amount thereof, costs and reasonable expenses and fees, including reasonable attorney's fees, incurred by City in successfully enforcing this obligation, to be awarded and fixed by the court, and to be taxed as costs and to be included in the judgment therein rendered.

It is hereby expressly stipulated and agreed that this bond shall inure to the benefit of any and all persons, companies, and corporations entitled to file claims under Title 15 (commencing with Section 3082) of Part 4 of Division 3 of the Civil Code, so as to give a right of action to them or their assigns in any suit brought upon this bond.

Should the condition of this bond be fully performed, then this obligation shall become null and void, otherwise it shall be and remain in full force and effect.

The Surety hereby stipulates and agrees that no change, extension of time, alteration, or addition to the terms of the Agreement, or the specifications accompanying

6/22 - 22 - Construction Agreement
the same shall in any manner affect its obligations on this Bond, and it does hereby waive notice of any such change, extension, alteration, or addition.

In witness whereof, the Principal and Surety caused this Bond to be executed on this ________ day of ______________________, 2026.

Principal
________________________________
By:______________________________
Title:_____________________________
Surety
_________________________________
By:______________________________
Title:_____________________________
Local Mailing Address of Surety:
________________________________
Street Address
________________________________
City & State
Telephone Number
(All Signatures Must Be Acknowledged)

6/22 - 22 - Construction Agreement

6/22 - 23 - Construction Agreement
A notary public officer completing this certificate verifies only the identity of the individual who signed the document, to which this certificate is attached, and not the truthfulness, accuracy, or validity of that document.

STATE OF CALIFORNIA )
)

COUNTY OF LOS ANGELES )
On ____________ , before me, _________________ , Notary Public, personally appeared _________________ , who proved to me on the basis of satisfactory evidence to be the person(s) whose name(s) is/are subscribed to the within instrument and acknowledged to me that he/she/they executed the same in his/her/their authorized capacity(ies), and that by his/her/their signature(s) on the instrument the person(s), or the entity upon behalf of which the person(s) acted, executed the instrument.

I certify under PENALTY OF PERJURY under the laws of the State of California that the foregoing paragraph is true and correct.

WITNESS my hand and official seal.

Signature: (Seal)

6/22 - 23 - Construction Agreement

6/22 - 24 - Construction Agreement

CITY OF SAN DIMAS

BOND SECURING PERFORMANCE
CONSTRUCTION CONTRACT NO.
2025-07 II HORSETHIEF CANYON WATER QUALITY MANAGEMENT IMPROVEMENTS Whereas, The City Council of the City of San Dimas (the "City"), State of California and Gentry General Engineering, Inc. (the "Principal") have entered into an Agreement (the "Agreement") dated _______________, 2026 whereby Principal agrees to install and complete the following improvements: CITY OF SAN DIMAS CONSTRUCTION CONTRACT NO. 2025-07 II HORSETHIEF CANYON WATER QUALITY MANAGEMENT IMPROVEMENTS. The Agreement is incorporated herein by reference.

Whereas, said Principal is required under the terms of said Agreement to furnish a bond for the faithful performance of said Agreement.

Now, therefore, we, the Principal and
_________________________________________UU, as surety (the "Surety"), are held and firmly bound unto the City, in the penal sum SEVEN HUNDRED FIFTY THREE

THOUSAND THREE HUNDRED SEVENTY EIGHT DOLLARS AND NO CENTS ($753,378) lawful money of the United States, for the payment of which sum well and truly to be made, we bind ourselves, our heirs, successors, executors and administrators, jointly and severally, firmly by these presents.

The condition of this obligation is such that if said Principal, his or its heirs, executors, administrators, successors or assigns, shall in all things stand to and abide by, and well and truly keep and perform the covenants, conditions and provisions in the said Agreement and any alteration thereof made as therein provided, on his or their part, to be kept and performed at the time and in the manner therein specified, and in all respects according to their true intent and meaning, and shall indemnify and, save harmless the City, its officers, agents and employees, as therein stipulated, then this obligation shall become null and void; otherwise it shall be and remain in full force and effect.

As a part of the obligation secured hereby and in addition to the face amount specified therefor, there shall be included costs and reasonable expenses and fees, including reasonable attorney's fees, incurred by City in successfully enforcing such obligation, all to be taxed as costs and included in any judgment rendered.

The Surety hereby stipulates and agrees that no change, extension of time, alteration or addition to the terms of the Agreement or to the work to be performed thereunder or the specifications accompanying the same shall in any way affect its obligations on this Bond, and it does hereby waive notice of any such change, extension

6/22 - 25 - Construction Agreement
of time, alteration or addition to the terms of the Agreement or to the work or to the specifications.

In witness whereof, the Principal and Surety caused this bond to be executed on this ________ day of ______________________, 2026.

Principal
_________________________________
By: ______________________________
Title:_____________________________
Surety
________________________________
By:______________________________
Title:_____________________________
Local Mailing Address of Surety:
________________________________
Street Address
________________________________
City & State
Telephone Number
(All Signatures Must Be Acknowledged)

6/22 - 26 - Construction Agreement
A notary public officer completing this certificate verifies only the identity of the individual who signed the document, to which this certificate is attached, and not the truthfulness, accuracy, or validity of that document.

STATE OF CALIFORNIA )
)

COUNTY OF LOS ANGELES )
On ____________ , before me, _________________ , Notary Public, personally appeared _________________ , who proved to me on the basis of satisfactory evidence to be the person(s) whose name(s) is/are subscribed to the within instrument and acknowledged to me that he/she/they executed the same in his/her/their authorized capacity(ies), and that by his/her/their signature(s) on the instrument the person(s), or the entity upon behalf of which the person(s) acted, executed the instrument.

I certify under PENALTY OF PERJURY under the laws of the State of California that the foregoing paragraph is true and correct.

WITNESS my hand and official seal.

Signature: _________________________ (Seal)

PROPOSAL FOR GEOTECHNICAL

MONITORING &

MATERIALS TESTING AND INSPECTION

SERVICES
PROJECT:

HORSETHIEF CANYON PARK
FOR:

City of San Dimas
245 E. Bonita Avenue
San Dimas, CA 91773
Proposal No. 26-1058_R.01
June 23, 2026
Prepared By: Geo-Advantec
457 W Allen Ave #113
San Dimas, CA 91773
ATTACHMENT 2

457 W Allen Ave #113, San Dimas, CA 91773 Phone: (909) 305-0400 Fax: (909) 907-0704 Geotechnical Engineering Earthquake Engineering Engineering Geology www.geoadvantec.com
Ms. Shari Garwick, PE June 23, 2026
Director of Public Works Proposal No. 26-1058_R.01
City of San Dimas
245 E. Bonita Avenue
San Dimas, CA 91773
Subject: Proposal for Geotechnical Monitoring and Materials Testing and Inspection Services for Horsethief Canyon Park
San Dimas, California
Dear Ms. Garwick:

Geo-Advantec, Inc. (GAI) appreciates the opportunity of submitting this Proposal to provide the Client and the City of San Dimas (City) with all the required geotechnical and materials special inspection services for the construction of the subject project. GAI ensures that our services will meet the requirements of applicable codes, regulations, ordinances, guidelines, and project documents.

Included in this submittal is our understanding of the project, a breakdown of the estimated budget for the inspection and testing services, our hourly rates, the company’s master schedule of rates and terms and conditions for this project.

We look forward to the opportunity to work with you on this and future projects. Should you have any questions, please do not hesitate to contact the undersigned at (909) 305-0400 or [email protected].

Respectfully Submitted,
GEO-ADVANTEC, INC.

Lisa Anderson, MBA
Vice President
Marketing & Business Development

Proposal No. 26-1058_R.01 June 23, 2026 Page 2 of 4

1. PROJECT UNDERSTANDING
At the time of preparation of this Proposal, the following documents have been provided for our review and use:
• A set of plans, sheets 1 to 9, prepared by RKA, dated 5/2/2024.

At this time, no soil report is available, and we will complete the estimate based on the plans/specs. Based on the review performed on the provided document, it is our understanding that the project involves placing 4 inches of asphalt over subgrade soils, installation of pipelines, construction of a new wash rack, and general grading on the site. Our scope will include the following:
• Provide field monitoring, testing, and inspection for the construction works. • Perform laboratory tests on subgrade, base, and asphalt materials. • Prepare and submit daily inspection reports.

During construction, GAI will provide geotechnical and materials inspection and testing, and will perform continuous and periodic inspections. Our on-site presence will be based on the direction we receive from the project authorities.

At this time, no construction schedule was available for our use in preparation of our estimate, and our proposed fee is being prepared using a rough quantity take-off using the provided drawing, which might be subject to change. A more accurate cost estimate could be provided upon the availability of the construction schedule. However, our service is based on time and material and will be provided on an on-call basis.

In addition, the accuracy of the provided estimate can be affected by:
• Contractor and sub-contractor’s efficiency and sequencing of events/work tasks. • Amount of services required by the jurisdictional agency. • Amount of calls we receive from the Client or their representative to provide our services. • Weather conditions and other unforeseen delays.

2. ESTIMATED BUDGET AND BREAKDOWN
Table 1 below provides a cost breakdown and our estimate for the outlined scope. The plans were used to estimate the times and testing required. The unit rates are included in the table. The hourly rates for inspectors and technicians are based on prevailing wage rates. Please refer to Attachment A for Terms and Conditions and Attachment B for the Master Schedule of Rates. The rates, provided fee, and estimate included in the Proposal take precedence over the master fee, should there be any inconsistency between the Proposal and master fee. GAI’s estimate is based on the documents we received and our experience with similar projects. The real construction schedule may differ from what we have assumed. The provided fee and estimate are for budgetary purposes and might be subject to change. The total estimated cost of our services is $30,284.00.

Proposal No. 26-1058_R.01 June 23, 2026 Page 3 of 4
Table 1. Cost Breakdown for the Horsethief Canyon Park
Description Quantity Unit Unit Rate
($)
Total Amount
($)

GEOTECHNICAL MONITORING
Soil Technician / Field Engineer 120 Hours 140.00 16,800.00 Nuclear Gauge 15 Days 80.00 1,200.00
Sample Pick up 2 Each 175.00 350.00
Percolation Test 1 Each 2,000.00 2,000.00
Senior Field Engineer 8 Hours 165.00 1,320.00
Traffic Control 1 Each 2,000.00 2,000.00
Administration 6 Hours 65.00 390.00
SUBTOTAL 24,060.00

MATERIALS SPECIAL INSPECTION
Inspector/Concrete 8 Hours 140.00 1,120.00
Senior Engineer/Plans, Reports, Test Results Review,
Submittal Reviews 2 Hours 200.00 400.00
TOTAL ESTIMATED FEES FOR GEOTECHNICAL MONITORING AND TESTING 1,520.00

SUBGRADE AND BASE
Maximum Density 2 Each 193.00 386.00
TOTAL ESTIMATED FEES FOR SUBGRADE AND BASE TESTING 386.00

HOT MIX ASPHALT TESTING
Extraction, % Asphalt, including Gradation 1 Each 490.00 490.00 Compacted Maximum Density – MARSHALL 1 Each 260.00 260.00 Concrete Cores, Compression 5 Each 43.00 215.00
QA/QC Laboratory Manager Review 5 Hours 120.00 600.00
TOTAL ESTIMATED FEES FOR HOT MIX ASPHALT TESTING 1,565.00 Contingency (10%) 2,753.00
TOTAL ESTIMATED FEES FOR MATERIALS INSPECTION AND TESTING $30,284.00

Proposal No. 26-1058_R.01 June 23, 2026 Page 4 of 4
I have read the attached Attachments A and B of this Proposal and approve the Proposal and agree with all its contents, including the attached Terms & Conditions. I hereby authorize GeoAdvantec, Inc. to proceed with all the works associated with this project.

City of San Dimas
By: _______________________________
Name: _____________________________
Title: _____________________________
Date: ______________________________
Email: _____________________________

Project No. 26-1058_R.01 June 23, 2026 Attachment A

ATTACHMENT A
Terms and Conditions

Client Initials: ________
Project No. 26-1058_R.01 June 23, 2026 Page A1 of A4
GEO-ADVANTEC, INC. – GENERAL TERMS & CONDITIONS
These General Terms & Conditions (“Terms”) are incorporated into and made part of the Proposal/Agreement between Geo-Advantec, Inc. (“GAI” or “Consultant”) and the Client. If there is a conflict between the Proposal and these Terms, these Terms govern unless the Proposal expressly states otherwise in writing.

1. Proposal Validity; Authorization to Proceed

1.1.Validity. Fees, rates, and assumptions stated in the Proposal are valid only if the Client authorizes GAI to proceed and the project commences within six (6) months of the Proposal date.

After that, GAI may revise the scope, schedule, and fees.

1.2.Authorization. Client may authorize GAI to proceed by signing the Proposal, issuing a written notice to proceed, or directing GAI to begin work (including by email).

1.3. Scope. GAI will perform only the services specifically described in the Proposal. Any services outside the scope are Additional Services and will be performed only upon Client’s written authorization and billed per the Proposal rates (or GAI’s then-current rates if not specified).

2. Client Responsibilities; Information; Site Access

2.1. Information. Client shall provide timely, accurate, and complete project information, including available plans, reports, schedules, geotechnical data, known site constraints, and changes. GAI may rely on information furnished by Client and others without independent verification.

2.2. Access. Client shall ensure safe access to the site will be provided in coordination with the contractor.

2.3. Changes/Unknowns. If site conditions, project plans, regulations, scope, or schedule change, or if unknown/hidden conditions are encountered, GAI may adjust its recommendations and/or perform Additional Services at additional cost.

3. Standard of Care (No Warranties)
GAI will perform services consistent with the professional standard of care ordinarily exercised by similar professionals practicing under similar circumstances at the time the services are performed. No other warranty or guarantee, express or implied, is made or intended.

4. Jobsite Safety: Means and Methods
GAI safety. GAI is responsible only for the safety of its own employees. GAI may suspend work if site conditions are unsafe or if access is denied, and such suspension shall be treated as a compensable delay and/or Additional Service.

5. Fees, Invoices, and Payment

5.1. Invoicing. GAI will invoice on a monthly basis.

5.2. Due date Invoices are due net thirty (30) days from the invoice date and are not contingent upon Client’s receipt of payment from any owner, developer, lender, contractor, or other party.

5.3. Disputed amounts. Client must notify GAI in writing of any good-faith billing dispute within fifteen (15) days of invoice date, identifying the specific disputed item(s) and basis. Undisputed amounts remain due as stated.

5.4. Late charges. Past-due amounts accrue interest at 1.5% per month (or the maximum allowed by law, if less) from the due date until paid, plus reasonable collection costs.

Client Initials: ________
Project No. 26-1058_R.01 June 23, 2026 Page A2 of A4

5.5. Suspension for nonpayment. If any invoice is delinquent, GAI may suspend services upon written notice. Suspension shall not be grounds for claims against GAI for delay, damages, or impacts.

5.6. Acceleration. Upon suspension or termination for nonpayment, all amounts accrued become immediately due.

5.7. Lien rights. Nothing in this Agreement waives or limits GAI’s statutory lien rights (including, as applicable, design professional/mechanics’ lien rights).

6. Laboratory Testing; Sample Handling

6.1. Disposition. Unless Client provides written instructions before testing, samples will be discarded 45 days after the field work is complete and samples are collected in accordance with GAI’s standard practices.

6.2. Storage/retrieval. If Client requests storage, extended retention, or retrieval after testing, Client shall pay any applicable handling/storage costs and shipping, and acknowledges samples may degrade over time.

6.3. Chain of custody. If special chain-of-custody or preservation requirements apply, Client must notify GAI in writing prior to sampling/testing; such requirements are Additional Services unless included in the Proposal.

7. Data, Instruments of Service, and Deliverables (Ownership/License/Use)

7.1. Ownership until paid. All field notes, data, calculations, specifications, designs, drawings, reports, and other work product (“Instruments of Service”) remain GAI’s property until all invoices are paid in full.

7.2. No third-party reliance. No third party may rely on GAI’s services or deliverables without a written reliance letter executed by GAI (may include additional fees and limitations). Client shall indemnify GAI for unauthorized third-party reliance as set forth below.

7.3. Drafts. Draft or preliminary documents are for review and are not for construction or reliance.

8. Indemnity
To the fullest extent permitted by law, Client shall indemnify, defend, and hold harmless GAI and its officers, directors, employees, and agents from and against claims, damages, liabilities, penalties, fines, and expenses (including reasonable attorneys’ fees) arising out of or related to:
(a) Client’s or Client’s contractors’/subcontractors’/consultants’ negligence or willful misconduct; (b) jobsite means, methods, sequences, safety practices, or site operations not related to GAI’s performance;
(c) hazardous materials not brought to the site by GAI (including discovery, handling, exposure, release, or remediation); and/or
(d) any use of or reliance upon GAI’s services/deliverables by any party other than Client without GAI’s written authorization.

This indemnity does not apply to the extent a claim is finally determined to have been caused by GAI’s negligence or willful misconduct.

9. Limitation of Liability
To the fullest extent permitted by law, GAI’s total aggregate liability for any and all claims arising out of or related to the Agreement (whether in contract, tort, negligence, strict liability, or otherwise) shall be limited to the greater of (i) the total fees paid to GAI for the specific services

Client Initials: ________
Project No. 26-1058_R.01 June 23, 2026 Page A3 of A4
giving rise to the claim, or (ii) $25,000. This limitation does not apply to liability arising from GAI’s willful misconduct where such limitation is prohibited by law.

10. Waiver of Consequential Damages
To the fullest extent permitted by law, neither party shall be liable to the other for consequential, incidental, special, exemplary, or punitive damages, including loss of profit, loss of use, loss of financing, loss of business, delay damages, or loss of goodwill, arising out of or related to the Agreement, regardless of foreseeability.

11. Termination

11.1. Client termination. Client may terminate upon written notice. Client shall pay GAI for all services performed and costs incurred through the effective termination date, plus reasonable demobilization/closeout costs.

11.2. GAI termination/suspension. GAI may terminate or suspend services for nonpayment, unsafe conditions, denial of access, or Client material breach.

11.3. Payment due. Upon termination, all accrued amounts become immediately due.

12. Assignment; No Third-Party Beneficiaries
Neither party may assign the Agreement or any claims arising from it without the other party’s prior written consent, except that either party may assign to a successor in interest in connection with a merger or sale of substantially all assets. The Agreement is for the sole benefit of the parties and creates no third-party beneficiaries.

13. Entire Agreement; Amendments; Severability; Waiver
This Agreement (Proposal + these Terms) is the entire agreement and supersedes prior discussions and understandings. Amendments must be in writing and signed by both parties. If any provision is unenforceable, the remainder remains in effect. Failure to enforce any provision is not a waiver.

14. Independent Consultant / Contractor
GAI is an independent Consultant/contractor. Nothing creates an employer-employee relationship, joint venture, or partnership.

15. Attorneys’ Fees
In any action or proceeding arising out of or related to this Agreement, each party shall pay its own attorneys’ fees and costs.

16. Governing Law; Venue
This Agreement is governed by California law. Venue for any dispute shall be in the state or federal courts located in the county where GAI’s principal office is located, unless the parties agree otherwise in writing.

17. Cooperation

Client Initials: ________
Project No. 26-1058_R.01 June 23, 2026 Page A4 of A4
The parties will cooperate in good faith to enable the timely performance of their respective obligations and to maintain effective working relationships among the project team.

18. Minimum Charges for Construction Phase Inspections

18.1. All technicians and inspectors are subject to a minimum of four (4) hours.

18.2. Services exceeding four (4) hours shall be billed at a minimum of eight (8) hours.

18.3. If an inspector or technician is scheduled, arrives at the project site, and no work is performed, a two-hour “show-up charge” will apply and be referred to as a show-up charge.

18.4. A sample pickup (truck + driver, within a 50-mile radius from GAI’s office) round trip is $175.

19. Travel and Mileage

19.1. No travel time or mileage costs will be reimbursed for engineering staff and materials/special inspection personnel. In accordance with the latest California Department of Industrial Relations (DIR) Public Works Manual, October 2023, soils technicians performing construction inspection and testing with a nuclear gauge device will be charged travel time at the contractual rate. Travel will be calculated from GAI’s nearest office, and charges will apply for round‑trip drive time (portal‑to‑portal). Reference: DIR Public Works Manual (October 2023, PDF) - https://www.dir.ca.gov/dlse/PWManualCombined.pdf

19.2. For regular/non-prevailing jobs, a round-trip mileage cost equal to $0.75 per mile, calculated from GAI's office to the project site, will be charged.

19.3. The travel time and mileage fee may be subject to change per the negotiation with the client and written approval.

20. Scheduling and Cancellations
A 24‑hour notice is required when scheduling an inspection or technician. For same‑day scheduling and for after 3:00 pm on the preceding day, the inspector/technician will be deployed to the site if a technician is available.

21. Prevailing Wage
Rates will increase proportionally every July 1 in accordance with the wage listed by the Department of Industrial Relations, which is tied to Operating Engineers Local 12 documented annual increases plus corresponding changes in general administration and overhead expenses.

These adjustments shall become the agreed-upon basis for charges by GAI to Client.

Project No. 26-1058_R.01 June 23, 2026 Attachment B

ATTACHMENT B
Master Schedule of Rates

Effective: January 2026-June 2027 Page A1 of A5
Proposal No. 26-1058 Master Fee Schedule

ENGINEERING SERVICES

ENGINEERING AND PROFESSIONAL SERVICES
Principal Geotechnical Engineer/Principal Engineering Geologist $ 250.00 Per Hour Senior Hydrogeologist $ 250.00 Per Hour
Senior Geotechnical Engineer/ Senior Engineering Geologist/Senior Registered Engineer $ 200.00 Per Hour Project Manager $ 150.00 Per Hour
Senior Field Engineer $ 165.00 Per Hour
Staff Engineer/Staff Geologist/Field Engineer $ 145.00 Per Hour Laboratory Manager $ 120.00 Per Hour
Administration $ 65.00 Per Hour
GIS Technician
Drafter/CAD Technician
$
$
135.00

90.00 Per Hour
Per Hour
Principal Geologist Forensic/Field and Office $ 320.00 Per Hour Principal Geotechnical Engineer Forensic (Field and Office) $ 375.00 Per Hour Senior Engineer Forensic (Field and Office) $ 275.00 Per Hour Field Engineer Forensic $ 215.00 Per Hour
Principal Geotechnical Engineer and Geologist Expert Witness and Litigation Tasks $ 375.00 Per Hour Senior Geotechnical Engineer/Senior Registered Engineer Expert Witness and Litigation Tasks $ 320.00 Per Hour

GEOTECHNICAL INVESTIGATIVE/PRE-CONSTRUCTION PHASE

FIELD DRILLING AND TESTING
*Field Testing/Sampling Helper (Technician - Prevailing Wage) *Surcharge of $10 per/hr. for projects under PLA/CWA agreements $ 135.00 Per Hour Drilling – Hollow Stem Auger (6-8” diameter) (subject to adjustment) $ 6500.00 Per Day Drilling – Mud Rotary Wash Drilling (subject to adjustment) $ 6750.00 Per Day Drilling – Cone Penetration Test (subject to adjustment) $ 6250.00 Per Day Coring- Pavement (Crew + Equipment, including rapid set concrete or cold AC patching) $ 275.00 Each Core Saw-Cut – R-value Sampling (Crew + Equipment, including rapid set concrete or cold AC patching) $ 450.00 Each Location Sample Pickup (truck + driver, within a 50-mile radius from GAI’s office) $ 175.00 Per Round GPR Survey $ 4000.00 Per Day
Percolation Test (Falling Head Method - Max. depth 15’) (Min. 2 tests, $9,630) $ 4250.00 Per Test

INSPECTION SERVICES

GEOTECHNICAL MONITORING

DURING CONSTRUCTION TESTING AND INSPECTION SERVICES
*Soil Technician / Field Engineer (Prevailing Wage)
*Surcharge of $10 per/hr. for projects under PLA/CWA agreements $ 140.00 Per Hour Soils/Materials Inspector (Regular Wage) $ 100.00 Per Hour Technician / Field Engineer – Pile and Tieback Monitoring & Inspection $ 140.00 Per Hour Deputy Grading Inspector (City of LA) $ 175.00 Per Hour Nuclear Gauge Equipment $ 80.00 Per Day

MATERIALS SPECIAL INSPECTION
*Inspector/Concrete, Batch Plant Inspection $ 140.00 Per Hour *Inspector/Masonry $ 140.00 Per Hour
*Inspector/Welding/Steel/Tagging & Sampling $ 140.00 Per Hour *Inspector/Post-Tension $ 140.00 Per Hour
*Inspector/Fireproofing $ 140.00 Per Hour
*Inspector/UT $ 150.00 Per Hour
*Inspector/Pull Test
*Surcharge of $10 per/hr. for projects under PLA/CWA agreements $ 150.00 Per Hour Per Diem Shop Inspection (if the shop is more than 50 miles from the project site) $ TBD

Effective: January 2026-June 2027 Page A2 of A5
Proposal No. 26-1058 Master Fee Schedule

REPORTS
Soils (Geotechnical/Geohazard Evaluation) Report Quote Each DSA-293 Report $ 1000.00 Ea. Cert.

DSA-291 Report $ 1000.00 Ea. Cert.

Final Grading / Compaction Report (Comprehensive-Minimum) $ 3500.00 Each Pad Certificate Report/Letter $ 1750.00 Each
Monthly Interim In-Grading Report $ 2000.00 Each
Pile/Shoring Monitoring Report (Final) $ Quote Each
Plan Review (Grading/ Foundation) $ 3000.00 Each
Materials Testing Final Verification Letter $ 1500.00 Each Project Laboratory Report Review Letter (Stamped) $ 1000.00 Each

LABORATORY TESTING

SOIL AND AGGREGATE

CLASSIFICATION & PHYSICAL CHARACTERISTICS

ID ASTM CTM
T101 D2937 CT212 Unit Weight $ 33.00 Each
T102 D4829 Expansion Index $ 155.00 Each
T103 C117, D1140 Finer than #200 Wash $ 70.00 Each
T104 D422, C136 CT202 Sieve Analysis- Coarse & Fine Including wash $ 193.00 Each T105 D422, C136 CT202 Sieve Analysis- Coarse Aggregate $ 148.00 Each T106 D422, C136 CT202 Sieve Analysis- Fine Including Wash $ 165.00 Each T107 D422 CT203 Particle-Size Distribution - Sieve Analysis + Hydrometer Combined $ 248.00 Each
T108 D422 CT203 Hydrometer Analysis only $ 165.00 Each
T109 D4318 CT204 Atterberg Limits LL, PL, & PI of Soils $ 155.00 Each T110 D2435 Consolidation (without Time Rate) $ 238.00 Each T111 D2419 CT217 Sand Equivalent Value of Soil and Fine Aggregate (Set of Three) $ 138.00 Each Set
T112 C127 CT206 Specific Gravity and Absorption (Coarse Aggregate) $ 110.00 Each T113 C127 CT206 Absorption Only, Coarse Aggregate $ 83.00 Each T114 C128 CT207 Specific Gravity and Absorption (Fine Aggregate) $ 198.00 Each T115 C128 CT207 Absorption Only, Fine Aggregate $ 110.00 Each T116 AASHTO
T100 CT209 Specific Gravity (Soil) by Hydrometer (Water Pycnometer) $ 175.00 Each T117 D2216 CT226 Water Moisture Content $ 33.00 Each
T118 D3080 Direct Shear (3 Points) $ 330.00 Each
T119 D3080 Direct Shear Remolded sample (3 points) $ 375.00 Each T120 D1557-A, B Maximum Density 4 in. Mold Passing No.4 or 3/8 in.

Sieve $ 193.00 Each
T121 D1557-C Maximum Density 6 in. Mold Passing 3/4 in. Sieve $ 203.00 Each T122 D2166 CT221 Unconfined Compressive Strength of Cohesive Soil $ 175.00 Each T123 D2844 CT301 R-Value, Untreated Material (3 Points) $ 358.00 Each T124 D2844 CT301 R-Value, Treated Material $ 385.00 Each T125 D4791 CT235 Flat and Elongated Particles $ 275.00 Each T126 D3744 CT229 Durability Index (fine and coarse) in Aggregate $ 275.00 Each

Effective: January 2026-June 2027 Page A3 of A5
Proposal No. 26-1058 Master Fee Schedule

SOIL AND AGGREGATE

CLASSIFICATION & PHYSICAL CHARACTERISTICS

ID ASTM CTM
T127 D3744 CT229 Durability Index (fine or coarse) in Aggregate $ 175.00 Each T128 C142 Clay Lumps and Friable Particles in Aggregate $ 165.00 Each T129 C40 CT213 Organic Impurities in Fine Aggregates for Concrete $ 93.00 Each T130 D5821 CT205 Percentage of Crushed Particles $ 198.00 Each T131 C131 CT211 Los Angeles Rattler Test (Abrasion up to 1-1/2”) $ 330.00 Each T132 C535 CT211 Los Angeles Rattler Test (Abrasion Large-up to 2- 1/2”) $ 385.00 Each
T133 C88 CT214 Sodium or Magnesium Sulfate Soundness of Aggregate, 5-cycles $ 435.00 Each
T134 CT216 Relative Compaction of Soils & Aggregates using California Impact Apparatus $ 265.00 Each
T135 CT227 Cleanness Value of Coarse Aggregate $ 248.00 Each T136 D558 Moisture-Density Relations of Soil-Cement Mixtures $ 193.00 Each T137 D1633-A Compressive Strength of Molded Soil-Cement Cylinders using 4 in. Mold $ 73.00 Each
T138 D4546 One-Dimensional Swell or Collapse of Soils $ 165.00 Each T139 Shelby Tube Cutting, Remolding or Trimming
Specimens for Testing $ 50.00 Each
T140 D1883 California Bearing Ratio, Maximum Density test, separate charge $ Quote Each
T141 D2435 Consolidation (with time rate for 2 loads) $ 308.00 Each T142 AASHTO CT234 Fine Aggregate Angularity $ 243.00 Each T143 D2850 Unconsolidated-Undrained Triaxial Compression $ 185.00 Each

CHEMICAL PROPERTIES OF SOILS
ID CTM
T190 CT643 Resistivity $ 83.00 Each
T191 CT643 pH $ 73.00 Each
T192 EPA 300.0 Sulfate Content $ 100.00 Each
T193 EPA 300.0 Chloride Content $ 100.00 Each
T194
CT643
EPA 300.0
EPA 300.0
Corrosivity Series $ 305.00 Each

CONCRETE

ID ASTM CTM
T201 C39 CT521 Compression Tests, 6x12 and/or 4x8 Cylinders, including Holds $ 43.00 Each
T202 C495 Compression, Lightweight Insulating Concrete $ 133.00 Each T203 C42, C39 Concrete Cores Compression Test (excludes sampling) $ 88.00 Each
T204 C42 Drilling Cores from Shotcrete Panel (Lab) $ 138.00 Each T205 C109 C515 Compression, 2”x2”x2” Cube Specimen $ 60.00 Each T206 C496 Splitting Tensile Strength 6”x12” Cylinder $ 165.00 Each T207 C78 CT523 Flexural Strength Test (6”x6”x21” Beam) $ 166.00 Each T208 C157 Drying Shrinkage (Set of 3 bars, 4 readings, up to 90-days) $ 590.00 Each set

Effective: January 2026-June 2027 Page A4 of A5
Proposal No. 26-1058 Master Fee Schedule

CONCRETE

ID ASTM CTM
T209 C39 Unit Weight of Concrete Cylinders $ 55.00 Each T210 Review Existing Mix Design $ 110.00 Each
T211 Drilling Cores from Shotcrete Panel (Field) $ Quote Each T212 Core Trimming/Cutting $ 50.00 Each

MATERIALS TESTING

ID ASTM CTM UBC
T301 D2216 7-6 Fireproofing Density Test $ 125.00 Each
T302 Mechanically Spliced Reinforcing Tensile Test up to size No.11 $ 360.00 Each
T303 A416 Pre-Stress Still Strand (7 wire) Tensile and
Elongation $ 410.00 Each
T304 A615, A706 Reinforcing Tensile or Bend Up to No.8 $ 75.00 Each T305 A615, A706 Reinforcing Tensile or Bend No.9 to 11 $ 115.00 Each T306 A615, A706 Reinforcing Tensile or Bend No.12 to 14 $ 260.00 Each T307 N/A Welding Procedure Review $ 110.00 Each
T308 F606 Anchor Bolts, Studs, or Threaded Rods Tensile Test under 100,000 lbf $ 265.00 Each
T309 F606, F3125 Bolt A325 or A490 Wedge Tensile and Hardness up to ¾” $ 165.00 Each
T310 F606, F3125 Bolt A325 or A490 Wedge Tensile up to 1-1/8” in diameter, and Hardness $ 250.00 Each
T311 F606, F3125 Bolt A325 or A490 Wedge Tensile up to 1-1/4” in diameter, and Hardness $ 260.00 Each
T312 F606, F3125 Bolt A325 or A490 Wedge Tensile up to 1-3/8” in diameter, and Hardness $ 270.00 Each
T313 F606, F3125 Bolt A325 or A490 Wedge Tensile up to 1-1/2” in diameter, and Hardness $ 290.00 Each
T314 F606, A194 Nut - Hardness and Proof Load under 100,000 lbf $ 70.00 Each T315 F606, A194 Nut- Hardness and Proof Load Test 100,000- 120,000 lbf $ 85.00 Each
T316 F436 Washer- Hardness $ 55.00 Each

HOT MIX ASPHALT TESTING

ID ASTM CTM
T401 D1561 CT304 Laboratory Test Maximum Density (LTMD), Hveem $ 310.00 Each T402 D1560 CT304,
CT366 Stabilometer Value $ 360.00 Each
T403 CT305 Stability - Swell $ Quote Each
T404 CT308 Specific Gravity & Density of Core $ 110.00 Each T405 D2041 CT309 Theoretical Maximum Specific Gravity & Density (Rice) $ 260.00 Each
T406 CT370 Moisture Content by Microwave Oven $ 120.00 Each T407 D5444 CT202 Sieve Analysis of Extracted Aggregate Sample $ 190.00 Each T408 C136 CT202 Sieve Analysis of Bin Aggregate Sample, each $ 80.00 Each T409 C136 CT202 Sieve Analysis of Combined Aggregate Sample $ 250.00 Each T410 D6307 CT382 Asphalt Content by Ignition Oven (Bitumen Content) $ 310.00 Each T411 D6307 CT382 Asphalt Content by Ignition Oven (Correction Factor) $ 600.00 Each
T412 D1188 CT308 Unit Weight – Coated, Molded Specimen or Cores $ 110.00 Each T413 D2726,
D6926 Compacted Maximum Density – MARSHALL $ 260.00 Each

Effective: January 2026-June 2027 Page A5 of A5
Proposal No. 26-1058 Master Fee Schedule

HOT MIX ASPHALT TESTING

ID ASTM CTM
T414 D2172 Extraction, % Asphalt (Reflux) including wash and solvent charge $ 490.00 Each
T415 D2216 CT226 Emulsion Moisture Content by Oven $ 80.00 Each T416 AASHTO T59 CT331 Residue by Evaporation $ 240.00 Each T417 D3910 Wet Track Abrasion Test (WTAT) $ 250.00 Each T418 Core Trimming/Cutting $ 50.00 Each

MASONRY TESTING

ID ASTM UBC
T501 C140 Compression Test of CMU Block (gross) $ 105.00 Each T502 C140 Absorption & Moisture Content $ 90.00 Each
T503 C426 Linear Shrinkage $ 270.00 Each
T504 C140 Unit Weight $ 90.00 Each
T505 C140 Dimensional Measurements $ 60.00 Each
T506 C140 Compression Test of Masonry Core $ 105.00 Each T507 C39, C780 21-16 Compression Test of 2” x 4” Mortar Cylinder $ 60.00 Each T508 C1314 21-17 Compression Test of Composite Prism 8”x16” $ 270.00 Each T509 C1019 21-18 Compression Test of 3” x 3” x 6" Grout $ 105.00 Each T510 CBC 2105A.4 Shear on Masonry Cores, 2 Faces, 4” or 6” Cores $ 225.00 Each T511 Saw Cutting Coupons, or trimming from Masonry
Unit (Not Solid Units) $ 60.00 Each
T512 GPR Scanning for Reinforcement $ Quote Each
T513 Masonry Wall Coring $ Quote Each
T514 Masonry Wall Coring above 5 feet from floor $ Quote Each T515 C482 Veneer Bond Strength Shear Test-Onsite $ Quote Each T516 Saw Cutting Masonry Prisms (When required) $ 120.00 Each T517 Sample Pickup of Masonry Prisms (Added to
standard pickup fee) $ 20.00 Each

ATTACHMENT 3

1 CITY OF SAN DIMAS

DEPARTMENT OF PUBLIC WORKS
SAN DIMAS, CA 91773

SPECIFICATIONS AND CONTRACT DOCUMENTS
FOR
CONSTRUCTION CONTRACT NO. 2025-07 II

HORSETHIEF CANYON WATER QUALITY MANAGEMENT

IMPROVEMENTS
BID OPENING DATE: TUESDAY, JUNE 30, 2026
BID TIME: 2:00 P.M.

ENGINEER’S ESTIMATE: $_ 700,000___
Please direct questions or comments to:

Shari Garwick

CITY OF SAN DIMAS

CITY HALL
245 EAST BONITA AVENUE
SAN DIMAS, CA 91773
(909) 394-6240
sgarwick@ sandimasca.gov
ATTACHMENT 4

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements i
CONSTRUCTION CONTRACT NO. 2025-07 II

TABLE OF CONTENTS
NOTICE INVITING SEALED BIDS .................................................................................................................................. ii SPECIAL PROVISIONS ................................................................................................................................................. 1 INSTRUCTIONS TO BIDDERS ................................................................................................................................... 15 DESCRIPTION OF BID ITEMS .................................................................................................................................... 22 BIDDER’S PROPOSAL ................................................................................................................................................ 41 BIDDER'S BOND .......................................................................................................................................................... 48 CONTRACTOR'S CLASSIFICATION .......................................................................................................................... 49 BIDDER'S STATEMENT OF TECHNICAL ABILITY AND EXPERIENCE .................................................................. 50 DESIGNATION OF SUBCONTRACTORS .................................................................................................................. 51 CERTIFICATE AS TO COMPLIANCE WITH CERTAIN REGULATIONS .................................................................. 52

REJECTION OF BID FOR PRIOR DISQUALIFICATION REMOVAL OR OTHERWISE PREVENTED FROM BIDDING BECAUSE OF VIOLATION OF THE LAW OR A SAFETY REGULATION ................................................ 53 QUESTIONNAIRE TO GENERAL CONTRACTORS .................................................................................................. 54 NONCOLLUSION AFFIDAVIT TO BE EXECUTED BY BIDDER AND SUBMITTED WITH BID .............................. 55 NOTARY ACKNOWLEDGMENT ................................................................................................................................. 56 APPENDIX A (Standard Plans).................................................................................................................................... 57 APPENDIX B (Jensen Precast Clarifier) ...................................................................................................................... 58

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements ii

CITY OF SAN DIMAS

NOTICE INVITING SEALED BIDS
CONSTRUCTION CONTRACT NO. 2025-07 II
BIDS MUST BE RECEIVED BEFORE: Tuesday June 30, 2026 at 2:00PM BIDS WILL BE OPENED ON: Tuesday June 30, 2026 at 2:00PM PLACE OF BID RECEIPT: Office of the City Clerk, City Hall, 245 East, Bonita Avenue, San Dimas, California 91773
PROJECT IDENTIFICATION NAME: CONSTRUCTION CONTRACT NO. 2025-07 II HORSETHIEF

CANYON WATER QUALITY IMPROVEMENTS
NOTICE IS HEREBY GIVEN that the City of San Dimas, County of Los Angeles, California, will receive up to, but not later than, the time set forth above sealed contract bids for the award of a contract for the above project. All bids shall be made on the form furnished by the City and shall be opened and publicly read aloud at the above-stated time in the Office of the City Clerk of the City of San Dimas, City Hall.

DESCRIPTION OF WORK: This project includes the installation of clarifiers, sewer and storm drain and water quality improvements, asphalt paving, electrical conduit and conducters and specialty items at Horsethief Canyon Equestrian Center. The engineer’s estimate for the cost of the work is $700,000.

OBTAINING CONTRACT DOCUMENTS: Electronic copies of Contract Documents may be requested from the Public Works Department via email at [email protected] or by calling (909)394-6240. Contract documents may also be obtained at the Public Works Department, City Hall, San Dimas, California, upon payment of $10.00, or $20.00 if mailed; both amounts are non-refundable.

Each bid shall be accompanied by bid security referred to in the contract documents and by a list of proposed subcontractors. Evidence of insurance, a performance bond, and a labor and materials bond as specified in the contract documents will be required prior to execution of the contract.

Pursuant to the Labor Code of the State of California, the Director of Industrial Relations has determined the general prevailing rate of wages and employer payments for health and welfare, vacation, pension and similar purposes applicable to the work to be done. This rate and scale are on file with the Department of Public Works, and copies will be made available to any interested party on request. The contractor to whom the contract is awarded, and the subcontractors under him, must pay not less than these rates for this area to all workers employed in the execution of the contract.

At the time of the award of the contract, the successful bidder shall possess a Class “A” contractor's license or a combination of Specialty Class “C-8, C-12, C-34” licenses sufficient to cover all of the work to be performed by him (OR SUCH OTHER LICENSE[S] AS ARE REQUIRED BY THE PROJECT). Only a contractor registered with the Department of Industrial Relations (“DIR”) to bid on public works contracts in California shall be permitted to submit a bid. Furthermore, only subcontractors registered with the DIR to bid on public works contracts in California shall be permitted to perform work or labor or render service under subcontract to the subject contractor, or be listed on the bid. Further, the project is subject to compliance monitoring and enforcement by the DIR.

In accordance with Public Contract Code section 22300, the bidder who is awarded the contract may substitute securities for retention moneys withheld by a public agency to ensure performance under this contract. The procedure and requirements for substituting said securities is set forth in Public Contract Code section 22300 which is incorporated by this reference as set forth herein.

The City reserves the right to reject any or all bids and to waive any irregularities or informalities in any bid or in the bidding and to make awards in the interest of the City. No bidder may withdraw his bid for a period of ninety (90) calendar days after the opening of bids.

Each bidder is hereby notified of a pre-bid meeting on Monday, June 15, 2026 at 10:30 A.M. at the corner of Horsethief Canyon Park Road and Sycamore Canyon Road.

CITY OF SAN DIMAS
For information,
please call San Dimas Public Works Department
at (909) 394-6240 /s/ Debra Black
City Clerk of the City of San Dimas
PUBLISHED: Inland Valley Daily Bulletin
June 8, and June 15, 2026

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 1 SPECIAL PROVISIONS
SP-1 STANDARD SPECIFICATIONS AND GENERAL PROVISIONS
The Standard Specifications and General Provisions for the construction materials and construction methods as set forth in the "Standard Specifications for Public Works Construction," 2021 Edition and the “State of California Department of Transportation Standard Specifications,” May, 2010 Edition, shall be the Standard Specifications and General Provisions for all the Work to be done and the provisions of the Contract for the Work. In case of conflict between the Standard Specifications, the General Provisions, and these Special Provisions, the Special Provisions shall take precedence over and prevail over such conflicting portions.

SP-2 DEFINITIONS
The terms, whenever appearing in these Specifications, shall be interpreted to mean as follows:
“Board” The City Council of the City of San Dimas
“City” The City of San Dimas, California
“City Attorney” The City Attorney of the City of San Dimas “City Engineer” Authorized personnel of the City of San Dimas “City Council” The City Council of the City of San Dimas “Contract” The Contract and Contract Documents
“Contract Documents The plans, specifications, special conditions, and any other related documents or addenda for the Work.
“Contractor” The Contractor bidding on the Work
“State” The State Department of Transportation
“Work” The Work or Improvement
SP-3 TIME LIMIT
The Contractor undertaking this project must return the executed Contract Documents within Ten (10) calendar days of the City Council award date, and to commence work within Five (5) calendar days from Notice to Proceed. The Contractor will have Seventy Five (75) working days to complete the project.

The working hours are Monday thru Friday 7:00 am to 5:00 pm with the exception of City Holidays.

The City Council will not authorize any of the Work to be done under these specifications before the Contract has been signed, and any of the Work that is done by the Contractor in advance of such time shall be considered as being done at its own risk, and on its own responsibility, and as a consequence, will be subject to rejection having been done without the presence of the City Engineer or Inspector appointed by the City Engineer.

SP-4 CONTRACTOR’S RESPONSIBILITY
A. SUPERINTENDENCE
Whenever the Contractor is not present on any part of the Work where direction is needed, orders given by the City Engineer shall be received and obeyed by the superintendent or foreman or authorized representative who may be in charge of the Work. Any order given by the City Engineer, not otherwise required to be in writing by the specifications will, on request of the Contractor, be given or confirmed in writing. An authorized representative of the Contractor shall be at the work Page 332 – 569 Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 2 site during working hours.

B. CHARACTER OF WORKMEN
All superintendents and foreman shall be English-speaking. Any superintendent, foreman, laborer, or other person employed on the Work by the Contractor who fails or refuses to perform the Work in the manner specified herein shall be discharged immediately, and such person shall not again be employed on the Work. Upon written notification, the Contractor or any subcontractor shall discharge any person who is in the opinion of the City Engineer incompetent, disorderly, unfaithful, or otherwise unsatisfactory. Such discharge shall not be the basis of any claim for compensation or damage against the City or any of its officers.

SP-5 CITY ENGINEER AND CITY ENGINEER’S RESPONSIBILITY
Whenever in these specifications, or in other contract documents, where these specifications govern, the term, “City Engineer”, shall mean authorized personnel of the City of San Dimas.

The City Engineer shall have the general supervision and direction of the Work. He has authority to stop the Work whenever such stoppage may be necessary to insure the proper execution of the Contract. He shall have authority to reject any work or materials which do not conform to the Contract Documents, to direct the application of work forces to such portions of the Work as in his judgment is required, to order the work force increased or diminished, to direct the sequence of the Work, and to decide questions which arise in the execution of the Work.

The City Engineer shall provide inspection for all the Work to be performed under the Contract. All materials and the Work shall be performed only in the presence of the City Engineer or his authorized inspector, and any Work done in the absence of the City Engineer or his authorized inspector shall be subject to rejection. The Contractor shall notify the City Engineer forty-eight (48) hours in advance of any Work to be done, in order that inspection services may be provided.

SP-6 INSURANCE REQUIREMENTS
Before execution of the Contract, during the entire period of the Contract, and for periods after the end of the Contract, the Contractor shall have in place all of the insurance coverage’s required in this section. The Contractor’s insurance shall comply with all items specified by the Contract. Any subcontractors shall be subject to all of the requirements of this section, and the Contractor shall be responsible to obtain evidence of insurance from each subcontractor.

A. INSURER REQUIREMENTS
All insurance policies used to satisfy these requirements shall be issued by insurers authorized to do business in the State of California. Insurers shall have a current A.M. Best’s ratings of not less than A: VII unless otherwise approved by the City.

B. COVERAGE’S, LIMITS AND POLICY REQUIREMENTS
The Contractor shall maintain the types of coverage’s and limits as stated:

1. Commercial General Liability Insurance Commercial General Liability Insurance occurrence form, including all coverage’s provided by and to the extent afforded by Insurance Services Office Form CG 0001 ed. 11/88 or 11/85, with no special

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 3 limitations affecting the City. The limit for all coverage’s under this policy shall be no less than $2,000,000 per occurrence. The City, its employees, officials and agents shall be added as an additional insured by endorsements to the policy. The insurer shall agree to provide the City with thirty (30) days prior written notice of any cancellation, non-renewal or material change in coverage. The policy shall contain no provision that would make this policy excess over, contributory with or invalidated by the existence of any insurance, self-insurance or other risk financing program maintained by the City. In the event the policy contains such an “other insurance” clause, the policy shall be modified by endorsement to show that this policy is primary for any claim arising out of the Work performed under the Contract.

2. Commercial Automobile Liability Insurance Commercial Automobile Liability Insurance including all coverage’s provided by and to the extent afforded by Insurance Services Office Form CA 0001, ed. 12/93, including Symbol 1 (any auto) with no special limitations affecting the City. The limit for bodily injury and property damage liability shall be no less than $2,000,000 per accident. The insurer shall agree to provide the City with thirty (30) days prior written notice of any cancellation, nonrenewal or material change in coverage. The policy shall contain no provision that would make this policy excess over, contributory with or invalidated by the existence of any insurance, self-insurance or other risk financing program maintained by the City. In the event the policy contains such an “other insurance” clause, the policy shall be modified by endorsement to show that this policy is primary for any claim arising out of the Work performed under the Contract.

3. Workers’ Compensation Insurance Workers’ Compensation Insurance shall meet all statutory benefit requirements of the Labor Code of the State of California. Employers Liability Insurance with a minimum limit of $1,000,000 per claim. The policy shall contain or be endorsed to include a waiver of subrogation in favor of the City.

C. ADDITIONAL REQUIREMENTS
The procuring of such required policies of insurance shall not be construed to limit the Contractor’s liability hereunder or to fulfill the indemnification provisions and requirements of the Contract. There shall be no recourse against the City for payment of insurance premiums or other related costs. The City shall notify the Contractor in writing of changes in the insurance requirements. If the Contractor does not deposit, within sixty (60) days of receipt of such notice, copies of acceptable insurance policies incorporating the changes with the City, the Contractor shall be deemed in default under the Contract.

Any deductibles or self-insured retentions must be declared to and approved by the City. Any deductible exceeding an amount acceptable to the City shall be subject to the following changes:

1. The insurer shall reduce or eliminate such deductibles or self-insured retentions with respect to the City and its officials, employees and agents (with additional premium, if any to be paid by the Contractor); or

2. The Contractor shall provide satisfactory financial guarantee for payment of losses and related investigations, claim administration and defense expenses.

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 4 D. VERIFICATION OF COMPLIANCE
The Contractor shall furnish the City with original endorsements effecting coverage required by this clause. The endorsements are to be signed by a person authorized by that insurer to bind coverage on its behalf. All endorsements are to be received and approved by the City before work commences. Not less than fifteen (15) days prior to the expiration date of any policy of insurance required by this section, the Contractor shall deliver to the City a binder or certificate of insurance with respect to each renewal policy, bearing a notation evidencing payment of the premium, or accompanied by other proof of payment satisfactory to the City.

SP-7 PROGRESS PAYMENTS
Progress payments will be made in accordance with Section 9-3 of the Standard Specifications. The City shall retain five (5) percent of each progress payment to the Contractor in order to ensure performance under the Contract. Upon written claim by the Contractor submitted to the City Engineer on or before the twenty-fifth (25) day of each month during which the Work is under construction, the City Engineer will make an approximate measurement of the Work performed to that date and recommend to the City a progress payment to be paid for the Work completed. All requests for Payment shall be submitted on a City provided template. Payment will be made to the Contractor on or about the fifteenth (15) day of the month following completion of each estimate period. No payment shall be made or required to be made when, in the judgment of the City Engineer, the Work is not proceeding in accordance with the Contract.

A. SUBSTITUTION OF SECURITIES FOR MONIES WITHHELD TO ASSURE

PERFORMANCE AND PAY EARNED RETENTIONS DIRECTLY TO AN ESCROW AGENT In accordance with California Public Contract Code, Section 22300, the Contractor may request permission to substitute securities in lieu of having retention withheld by the City from progress payments when such payments become due or, in the alternative, the Contractor may request that the City make payments of earned retentions directly to an agreed upon designated escrow agent at the Contractor’s expense. The following shall control if either option is requested by the Contractor:

1. Substitution of Securities for Performance Retention At some reasonable time before any progress payments would otherwise be due and payable to the Contractor in the performance of the Work under the Contract, the Contractor may submit a request in writing to the City requesting permission to substitute retentions with securities equivalent to the estimated amount of retention (“Estimated Retention”) to be withheld by the City. The Contractor shall deposit such securities with the City or may, in the alternative, deposit such securities in escrow with a state or federally chartered bank in California, as the escrow agent, and at the Contractor’s expense.

Such securities will be equivalent or greater than the Estimated Retention. If on or after the date the securities are to be deposited: (a) the Contract is modified, by written modification, change order or otherwise, resulting in the Contractor being entitled to receive an amount more than the estimated Contract amount; and/or (b) the City, by a reservation of rights and at its sole discretion and upon advise of the City Attorney, determine that the amount of the securities on deposit, are not equal to or greater than the Estimated Retention, the Contractor shall within a reasonable time, upon the request of the City, deposit additional securities, so that the amount of securities on deposit with the City or escrow agent is equivalent or greater in value than the amount

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 5 of Estimated Retention. Upon satisfactory completion of the Contract, which shall mean, among other things, that the City is not otherwise entitled to retain proceeds from progress payments as elsewhere provided in the Contract or under applicable law, the securities shall be returned to the Contractor.

2. Deposit of Retention Proceeds with an Escrow Agent As an alternative to the substitution of securities, as provided in (A)(1) above, or the City otherwise retaining and holding retention proceeds from progress payments, the Contractor may request the City to make payments of retentions earned directly to an escrow agent with the same qualifications as required in paragraph (A)(1) above and at the expense of the Contractor. At its sole expense, the Contractor may direct the investment of such retention payments into only such securities as mentioned in paragraph (A)(3) below and shall be entitled to interest earned on such investments on the same terms provided for securities deposited by the Contractor. Upon satisfactory completion of the Contract, which shall mean when the City would not otherwise be entitled to withhold retention proceeds from progress payments had the Contractor not elected to have such proceeds deposited into escrow, the Contractor shall be allowed to receive from the escrow agent all securities, interest, and payments deposited into escrow pursuant to the terms of this section. The Contractor shall pay to each subcontractor, not later than twenty (20) days of receipt of the payment, the respective amount of interest earned, net of costs attributed to retention withheld from each subcontractor, on the amount withheld to insure performance of the Contractor.

3. Securities eligible for investment Securities eligible for investment shall include those listed in California Government Code Section 16430, bank or savings and loan certificates of deposit, interest bearing demand deposit accounts, standby letters of credit, or any other security mutually agreed upon between the Contractor and the City. The Contractor shall be the beneficial owner of any securities substituted for any monies withheld and shall receive any interest thereon.

4. Escrow Agreement for security deposits in lieu of retention The Escrow Agreement that shall be used for the deposit of securities in lieu of retention shall substantially conform to the form prescribed in California Public Contract Code Section 22300(e).

5. Inconsistencies with prevailing statutory requirements If there is any inconsistency between or differences in Public Contract Code Section 22300 and the terms of this provision, or any future amendments thereto, Section 22300 shall control.

B. RELEASE OF RETENTION PROCEEDS:

Retention proceeds withheld by the City, or by the Contractor from any subcontractor shall be governed by California Public Contract Code, Section 7107. Within sixty (60) days after the date of completion of the Work covered by the Contract, the retention withheld from the Contractor shall be released, unless the City decides to continue to withhold such proceeds, as provided for within the Contract. In the event of a dispute between the Contractor and the City involving the Work, the City may withhold an amount from the retention payment that shall not exceed 150 percent (150%) of the estimated value of the disputed amount from final payment to the Contractor. The date of completion of the Work shall mean any of the following:

1. The occupation, beneficial use, and enjoyment of the Work by the City, excluding any operation only for testing, startup, or commissioning, by the City, or its agent,

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 6 accompanied by cessation of labor on the Work;

2. The acceptance by the City, or its agent, of the Work;

3. After the commencement of the Work, a cessation of labor on the Work for a continuous period of one-hundred (100) days or more, due to factors beyond the control of the Contractor; or

4. After the commencement of the Work, a cessation of labor on the Work for a continuous period of thirty (30) days or more, if the City files and records a "Notice of Cessation" or "Notice of Completion" with the Los Angeles County Recorder’s Office.

The Contractor may withhold from a subcontractor its portion of the retention proceeds if a bona fide dispute exists between the Contractor and the subcontractor. Otherwise, payment must be made within ten (10) days from the time that any retention proceeds are received by the Contractor. The amount withheld from the retention payment shall not exceed 150 percent (150%) of the estimated value of the disputed amount. In the event retention payments are not made within the required time periods, the City or the Contractor withholding the unpaid amounts shall be subject to a charge of two percent (2%) per month on any improperly withheld amounts in lieu of interest otherwise due.

In any action for the collection of funds improperly withheld, the prevailing party shall be entitled to attorney’s fees and costs.

SP-8 LIQUIDATED DAMAGES
Liquidated damages will be assessed in accordance with Section 6-9 of the Standard Specifications at the rate of $500 per Calendar day. Payments made by the City after the scheduled completion date does not constitute a waiver of liquidated damages.

In addition to liquidated damages for Contract Completion, the Contractor shall be subject to liquidated damages in the amount of Five Hundred Dollars ($500) per Calendar Day for failure to comply with the following construction phasing requirements:

A. Horse Wash Rack Restoration
The interruption of operation of any horse wash rack shall not exceed twenty-one (21) consecutive Calendar Days. The twenty-one (21) day period shall commence on the first day the horse wash rack is rendered unavailable for its intended use.

The horse wash rack shall be considered restored when it is fully operational, safe for public use, and available for equestrian use.

Liquidated damages in the amount of Five Hundred Dollars ($500) per Calendar Day shall be assessed for each Calendar Day beyond the twenty-one (21) day period that the horse wash rack remains unavailable for equestrian use.

B. Sewer and Storm Drain Trenches
All sewer line and storm drain trenches opened during a work shift shall be backfilled, compacted to not less than ninety percent (90%) relative compaction, and brought flush with the adjacent finished surface by the end of the same work day. The only exception is on the paved section of

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 7 Horsethief Canyon Park Rd. The contractor may use shoring and plates. Plates shall not be in place for more than 5 calendar days.

Liquidated damages in the amount of Five Hundred Dollars ($500) per Calendar Day shall be assessed for each trench location that remains open, unbackfilled, or not brought flush with the adjacent surface beyond the end of the work day, unless otherwise authorized in writing by the Engineer.

C. Barn-to-Main Office Paving Operations
All asphalt paving operations, including asphalt removal, subgrade preparation, subgrade compaction, aggregate base placement, and final asphalt paving, within the area between the barn and the main office as shown on Sheet 4 shall be completed within five (5) consecutive Calendar Days.

Work within this area shall commence on a Monday and shall be scheduled such that all paving operations are completed prior to the following weekend.

Liquidated damages in the amount of Five Hundred Dollars ($500) per Calendar Day shall be assessed for each Calendar Day that the paving operations exceed the five (5) Calendar Day limit.

SP-9 DISPUTE RESOLUTION
Section 20104 et seq. of the California Public Contract Code prescribes a process for utilizing informal conferences, nonbinding judicially supervised mediation, and judicial arbitration to resolve disputes on construction claims of $375,000 or less. In the case of a dispute between the Contractor and the City in regards to this Contract, the requirements of Section 20104 et seq. of the California Public Contract Code shall apply.

SP-10 PROTECTION OF WORK AND MATERIALS
In addition to the requirements of Section 4-1.2 of the Standard Specifications, the Contractor shall be responsible for the protection of the Work until it has been inspected and accepted by the City Engineer. Any Work damaged or destroyed prior to acceptance of the Work shall be replaced at the Contractor’s expense and to the satisfaction of the City Engineer. This requirement pertains to all sections of the Contract.

The Contractor’s attention is directed to Section 7105 of the Public Contract Code of the State of California prohibiting assignment of responsibility to the Contractor for repairing work damaged by an act of God, in excess of 5% of the contracted amount, provided that the Work damaged is built in accordance with accepted and applicable building standards, and the plans and specifications of the City.

SP-11 SOUND CONTROL REQUIREMENTS
The Contractor shall comply with all local sound control and noise level rules, regulations and ordinances which apply to any work performed by the Contractor. The noise level from the Contractor’s operation, between the hours of 8:00 p.m. to 6:00 a.m., shall not exceed 86 dBA at a

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 8 distance of 50 feet. This requirement in no way relieves the Contractor from responsibility for complying with local ordinances regulating noise level. Said noise level requirement shall apply to all equipment for the Work or related to the Work, including but not limited to trucks, transit mixers or transient equipment that may or may not be owned by the Contractor. No internal combustion engine shall be operated on the project without a muffler. The use of loud sound signals shall be avoided in favor of light warnings except those required by safety laws for the protection of personnel.

SP-12 STREET SIGNS
During period of construction, the Contractor will be responsible for any damage caused to street signs and stop signs within the area of the Work. If the nature of the Work requires the removal of street signs or stop signs, the Contractor may deliver the signs to the City Maintenance Yard for storage. All signs will be reinstalled as directed by the City Engineer.

SP-13 TRAFFIC CONTROL
The Contractor shall comply with all the requirements of Section 7-10 of the Standard Specifications, Subsection 56-2 of the Caltrans Standard Specifications, and the current requirements set forth in the “Manual of Traffic Controls for Construction and Maintenance Work Zones” published by the Department of Transportation, State of California, and to provide all barricades, pedestals and other means necessary to provide the safety of the public and the control of traffic. Flasher units on barricades shall have a twelve (12) volt system. In addition, the Contractor must be prepared to provide additional traffic control measures when necessary for any condition that may arise during the construction period. Failure to provide adequate safety devices, as directed by the City Engineer, will cause the City to install safety devices as needed at the cost of $50 per location per day, and said cost will be assessed to the Contractor.

A. PROTECTION OF WORK AND PUBLIC
The Contractor shall take all necessary measures to protect the Work and prevent accidents during any and all phases of the Work. If deemed necessary by the City, the Contractor shall repair the damaged area in accordance with these special provisions.

Should the Contractor appear to be neglectful or negligent in furnishing warning and protective devices, the City Engineer may direct attention to the existence of a hazard and the necessary warning and protective measures shall be furnished and installed immediately by the Contractor at their expense. Should the City point out the inadequacy of warning and protective measures, such action on the part of the City Engineer shall not relieve the Contractor from responsibility for public safety or abrogate their obligation to furnish and pay for these devices. If the Contractor fails to provide such devices, the City Engineer will place the devices or cause the devices to be placed.

The cost of placing such devices shall be the sole responsibility of the Contractor and shall be paid for at the rate of $45/hour for labor and vehicle use, $15/day per barricade and any other costs incurred by the City relative to traffic control. The costs shall be deducted from the total Contract price for the Work.

B. CONSTRUCTION SIGNING
Construction signing shall consist of furnishing, installing, maintaining and removing construction signs and barricades as required by the California Manual of Uniform Traffic Control Devices (CA M.U.T.C.D.). The traffic control system shall be installed prior to starting the Work and shall not be removed until all the Work has been completed.

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 9 C. TRAFFIC MAINTENANCE
The Contractor shall be responsible for handling vehicular and pedestrian traffic in accordance with Section 5-7, 600 and 601 of the Standard Specifications and these Special Provisions.

All trucks which the Contractor proposes to use that exceed the legal load limit, when loaded, will be required to have overweight permits from the City prior to using City streets.

The Contractor shall prepare any additional traffic control plans to compliment the approved traffic control plans included in the bid set as needed. Any additional traffic control plans shall be submitted to the City for approval at least five (5) days prior to commencement of the Work. The traffic control plans shall show:

1. Existing and temporary lane lines;

2. Dimensions of the Work zone and street improvements;

3. Advance warning signs on all streets under construction and all side streets that intersect with these streets; and

4. Delineators.

The traffic control plan shall indicate the sequence of lanes or portions of lanes being closed, and the travel plan for each phase of the Work.

The traffic control plans shall:

1. State that the traffic control plan conforms to the "California Manual of Uniform Traffic Control Devices (CA MUTCD);

2. Identify the emergency contact person and their phone number.

3. Provide the minimum required lane widths and clearances to obstructions.

The Contractor shall cooperate with the City Engineer in handling traffic through the Work area and the Contractor shall make arrangements to assure the Work area is clear of parked vehicles and maintain clear access to driveways.

The Contractor shall provide controlled pedestrian crossings through the Work. Crossings shall provide pedestrians a means of passing over or through the Work without endangering pedestrian safety.

The Contractor shall use the required number of barricades to close those areas where the subgrade has been prepared and left overnight prior to installing the pavement surface. The use of cones will not be permitted.

A detour sign will be required for intersections if the delay for the intersections cross-street will be substantial. The detour sign shall include installation of advance signing displaying the anticipated delay time. The sign shall be installed on the cross street and the street where the Work is performed shall be barricaded to through traffic. A detour sign will not be required if a cross road only needs a temporary closer no more than five (5) minutes as the Work progresses through the intersection.

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 10 The signing of the detour route shall be approved by the City Engineer prior to installation of the detour and closure of the road.

The Contractor's equipment and personal vehicles of the Contractor's employees shall not be parked on the traveled way at any time. Overnight parking of construction equipment in the Work zone or on adjacent roads is not permitted. Parking of construction equipment shall be confined to the approved storage site.

D. STRIPING
Temporary striping and marking for traffic control shall conform to Section 310-5.6.5 of the 2009 Standard Specifications. Temporary striping and marking which has no further use shall be removed by wet sandblasting, and all sand used in sandblasting shall be removed without delay as the sandblasting operation progresses.

Temporary Pavement Markers (Removable Tabs):

The Contractor shall furnish and install removable traffic tabs every 10 feet when any permanent striping is removed, destroyed or covered due to construction activities. Also, temporary removable traffic tabs shall be installed at location where a stop bar or crosswalk is removed, destroyed or covered due to construction activities. The contractor shall maintain all tabs until permanent striping is installed and/or replaced. The contractor shall remove all temporary traffic tabs, so as not to disturb or destroy the asphalt concrete, during the course of placing the permanent striping legends.

Temporary Overlay/Pavement Markers (TOMs) shall be installed prior to removing traffic control devices, including detours.

E. RESTRICTIONS ON CLOSURE OF STREETS AND TRAFFIC LANES The Contractor shall conduct all operations so as to provide reasonable access to the adjoining properties with a minimum of inconvenience to the public by having no greater length or quantity of the Work under construction than can be properly prosecuted. No trench shall be left open overnight.

Trenches shall be plated or backfilled flush at the end of each working day.

The contractor shall maintain access to the equestrian stalls and offices at all times with the exception of areas that are under active construction. All trenches to be backfilled at night.

The Contractor shall provide steel plates and construct temporary A.C. ramps where necessary to provide safe and drivable access to residents and businesses.

F. PAYMENT
Payment for traffic control and protection of the work area including the furnishing all materials, labor, equipment and all incidentals necessary to complete the Work in accordance with the Standard Specifications and these special provisions shall be INCLUDED IN BID ITEM 2 IN THE BIDDER’S PROPOSAL AND NO ADDITIONAL COMPENSATION WILL BE ALLOWED. The Contractor shall include the cost of temporary striping and all traffic markings and legend as shown on the plans.

In the event that the Director of Public Works approves a temporary road closure, the Contractor shall notify effected residences and business and the following agencies at least 48 hours in advance:

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 11 San Dimas Sheriff Station Local Fire Authority
San Dimas Hospital Bonita Unified School District
Road Closures shall be kept to a minimum, and shall only be allowed where necessary for the Work scheduled for that day. The Contractor shall post notification of the road closure using a changeable message sign forty-eight (48) hours prior to and throughout the closure. Sign verbiage must be approved by the Director of Public Works. The Contractor shall only open the length of trench that the Work can be completed on and the trench backfilled that same day.

SP-14 RESPONSIBILITY TO THE PUBLIC
Due to the nature of this project involving some inconvenience to residents, a good Public Relations Program is mandatory and evidence of satisfactory past performance in this area will be required.

Payment for this item shall be included in the contractor’s Mobilization costs.

A. PUBLIC CONVENIENCE
At least ten (10) calendar days prior to commencing work, the Contractor shall submit a construction schedule to the City for approval. Based on the construction schedule, the Contractor will notify residents, and businesses of the Work and post temporary "NO PARKING" signs at no cost to the City. Signs will be posted at all intersections and along street at a maximum of 200 feet between signs. Signs may be attached to existing poles or street light standards, but when necessary the Contractor shall furnish posts. The "NO PARKING" signs shall be placed not less than twenty-four (24) hours prior to performing the Work; therefore, a request for changes in the schedule requiring additional posting shall be submitted by the Contractor for approval by the City Engineer at least forty-eight (48) hours prior to the Work.

Contractor shall coordinate construction schedule with Sycamore Canyon Equestrian Center Staff and City a minimum of 7 days prior to work.

The Contractor shall provide access to all stalls/barn area during non-working hours.

B. PROPERTY DAMAGES AND INDEMNIFICATION
a. Contractor shall indemnify, defend and hold harmless City/Government Agency and its officers, employees, and agents (collectively, the "Indemnified Parties") from and against any and all losses, damages, liabilities, costs, and expenses, including reasonable attorneys' fees, arising out of or in connection with any claim, suit, action or proceeding brought by any third party for damages to private property caused by Contractor's work. b. The Contractor shall process and resolve all claims reported or submitted by the public as follows:

1. Contractor shall provide contacts to the City and upon request to the public for submittal of all claims related to this project.

2. Contractor shall be responsive to any resident/private owner claims regarding such damages and shall provide a written response to the claimant and City within five (5) business days after receipt of the claim.

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 12 3. Contractor shall use best efforts to resolve all claims within thirty (30) business days after receipt of the claim.

4. Contractor to submit to the City a copy of the claim, a written analysis of the claim, and a statement indicating whether or not you will pay the claim. If the claim is rejected, provide the reasons for rejection in writing.

5. Contractor acknowledges and agrees that failure to be responsive to resident/private owner claims in accordance with SP 14 Section B shall result in liquidated damages of fifty dollars ($50) per day for each day beyond the first five business days that Contractor fails to provide a written response to the claimant.

SP-15 EXISTING UTILITIES
Facilities of individuals or entities known to have utilities in the Work area are shown on the plans in their approximate location, in those Work areas where conflict is anticipated; however, not all the locations of subsurface utilities are shown on the plans. It is the Contractor’s responsibility to ascertain and determine, at his own risk, the true location of all facilities and utilities in the Work area.

The following is a list of individuals or entities which may have facilities or utilities in the Work area.

This list is merely informational for the Contractor and may or may not be complete or inclusive:

Sanitary Sewers/Storm Drain City of San Dimas
L.A. County Department of Public Works
L.A. County Sanitation District
Water Golden State Water Co.

Metropolitan Water District
Gas Southern California Gas Company
Electricity Southern California Edison
Telephone Spectrum
Frontier
Underground Service Alert Members (800) 422-4133
Prior to any construction, the Contractor shall pothole and locate existing utilities within the Work area.

SP-16 HIGHWAY CONSTRUCTION PERMIT
Pursuant to the authority contained in Section 591 of the State of California Vehicle Code, the City has determined that, within such areas as are within the limits of the Work and are open to public traffic, the Contractor shall comply with all the requirements set forth in Divisions 11, 12, 13, 14, and 15 of the Vehicle Code. Attention is directed to the statement in Section 591 of said code which does not relieve any person from the duty of exercising due care. The Contractor shall take all necessary precautions for the safe operation of his equipment and the protection of the public from injury and damage from such equipment.

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 13 SP-17 BEST MANAGEMENT PRACTICES
In compliance with the Federal Clean Water Act, the Contractor will be required to implement Best Management Practices (“BMPs”) to prevent and control the entry of pollutants of non-stormwater runoff into the City’s storm drain system. The Contractor is hereby advised that the City has adopted Ordinance No. 1017 to regulate Urban Runoff Pollution. The Contractor is further advised that the City has established BMPs to be employed at construction sites, and also has available for the Contractor copies of the, “Stormwater Best Management Practice Handbook,” published by the California Stormwater Quality Association (CASQA), an introductory guide to stormwater quality control on construction sites, which contains several principles and techniques that can be used to help prevent stormwater pollution.

SP-18 PRE-WORK CONFERENCE
Prior to commencement of the project, but after award of the contract, the Contractor must contact the Public Works Department at (909) 394-6240 to arrange for a pre-construction conference. The contractor shall have all submittals turned into the City prior to the end of the pre-work conference.

These submittals shall include at a minimum:

1. Traffic Control Plans

2. Emergency (24 hour) contact information for Contractor’s Project Manager and on-site foreman

3. Mix Designs for Asphalt Concrete, Portland Cement Concrete, Masonry Block, Rebar, Street Lights, Conduit, Pull Boxes, Electrical Wiring, Connectors and all other material submittals.

4. Construction Work Schedule, CPM (Critical Path Method) including sequence of work

5. Neighborhood Construction Notification Letters

6. Truck/Haul Routes
SP-19 PROJECT PHASING AND ADDITIONAL COORDINATION
Construction sequencing and phasing requirements shall include the following:

A. No adjacent driveways to be closed at the same time. Maintain one driveway for access at all times.

B. All work shall be ramped to allow for truck/horse trailer access when not in active construction.

C. All work to be done is within an active park and equestrian area. Contractor must take extra precautions to protect work area. Excavations must be covered and fenced if left unattended at any time.

D. One wash rack to remain serviceable and available for equestrian use at all times. Contractor may coordinate for temporary relocation of wash racks with Sycamore Canyon Equestrian Center Operator.

E. All pavement seams shall be approved by the City Engineer.

F. Minimum notice before paving operations (removals or paving) is 7 calendar days.

G. Contractor to assist in coordination, provide and maintain access for pickup of trash collection.

H. All trenching shall be backfilled at the end of each day.

I. Contractor to trim trees near wash racks as necessary to remove interfering branches. Extent of Trimming to be approved by City Arborist prior to work. Tree must be left balanced.

J. Contractor vehicles or heavy equipment shall not drive over non HS20 rated bridges (wooden bridnge on Sheet 3) or over any crossings over drainage channels. Contractor shall protect

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 14 existing crossings and bridge within the equestrian center from damage due to construction related activity.

K. The City will provide initial survey. The contractor must protect all survey stakes/markings and shall re-establish destroyed markings at the contractor’s expense.

L. The City does not have As-Built drawings or other documentation of the existing bathroom building shown on Sheet 3 that is to be demolished.

M. The City shows up to 3 inches of asphalt paving under the northerly drive aisle on Sheet 4.

Contractor to include all cost for removal of the asphalt as part of Bid Item 3: General Earthwork and Unclassified Excavation.

N. The Project Plans and Specifications include 9 Plan Sheets and 56 pages of Specifications and Contract Documents and an Appendix A with standard plans and an Appendix B with the Jensen Clarifier details.

O. Following are dates of upcoming horse shows that the contractor must restore full use of adjoining areas to the upper square arena and the Main Jumping Arena :
o August 22, 2026
o September 19, 2026
o November 7, 2026

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 15 INSTRUCTIONS TO BIDDERS
IB-1 SECURING DOCUMENTS
The Contract Documents are available for examination without charge in the Public Works Department, and copies may be obtained from the Public Works Department in the manner specified in the "Notice Inviting Bids."
IB-2 EXAMINATION OF PLANS, SPECIFICATIONS & SITE OF WORK The bidder is required to carefully examine the plans, specifications, and the Work site. It will be assumed that the bidder has investigated and is satisfied as to:

A. The conditions to be encountered, including all installations and utilities, whether underground, surface, or overhead;
B. The character, quality, and quantities of work to be performed and materials to be furnished; and
C. The requirements of the plans, the specifications, the special provisions, and the Contract.

It is mutually agreed that submission of a proposal shall be considered prima facie evidence that the bidder has made such examination.

The plans show conditions as they are believed to exist, but the Contractor is not to infer that all of the conditions as shown actually existent, nor shall the City or any of its officers be liable for any loss sustained by the Contractor as a result of any variance between conditions shown on the plans and actual conditions revealed during examination or progress of the Work.

Each bidder is hereby notified of a mandatory pre-bid meeting on Monday June 15 at 10:30 a.m. The location of the mandatory pre-bid meeting will be at the intersection of Horsethief Canyon Park Rd and Sycamore Canyon Road.

All questions or comments regarding this project shall be submitted via mail, email, or fax and shall be received prior to 11:00 a.m., Thursday, June 25th, 2026.

IB-3 INTERPRETATION OF DRAWINGS AND DOCUMENTS
If any bidder finds discrepancies in, or omissions from the plans, specifications, the special provisions or other proposed Contract Documents, or if the bidder should be in doubt as to the true meaning of any part of the Work, they shall at once make a written request to the City Engineer for correction, clarification, or interpretation of the point(s) in question. The person submitting such request shall be responsible for its prompt delivery. Requests for clarification, interpretation or correction must be received a minimum of 2 business days prior to the bid opening in order to allow time for a written response from the City.

In the event that the City Engineer receives such a request, and it should be found that certain essential information is not clearly and fully set forth, or if the City Engineer discovers errors, omissions, or points requiring clarification in the plans, specifications, special provisions, or other related Contract Documents, a written addendum will be mailed to each person to whom a set of Contract Documents has been delivered. The City Council will not be responsible for any

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 16 instructions, explanations, or interpretations of the Contract Documents presented to bidder in any manner other than by written addendum.

IB-4 ADDENDA OR BULLETINS
The effect of all addenda to the Contract Documents shall be considered in the bid, and said addenda shall be and are made a part of the Contract Documents, and shall be returned with them. Before submitting their bid, each bidder shall be responsible to discover whether or not any addenda have been issued, and the bidder’s failure to include any such addenda issued shall render their bid informal, and result in its rejection.

IB-5 BID PROPOSALS
The Contractor shall submit a bid proposal for the Work in accordance with the Bidder’s Proposal included in these specifications. For each subcategory of Work as set forth in the Bidder’s Proposal, all bidders are to provide a subtotal for such work by multiplying the given estimated quantities of Work, as indicated in the Bidder’s Proposal, by the unit prices as submitted by the bidders. In the case of a math error whereby the subtotal for any such work does not equal the quantity of work times the provided unit price, the unit price shall prevail and bids will be computed based upon the unit price and compared on the basis of the corrected subtotals. The award will be made to the lowest responsible bidder based on the "Total of Base Bid Items", as may be corrected and adjusted by the City as set forth herein.

IB-6 LICENSING OF CONTRACTORS
Before submitting any proposal, ALL persons, firms, partnerships or corporations shall be licensed in accordance with the provisions of Chapter 9 of Division 111, Business and Professions Code of the State of California, and any applicable ordinances of the City. For this project, the Contractor will be required to possess a “A” General Engineering Contractor’s License a “C8” Concrete License, a "C12" Earthwork and Paving License, or a “C34” Pipeline Contractor’s License. It is a misdemeanor for any unlicensed person to submit a bid in response to this invitation in the capacity of a Contractor (See Section 7028.15 of the Business and Professions Code of the State of California).

IB-7 PERMITS AND LICENSES
The Contractor and each of its subcontractors will be required to obtain a City of San Dimas business license to operate in the City. Additionally, the Contractor is required to obtain a City of San Dimas Encroachment Permit “No Fee” prior to commencing any work.

IB-8 TAXES
No mention shall be made of sales tax or use tax, as all bid prices submitted will be considered as including such tax.

IB-9 PROPOSALS
Before a bid will be considered, the bid must be made in accordance with the following instructions:

1. Bids shall be made upon the forms attached herein; all bid items shall be properly filled out; numbers shall be stated both in words and in figures, and the signatures of

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 17 all persons signing shall be in longhand. If there is a conflict in the bid item unit prices and bid item totals, the bid item unit prices shall govern. Should it be necessary to remove any of the bid document pages for typing the proposal, etc., they shall be reassembled and attached either by ring binder or by stapling together, and submitted.

2. All prices and notations must be in ink or typewritten. No erasures will be permitted.

Mistakes may be crossed out, and corrections typed or written with ink adjacent thereto, and must be initialed in ink by the person or persons signing the bid.

3. Any proposal which, in the opinion of the City Council, is so unbalanced between the various Contract items so as to be detrimental to the best interest of the City will be rejected.

4. Bids shall not contain any recapitulation of the Work to be done. No oral, telegraphic, or telephonic proposals of modifications will be considered.

5. Each bidder shall list his proposed subcontractors on the form accompanying the proposal in accordance with the provisions of the specifications.

6. Each bidder shall furnish a statement of his technical ability, experience, and references properly and fully filled out on the form provided.

7. The City Council may require any bidder to furnish a statement of his financial responsibility.

8. Each bidder must accompany their bid with either a Cashier's Check, upon some responsible bank, or a check upon such bank properly certified, or by a corporate Surety Bond meeting the requirements of Section 2-4 of the Standard Specifications, payable to the City of San Dimas for a sum of not less than ten (10) percent of the aggregate sum of the bid, which check or bond and the monies represented thereby shall be held by the city as a guarantee that the bidder, if awarded the Contract, will, in good faith, enter into such Contract and furnish the required bonds. The bidder agrees that, in case of his refusal or failure to execute the Contract and give the bonds within time limit set herein, after written notice that the Contract has been awarded to the bidder for the Work, such check or bonds and the money represented thereby, shall remain the property of the City. The surety will pay to the City the damages which the City may suffer by reason of the bidder’s failure, not exceeding the sum of ten (10) percent of the amount of the bid. A bid received and not accompanied by such Cashier's or Certified check, or approved bond shall be rejected.

9. Bids shall be delivered to the City Clerk, in the City Hall, on or before the day and hour set for the opening of bids, in the "Notice Inviting Bids," which bids shall be enclosed in a sealed envelope, and bearing the title of the Work and the name of the bidder.

10. Bid protests shall comply with City Municipal Code Section 3.30.080.

IB-10 DISQUALIFICATION OF BIDDERS
No person, firm or corporation shall be allowed to make, file, or be interested in more than one bid

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 18 for the same work unless alternate bids are called for. A person, firm, or corporation who has submitted a sub-proposal to a bidder, or who has quoted prices on materials to a bidder, is not hereby disqualified from submitting a bid in his own behalf.

IB-11 WITHDRAWAL OF BID
Any bidder may withdraw their bid in person or by written request at any time prior to the scheduled closing time for receipt of bids.

IB-12 OPENING OF BID PROPOSALS
The City Clerk will in open session publicly open, examine, and declare the bids at the time set forth in the "Notice Inviting Bids." Bidder or their authorized representatives are invited to be present.

IB-13 AWARD OF CONTRACT OR REJECTION OF BIDS
The Contract for the Work will be awarded to the lowest responsible bidder complying with these instructions and with the "Notice Inviting Bids." The City Council, however, reserves the right to reject any and all bids, and to waive any informality in the bids received. The City Council also reserves the right to withhold award for a period not to exceed ninety (90) days from the date the bids are received by the City Clerk of the City as specified in the "Notice Inviting Bids." IB-13.1 BID PROTESTS
To be considered, a bid protest must be filed in writing within 3 business days of the bid opening.

Only a contractor who has submitted a bid on the project may file a bid protest. The following items must be included in the bid protest:

1. The bid protest must be submitted in writing and signed by a legally authorized representative of the protesting company.

2. The bid protest must be sent or delivered to the attention of the City of San Dimas City Clerk at 245 E Bonita Ave, San Dimas, CA 91773.

3. The written bid protest must be received at the City no later than 3 business days after the bid opening.

4. The envelope containing the bid protest must reference “BID PROTEST” and the project name on the envelope.

5. A substantive description of the basis for the protest must be detailed in the written protest letter.

The City will review the Bid Protest and determine what further action is required.

IB-14 WORKMEN AND WAGES
Attention is specifically directed to all provisions of the Labor Code of the State of California with regard to workmen and wages. Wages shall be not less than the prevailing wage rates as determined by the City pursuant to the Labor Code.

The Contractor's attention is directed to the provisions California Labor Code Section 1775 whereby a Contractor shall, as a penalty to the City, forfeit not more than fifty dollars ($50) for each calendar day, or portion thereof, for each worker paid less than the prevailing rates as determined by the City Engineer for the Work or craft in which the laborer, workman or mechanic is employed for any public work done under the Contract by them or by any subcontractor under them.

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 19 The amount of this penalty shall be determined by the Labor Commissioner and shall be based on consideration of the Contractor's mistake, inadvertence, or neglect in failing to pay the correct rate of prevailing wages, or the previous record of the Contractor in meeting his or her prevailing wage obligations, or a Contractor's willful failure to pay the correct rates of prevailing wages.

This project is subject to compliance monitoring and enforcement by the Department of Industrial Relations. No contractor of subcontractor may be listed on a bid proposal for a public works project unless registered with the Department of Industrial Relations pursuant to Labor Code Section 1725.5 with limited exceptions for bid purposes only under Labor Code section 1771.1 (a). Additionally, no contractor or subcontractor may be awarded a contract for public work on a public works project unless registered with the Department of Industrial Relations pursuant to Labor Code section 1725.5.

IB-15 EMPLOYMENT OF APPRENTICES
The Contractor's attention is directed to the provisions in Section 1777.5 (Chapter 1411, Statutes of 1968) and 1777.6 of the Labor Code of the State of California concerning the employment of apprentices by the Contractor or any subcontractor under them.

Section 1777.5, as amended, requires the Contractor or subcontractor employing tradesmen in any apprenticeable occupation to apply to the joint apprenticeship committee nearest the site of the public works project and which administers the apprenticeship program in that trade for a certificate of approval. The certificate will also fix the ratio of apprentices to journeymen that will be used in the performance of the Contract. The ratio of apprentices to journeymen in such cases shall not be less than one to five, except:

1. When unemployment in the area of coverage by the joint apprenticeship committee has exceeded an average of 15 percent in the 90 days prior to the request for certificate; or

2. When the number of apprentices in training in the area exceeds a ratio of one to five; or

3. When the trade can show that it is replacing at least 1/30 of its membership through apprenticeship training or an annual basis statewide or locally; or

4. When the Contractor provides evidence that they employ registered apprentices on all of their contracts of an annual average of not less than one apprentice to eight journeymen.

The Contractor is required to make contributions to funds established for the administration of apprenticeship programs if they employ registered apprentices or journeymen in any apprenticeable trade on such contracts and if other contractors on the public works site are making such contributions.

The Contractor, of any subcontractor under them, shall comply with the requirements of Sections 1777.5 and 1777.6 in the employment of apprentices.

IB-16 NON-DISCRIMINATION IN EMPLOYMENT
In accordance with California Labor Code Section 1735, the Contractor shall not discriminate in the employment of persons engaged to perform the Work covered by the Contract because of race,

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 20 religious creed, color, nation of origin, ancestry, physical disability, mental disability, medical condition, marital status or sex of such person, except as provided for in Section 12940 of the Government Code of the State of California. If the Contractor is found to be in violation of Section 1735 while in performance of the Work, the Contractor shall be subject to all penalties imposed in Part VII, Chapter 1 of the California Labor Code and deemed to be in material breach of the Contract.

IB-17 EXECUTION OF CONTRACT DOCUMENTS
The Contract, in the form contained in the Contract Documents, shall be signed by the successful bidder and returned, together with a Performance Bond and a Material Bond as set forth below, within ten (10) days after the written notice that said Contract has been awarded to him for the Work.

No proposal shall be considered binding upon the City until the execution of the Contract, and the filing of the required bonds.

The Performance Bond shall be equal to one hundred percent of the Contract price and is to guarantee faithful performance of all work, within the time prescribed, in a manner satisfactory to the City, and that all materials and workmanship will be free from original or developed defects. The Performance Bond will remain in effect until the end of all warranty periods set forth in the Contract.

The Material and Labor bond shall be equal to one hundred percent of the Contract price and is to satisfy claims for materials, suppliers, and mechanics and laborers employed by the Contractor for this project. The Material and Labor Bond shall be maintained in full force and effect until the Work is accepted by the City and until all claims for materials and labor are paid, and shall otherwise comply with the Civil Code.

Failure to execute the Contract and to file bonds as provided herein within fifteen (15) days after notification of award by the City shall be just cause for the annulment of the award and the forfeiture of the proposal guaranty.

IB-18 RETURN OF BIDDER'S GUARANTEES
Proposal guarantees will be held until the Contract has been finally executed, after which they will be returned to the respective bidders whose proposals they accompany. The notice to bidders, proposals, bonds, instructions to bidders, general provisions, and detailed specifications shall be deemed incorporated in the Contract by reference.

Upon refusal or failure of the successful bidder to execute the Contract, the City may award the Contract to the next lowest responsible bidder. If the City awards the Contract to the next lowest bidder, the amount of the lowest bidder's security shall be applied by the City to the difference between the low bid and the next lowest bid, and the surplus, if any, shall be returned to the lowest bidder if cash or check is used, or to the surety on the bidder's bond if a bond is used.

IB-19 EXTRA WORK AND TIME AND MATERIAL
All Extra Work claims shall be submitted in the format provided in Appendix B. Any item considered to be extra work must be reported to the City immediately. Work will not be considered as an Extra Work item unless the city is immediately notified (within 10 minutes of encountering the extra work condition) and the report form in appendix B is completed and filed within 24 hours of encountering the extra work. Submittal of false claims is punishable by State law and in addition, the contractor shall reimburse the City for all employee costs and other fees spent on researching and reconciling the false claim.

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 21 All equipment used for extra work items will be paid at the current Caltrans Equipment rates.

Labor surcharge will be paid at Caltrans rates. Submittal of this bid proposal is agreement to these conditions.

A. WORK BY CONTRACTOR
The following percentages shall be added to the Contractor’s costs and shall constitute the markup for all overhead and profits:

1) Labor 15%
2) Materials 15%
3) Equipment Rental 15%
4) Other Items and Expenditures 15%
B. WORK BY SUBCONTRACTOR
When all or any part of the extra work is performed by a Subcontractor, the markup established in 3-3.2.3(a) shall be applied to the Subcontractor’s actual cost of such work. A markup of 10 percent on the first $5,000 of the subcontracted portion of the extra work and a markup of 5 percent on the Work added in excess of $5,000 of the subcontracted portion of the extra work may be added by the Contractor.

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 22 CONSTRUCTION CONTRACT NO. 2025-07 II

HORSETHIEF CANYON WATER QUALITY

MANAGEMENT IMPROVEMENTS

DESCRIPTION OF BID ITEMS
MOBILIZATION AND NPDES/SWPPP REQUIREMENTS – BID ITEM 1
The following items of work shall be included in the lump sum bid for this item and no additional compensation will be allowed:
a. Mobilization and Demobilization
b. Schedule
c. Material and Equipment Storage
d. NPDES/SWPPP and erosion control requirements
e. Clearing and Grubbing
The work included in this item shall consist of all the work described in Section 7-3.4, “Mobilization” and Section 300-1, “Clearing and Grubbing”, of the Standard Specifications for Public Works Construction, latest edition, hereafter referred to as Standard Specifications.

This Bid Item shall include, but not be limited to, the cost to secure bonds and insurance’s, movement of personnel, equipment, materials and incidentals to and from the project sites, securing a temporary construction yard, maintaining the project in a safe, clean and orderly manner during construction and final cleanup of the work and staging sites. Brush and other organic matter shall be removed from the area of the proposed improvements and from any area where soils or construction materials will be stockpiled. No material or equipment shall be stored where it will interfere with the safe passage of public traffic and at the end of each day’s work; the Contractor shall remove all equipment and other obstruction from that portion of the roadway used by public traffic.

This Bid Item is to include any and all work required to keep the public right-of-way, adjoining properties and downstream drainage improvements free of construction debris and silt.

The contractor shall provide onsite temporary bathroom facilities (Porta Potty) for the contractor’s personnel. No use of the Equestrian Center bathroom facilities by contractor personnel is alloed. Location of the temporary bathroom facilities shall be reviewed and approved by the City. Temporary bathroom facilities shall be included in the price of Bid Item 1.

The work included in this item shall also include all the work to satisfy NPDES/SWPPP and erosion control requirements. No additional amounts shall be paid for erosion control, erosion damage cleanup, removal of debris from the project site, NPDES/SWPPP

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 23 requirements (including the plan), or removal of soil deposited on public streets by construction traffic. The contractor shall prepare and submit the SWPPP for city review and approval. All costs for SWPPP preparation and implementation shall be paid under this bid item. The SWPPP shall be submitted and approved by the City prior to commencement of construction. All NPDES compliance shall be per the construction general permit, order No. 2012-0006-DWQ. All required NPDES regulations shall be complied with, including, but not limited to:
a) Storm or construction generated water containing sediment such as construction waste, soil, slurry from concrete/asphalt concrete saw cutting operations, clean up of concrete transit mixers or other pollutants from construction sites and parking areas shall be retained or controlled on site and shall not be permitted to enter the storm drain system.
b) Temporary sediment filtering systems such as sandbags, silt fences, stabilized construction entrance, or gravel berms shall be utilized to trap sediment so that only filtered water enters the City’s storm drain system. Proper cleanup and disposal of settled sediment and the filtering system shall be the responsibility of the Contractor.
c) Discharge of concrete transit mixer wash water on to approved dirt areas (subgrade area designated for new concrete construction, for example) is acceptable.

Discharge onto private property, parkway areas, or the street is not permitted. d) Plastic or other impervious covering shall be installed where appropriate to prevent erosion of an otherwise unprotected area, along with any other runoff control devices deemed appropriate by the City.
e) Excavated soil stored on the site shall be covered in a manner that minimizes the amount of sediments running into the storm drain system, street, or adjoining properties.
f) No washing of construction or other industrial vehicles and equipment shall be allowed adjacent to a construction site.
g) During the rainy season (October 15 to April 15), the Contractor shall keep at the construction site sufficient materials and labor to install temporary sediment filtering systems and other water pollution prevention control measures. These control measures shall be in place and maintained by the Contractor on a daily bases on days when construction is not in progress due to rain. h) All costs associated with water pollution shall be borne to the Contractor. Any expense incurred by the City to expeditiously respond to storm drain contamination resulting from Contractor’s failure to implement water pollution control measures will be charged to the Contractor.
i) BMPs must conform to the most recent edition of the California BMP Handbook (www.cabmphandbooks.com).

Spillage resulting from hauling operations along or across any public traveled way shall be removed promptly.

Should the Contractor fail to provide and maintain these devices and services for the entire duration of the project and the City is required to alleviate said condition, the total charges for labor, equipment and materials, including overhead and transportation, accrued by the

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 24 City for such work will be deducted from the contract payments to the Contractor.

CLEARING AND GRUBBING
Also included in this bid item is clearing and grubbing per Section 300-1, “Clearing and Grubbing” of the Standard Specifications not otherwise included in the individual bid item.

Payment for this Bid Item shall be on a lump sum basis. Full compensation for conforming to the requirements of this section, not otherwise provided for, shall be considered as included in the prices paid for the various contract items of work involved, and no additional compensation will be allowed therefore.

TRAFFIC CONTROL – BID ITEM 2
This Bid Item must include all material, equipment, and labor necessary to provide traffic control to fully protect the public from danger due to the work being done. Work under this, must include the furnishing, installation and maintenance of all traffic control devices and equipment necessary in the opinion of the Engineer and as stated below to maintain the flow of vehicular, equestrian and pedestrian traffic through and around the work area. This must also include the installation of temporary fencing, temporary lane delineations and various temporary striping required prior to opening the roadway to vehicular traffic.

The contractor shall submit Temporary Traffic Control Plans for work on this project. Costs for the design, installation, maintenance and removal of temporary traffic control shall be included in this bid item.

At least 10 calendar days prior to commencing the work, the Contractor shall submit to the Engineer his proposed schedule for street closures, lane closing and his methods of traffic control. Lane closures shall be per the "CALIFORNIA MANUAL OF UNIFORM TRAFFIC CONTROL DEVICES (CA MUTCD), LATEST EDITION. This submittal by the Contractor will allow for an advanced review of the Contractor’s proposed traffic control. “Acceptance” of the Contractor’s traffic control plan does not constitute an acceptance of liability on the part of the City. The Contractor is solely responsive for ongoing safety at the job site regardless of the traffic control plan.

Included in this item are any costs associated with construction activities required to conform to the notes on the construction plans and instructions in these specifications. This includes transportation of any equipment necessary to complete the construction. The contractor is hereby advised to include all transportation and delay costs associated with meeting the timelines and schedules (as outlined in SP-13 and SP-19) in this bid item.

Section 600 of the Standard Specifications is amended by Addition of the Following:

The Contractor shall furnish all flagman and guards, and supply and install all signs, lights, barricades, delineators, and other facilities which are necessary to expedite the passage of public traffic through or around the work, or to prevent accidents or damage or injury.

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 25 In no case shall traffic be diverted from the existing traveled way without prior approval of the Engineer.

The Contractor shall provide and maintain all signs, barricades, pedestals, flashers, delineators and other necessary facilities for the protection of the motoring public within the limits of the construction area. All signs to be used on the job during hours of darkness shall be reflectorized. All signs, barricades and methods shall conform to the requirements of the current “California Manual on Uniform Traffic Control Devices” (CA MUTCD).

The Contractor shall supply and post signs at each entrance to the construction work locations to warn motorists of possible safety hazards. The signs shall be of sufficient size and shall be mounted in such a way to be readable by the motorists.

No material or equipment shall be stored where it will interfere with the safe passage of public traffic and at the end of each day’s work. The Contractor shall remove all equipment and other obstructions from that portion of the roadway used by public traffic.

The contractor shall work to alleviate traffic congestion during rain events by minimizing obstructions to both pedestrian and vehicle flow. The contractor shall adjust traffic control devices and best management practices (BMPs) to prevent interference with the natural flow of water on sidewalks and roadways.

Should the Contractor fail to provide and maintain these devices and services and the City is required to alleviate said condition, the total charges for labor, equipment and materials, including overhead and transportation, accrued by the City for such work will be deducted from the contract payments to the Contractor.

Action on the part of the Engineer in directing the Contractor’s attention to inadequacy of the required devices and services or any action of the City to alleviate the Contractor’s inadequacies shall not relieve the Contractor from responsibility for public safety or abrogate the obligation to provide and maintain these devices and services.

There shall be no trench plates in unpaved areas. Trench plates may be used on Horsethief Canyon Park entrance road.

The contractor must maintain access to occupied equestrian stalls. Sewer trenches must be backfilled and compacted by the end of each day.

Payment for this Bid Item shall be on a lump sum basis. Full compensation for conforming to the requirements of this section, not otherwise provided for, shall be considered as included in the prices paid for the various contract items of work involved, and no additional compensation will be allowed therefore.

GENERAL EARTHWORK AND UNCLASSIFIED EXCAVATION, REMOVALS, CONSTRUCT GRADED SWALE AT 2% MINIMUM AROUND SHELTER – BID ITEM 3, 16

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 26 The work included in this item shall consist of all the work described in Section 300-1, "Clearing and Grubbing", Section 300-2, “Unclassified Excavation”, Subsection 300-4, “Unclassified Fill,” and Subsection 301-1.5,” Grading of Areas Not To Be Paved” and Section 401, “Removal” of the Standard Specifications.

Brush and other organic matter shall be removed from the area of the proposed improvements and from any area where soils or construction materials will be stockpiled.

Grading and Unclassified Excavation shall consist of all excavation and embankment, including roadways and shoulders, unless separately designated. Fill shall be placed to the top of curbs and graded to provide positive drainage within the right of way and to existing swales.

This Bid item is to include any grading necessary along the shoulders of the road to eliminate any ponding or edge drops, any grading necessary around the new shelter and wash rack to provide positive flow away from the new grated inlet (Sheet 4), any grading necessary of the existing parking lot to provide positive flow to the new grated inlet (Sheet 5), any grading necessary of the existing access road to provide positive drainage to the existing brow ditch (Sheet 5), any grading of the horse corral necessary to provide positive flow to the new concrete apron (Sheet 6), and any grading necessary to restore the parkway after installation of the stormwater retention device and storm drain (Sheet 8).

The City shows up to 3 inches of asphalt paving under the northerly drive aisle on Sheet 4.

Contractor to include all cost for removal of the asphalt as part of Bid Item 3: General Earthwork and Unclassified Excavation.

This Bid Item is to include any and all work required to keep the public right-of-way and adjoining properties free of construction debris and silt.

Payment for this Bid Item shall be on a lump sum basis. Payment shall include full compensation for conforming to the requirements of this section, not otherwise provided for, shall be considered as included in the prices paid for the various contract items of work involved, and no additional compensation will be allowed therefore.

REMOVE EXISTING GATE/POST, REMOVE EXISTING PALM TREE STUMP, REMOVE

EXISTING DRAIN HOSE, REMOVE EXISTING DRIVEWAY APPROACH, REMOVE

EXISTING GRATED INLET, REMOVE EXISTING FENCE AND RECONSTRUCT

CORRAL FENCING TO CLEAR APRON, SAWCUT AND REMOVE EXISTING CONCRETE – BID ITEM 4, 5, 6, 7, 8, 10, 48
This Bid Item shall include all material, equipment, labor, hauling of debris, grading and disposal of waste necessary to remove existing gate/posts, existing palm tree stump, existing drain hose, existing drive approach, existing grated inlet, existing corral fencing, and other miscellaneous obstructions within the work limits at the locations shown on the project plans and to the satisfaction of the Engineer and as specified in Section 300-2, “Unclassified Excavation,” and Section 401, “Removal” of the Standard Specifications.

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 27 All removed material becomes the property of the contractor and shall be hauled and disposed of properly at a licensed disposal facility outside of the roadway right of way.

These Bid Items shall also include the relocation of the existing corral fencing clear of the new concrete apron.

These bid items do not include removal of building pad under the restroom building which is included in bid item 9.

Payment for these Bid Items shall be per the contract unit price listed in the Bid Proposal and shall be considered as full compensation for furnishing all tools, labor, equipment, and materials and no additional compensation will be allowed therefore.

REMOVE EXISTING RESTROOM BUILDING/CONCRETE PAD – BID ITEM 9 This Bid Item shall include all material, equipment, labor, hauling debris, grading and disposal of waste necessary to remove existing restroom building/concrete pad, footings, all appurtenances within the structure as specified in accordance with Section 401, “Removal” of the Standard Specifications at the locations shown on the project plans and to the satisfaction of the Engineer. Contractor shall work with property owner regarding the removal, protection and storage of any improvements adjacent to the project limits.

Payment for this Bid Item shall be per each basis and shall be considered as full compensation for furnish all tools, labor, equipment, and materials for doing all the work involved and no additional compensation will be allowed therefore.

RELOCATE EXISTING SIGN – BID ITEM 11
This Bid Item shall include all material, equipment, labor, and grading necessary to remove and relocate existing sign in accordance with Section 401, “Removal” of the Standard Specifications at the locations shown on the project plans and to the satisfaction of the Engineer.

Payment for this Bid Item shall be per each basis and shall be considered as full compensation for furnish all tools, labor, equipment, and materials for doing all the work involved and no additional compensation will be allowed therefore.

ADJUST EXISTING WATER METER BOX TO GRADE, INSTALL 8” VALVE CAN 7 SLEEVE OVER EXISTING WATER VALVE – BID ITEM 12, 47
This Bid Item shall include all material, equipment, and labor necessary to adjust the existing water meter box to grade, including & protecting existing water meter and connecting pipes, as required, at locations shown on the plans, and as directed by the Engineer.

This item shall also include the installation of a new 8” valve can and slip can sleeve over an existing water valve. The valve can shall be adjusted to the final finished grade.

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 28 Payment for this Bid Item shall be per each basis and shall be considered as full compensation for furnish all tools, labor, equipment, and materials for doing all the work involved and no additional compensation will be allowed therefore.

TIE INTO EXISTING 4” SEWER AND CONSTRUCT SEWER CLEANOUT PER SPPWC 204-3, CONNECT TO EXISTING CLEANOUT – BID ITEM 13, 15, 28 This Bid Item shall include all materials, labor and equipment necessary for the construction of the sewer cleanout structure, access frame & cover, concrete encasement, temporary or permanent support of existing substructures, connection to existing sewer/drain line, trench excavation, shoring, removal and disposal of conflicting portion of existing sewer/drain, and trench backfill and compaction.

The work included in these Bid Items shall consist of all the materials and work described in Section 306, “Open Trench Conduit Construction” of the Standard Specifications and per SPPWC Standard Plan No. 204-3. Material shall be for sewer pipe and fittings shall conform Subsection 306-7.7 “Plastic Sewer Drainage Pipe” of the Standard Specifications.

Payment for all materials, equipment and labor required to perform the work included in this Bid Item shall be included in the unit price bid and no additional compensation will be allowed. Measurement shall be per the unit bid.

PLANT 24” BOX COAST LIVE OAK TREE – BID ITEM 14
The work covered under this Bid Item shall include all labor, material, and equipment needed to plant 24” box Coast Live Oak trees within the work limits and no additional compensation will be allowed thereof. The work shall be constructed in accordance with Section 801-4.5, “Tree and Shrub Planting” and Section 801-4.6, “Tree Staking and Guying” of the Standard Specifications.

The Coast Live Oak trees shall be furnished by the contractor. The exact location and number of Coast Live Oak trees to be planted will be determined by the City. The City shall approve each tree (size, healthiness, aesthetics, etc.) prior to planting.

The measurement and payment to furnish and install trees will be made at the contract unit price per each item as listed in the bid schedule and shall include full compensation for furnishing all materials, labor, tools, equipment, transportation and incidentals required to plant all trees in accordance with the plans and the Standard Specifications and no additional compensation will be allowed thereof.

CONSTRUCT 42” HIGH METAL HAND RAILINGS PER S.P.P.W.C. 606-3 – BID ITEM 17 The Bid Item shall include the installation of new metal handrail per SPPWC Std. Plan 606- 5 type A into new concrete wash rack. This bid item shall include the cost of all hardware needed to properly install the handrail and shall conform to provisions outlined in Section 206-5 “Metal Railings” and Section 304-2 “Metal Hand Railings”. The handrail shall be galvanized, painted a metal color. Metal hand rails shall be imbedded into the PCC curb.

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 29 The exact location and limits of the handrail will be determined by the City prior to installation.

Payment for this Bid Item shall be on a linear feet basis. Payment shall include full compensation for conforming to the requirements of this section, not otherwise provided for, shall be considered as included in the prices paid for the various contract items of work involved, and no additional compensation will be allowed therefore.

CONSTRUCT JENSEN PRECAST 750 GALLON CLARIFIER – BID ITEM 18 The work included in this Bid Item shall include all labor, materials, and equipment required to construct the Jensen Precast 750 Gallon Clarifier or City approved equal. Jensen Precast 750 Gallon Clarifier shall be installed per manufacturer requirements included in Appendix B. All pipe, connections, excavation, trenching, backfill and compaction, utility crossing protection and pavement or surface restoration required to connect the Jensen Precast Clarifier to the existing drain lateral shall be included in the unit price. The exact location and depth of utilities that will be connected is unknown and needs to be identified by the Contractor prior to start of construction. The JP Clarifier unit shall be constructed at the locations and elevations shown on the approved drawings. Any modifications to the elevation or location shall be at the direction of and approved by the Engineer.

The Contractor is responsible for inlet protection/sediment control and cleaning around each Unit.

Payment for all materials, equipment and labor required to perform the work included in this Bid Item shall be included in the unit price bid and no additional compensation will be allowed. Measurement shall be per the unit price.

CONSTRUCT 4” PVC SDR35 PIPE, CONSTRUCT 6” PVC SDR35 PIPE – BID ITEM 19, 22 The contractor shall furnish all labor, materials, tools, equipment transportation and all incidental work and other services required to install a 4” & 6” drain lines as shown on the plans, and specified in accordance with these Specifications. The material and work included in these items shall conform to Table 604.1 of Section 604.0, “Materials” of the California Plumbing Code and comply with the requirements and conditions of Section 306, “Open Trench Conduit Construction” of the Standard Specifications.

Contractor to locate the existing drainage pipe from the upper horse wash rack and connect the new 6 inch pvc pipe from parking lot to the existing drainage pipe. The new horse wash rack shall drain to the clarifier and sewer.

Bid item No. 22 includes the removal of the conflicting portions of the existing drain pipe and all fittings required to connect.

The contractor must maintain access to occupied equestrian stalls. Sewer trenches must be backfilled and compacted by the end of each day. Contractor to coordinate trenching with Sycamore Canyon Equestrian center Operator. No trench plates allowed with the

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 30 exception of Horsethief Canyon Park Road.

Payment this Bid Item shall be made at the contract unit price listed in the Bid Proposal.

Payment shall conform to the provisions in Subsection 303-5.9 “Measurement and Payment” of the Standard Specifications.

CONSTRUCT 2’ WIDE DOWNDRAIN, CONSTRUCT 8” CURB AND GUTTER PER S.P.P.W.C. 120-3, CONSTRUCT 4’ WIDE PARKWAY DRAIN PER S.P.P.W.C. 151-3 (INLET TYPE 2), CONSTRUCT 4” CONCRETE APRON, CONSTRUCT DRIVEWAY APPROACH PER S.P.P.W.C. 110-2, CONSTRUCT P.C.C. ALLEY INTERSECTION PER S.P.P.W.C. 130-3, CONSTRUCT 4’ WIDE V-DITCH – BID ITEM 20, 24, 26, 27, 29, 31, 40 The work included in these items shall consist of any or all work described in Section 303- 5, “Concrete Curb, Walk, Gutters, Cross Gutters, Alley Intersections and Driveways,” Section 401-3 “Concrete and Masonry Improvements,” Section 300-2, “Unclassified Excavation,” and Section 401, “Removal,” of the Standard Specifications. All work shall be performed in accordance with the provisions of said Section 303-5, “Concrete Curbs, Walks, Gutters, Cross Gutters, Alley Intersections, Access Ramps, and Driveways” of the Standard Specifications.

Excavation necessary for this construction shall be included in this bid item and no additional compensation will be made therefore. Curing Compound shall be Type 1 clear conforming to the provisions in Subsections 201-4, “Concrete Curing Compound” of the Standard Specifications.

Subgrade shall be prepared in accordance with Section 301-1, “Subgrade Preparation” of the Standard Specifications. The completed subgrade shall be tested for grade and crosssection by means of a template extending the full depth of the section and supported between the side forms. The subgrade and forms shall be thoroughly watered in advance of placing concrete.

Unless otherwise specified, all concrete items shall be constructed with Class 520-C-2500 concrete. Concrete aggregate shall be No. 3 grade conforming to the requirements prescribed in Section 200-1, “Rock Products” of the Standard Specifications, unless specified otherwise by the Engineer.

All forms shall be set to the true lines and grades as shown on the plans and typical crosssections. The depth of forms for the gutter shall be equal to the full depth of the structure.

Timber forms if used, shall be surfaced on the side next to the concrete and on the upper edge and shall be of the required size and strength to maintain their rigidity when the concrete is placed. Timber forms on all straight work shall not be less than 1 5/8-inch in thickness after being surfaced.

The forms on the front of curbs shall be removed not less than 2 hours or more than 6 hours after the concrete has been placed. All other forms shall remain in place until the concrete is thoroughly set. Forms shall be cleaned thoroughly and coated with light oil before subsequent use, and as often as necessary to prevent the concrete from adhering to them.

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 31 Warped or rough forms will be rejected.

The parkway drain shall be constructed per SPPWC 151-3 and per 2’ downdrain detail on sheet 6. Cost for parkway drain shall include parkway drain, and curb flair and ac paving per detail.

Curb forms shall be held rigidly in place by the use of pairs of iron stakes placed at required intervals so as not to displace the forms. An effort shall be made to space all joints in such a manner so as to create an appearance of uniformity. Expansion joints shall be filled with joint filler strips ½-inch thick and shall extend the full width and depth of curb and gutter.

The joint filler strips shall be in one piece, pre-cut to true cross-section and installed true to line and grade and at true angles to the curb and gutter line. Edges of expansion joints shall be rounded with an approved edging tool having a radius not to exceed ¼-inch and all excess concrete shall be removed from around the joint.

Weakened plane joints for sidewalks shall match adjacent concrete surfaces. Weakened plane joints shall be installed at regular intervals not exceeding 15 feet. Weakened plane joints shall be constructed in accordance with Subsection 303-5.4.3, “Weakened Plane Joints” of the Standard Specifications.

Finishing of concrete items shall conform to Subsection 303-5.5, “Finishing” of the Standard Specifications. A mortar finish will not be allowed or accepted under any circumstances.

Exposed concrete surfaces shall be cured in accordance with Subsection 303-5.6, “Curing” of the Standard Specifications.

Any new work found to be defective or damaged prior to its acceptance shall be repaired or replaced by the Contractor at no expense to the City. Prior to acceptance of any curb and gutter, the Contractor shall water flow test each segment of curb and gutter to ensure that ponding of water does not occur within the limits of new construction.

All work specified in this item shall conform to the following SSPWC, also referred as, SPPWC Standard Drawings:

Std. No.
a) PCC Driveway Approach SPPWC 110-2
b) PCC Parkway Drain SPPWC 151-3
c) PCC Curb & Gutter SPPWC 122-3
d) PCC Alley Intersection SPPWC 130-3
e) PCC Downdrain Per Plan
f) PCC Concrete Apron Per Plan
g) PCC V-Ditch Per Plan
Payment shall conform to the provisions in Subsection 303-5.9 “Measurement and Payment” of the Standard Specifications. Full compensation for all removals, excavation,

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 32 equipment, labor and materials, required for these items shall be considered as included in the unit price bid, and no additional compensation will be made therefore.

CONSTRUCT JENSEN PRECAST 18” X 18” CATCH BASIN (TRAFFIC RATED) BID ITEM 21
The work included in this Bid Item shall include all labor, materials, and equipment required to construct the Jensen Precast 18” x 18” traffic rated catch basin or City approved equal.

All pipe and connections required to connect the 18” x 18” catch basin shall be included in the unit price.

This bid item includes the sawcut and removal of 4.5 feet of existing curb, concrete pad, drain inlet, and new 4” concrete paving, 4” curb per concrete wash rack detail 2, and new 4” concrete paving and 4” curb per concrete wash rack detail 1.

Payment for all materials, equipment and labor required to perform the work included in this Bid Item shall be included in the unit price bid and no additional compensation will be allowed. Measurement shall be per the unit price.

CONSTRUCT 4” THICK B-PG 64-10 OVER COMPACTED NATIVE WITH THICKENED EDGE – BID ITEM 23
All asphalt concrete pavement shall conform to Section 203-6, “Asphalt Concrete”, and Section 302-5 “Asphalt Concrete Pavement” of the Standard Specifications and as modified herein, and to the lines and grades necessary to complete construction.

GENERAL
This bid item shall include all labor and materials required to construct various pavement thickness shown in plans.

The CONTRACTOR shall compact both lifts by steel wheel, rollers, vibratory plates, or rammers. The minimum final compaction shall be 95 percent of the density obtained in accordance with the methods specified in Subsection 302-5.6.2 of the Standard Specifications.

The CONTRACTOR shall furnish to the City reports from the supplier certifying that the asphalt pavement materials and proportions conform to the designated classifications for asphalt concrete pavement as required herein, or as directed by the Engineer.

Prime Coat will not be required on this project. Tack Coat shall be required and uniformly applied to existing hard-surfaced pavement including the vertical portions of all A.C. and P.C.C. surfaces to be joined. Tack coat material shall be Grade SS-1h emulsified asphalt.

Tack coat shall be applied at a rate of 0.05 gallons per square yard.

Asphalt concrete shall be thoroughly compacted by rolling in accordance with Subsection 302-5.4.6, “Rollers” of the Standard Specifications. All adjustable valve cans and lids shall

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 33 be adjusted to pavement grade prior to rolling. Rolling along a joint shall be such that the widest part of the roller is on the hot side of the joint.

Joint lines between successive runs shall be on lane lines.

Three-inch and greater thickness pavement shall be laid in two courses. The asphalt concrete pavement shall conform to the following specifications:
4” Asphalt Concrete Pavement: B-PG 64 -10, Base
There is no RAP allowed in the wear course.

Asphalt concrete shall be the product of mixing mineral and/or crushed slag aggregate with asphalt binder at a central mixing plant.

The asphalt binder shall be paving asphalt. The viscosity grade shall be as specified by the City Engineer and shall conform to the requirements of Section 203.6 of the Standard Specifications. The temperature of the paving asphalt and the mineral aggregate at the time of mixing shall conform to Section 203-1 of the Standard Specifications.

The asphalt concrete shall be constructed to the line, grades and designs shown on the plans or ordered by the Engineer. The soil shall be sterilized where asphalt concrete is required to be placed directly on native soil. Polybor chlorate, a weed killer, shall be applied to all ground surfaces where pavement is to be placed. It shall be mixed at the rate of two pounds of chemical to one gallon of water and shall be applied at a coverage rate of one gallon per 50 square foot.

Unless approved by the Engineer, the CONTRACTOR will not be allowed to deposit the A.C. material from bottom dump trucks into a windrow then pick up said material and convey it into the paving machine by an elevating device. All areas shall be paved by depositing the A.C. material from delivery trucks directly into the paving machine hopper.

In addition to the requirements in Subsection 302-5.5 of the Standard Specifications, asphalt concrete shall be placed with spreading equipment equipped with fully automated screed and grade sensing controls, which shall control the longitudinal grade of the screed.

Payment shall conform to the provisions in Section 301-2.4 “Measurement and Payment” of the Standard Specifications and the unit price bid for asphalt concrete pavement items shall include full compensation for furnishing all materials, labor, tools, equipment, transportation and incidentals required to construct the pavement in accordance with the plans, these Special Provisions and the Standard Specifications and no additional compensation will be allowed thereof.

CONSTRUCT 4” THICK STABILIZED DG PATH (STALOCK) – BID ITEM 25 The work included in this Bid Item shall consist of all the work to construct a Stabilized Decomposed Granite (DG) trail to include grading the trail surface to match the elevations

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 34 set on the project plans, haul away excess material, import and install new DG material as needed, and apply Stalok trail surface stabilizer.

All grading shall conform to the provisions in Section 300, “Clearing and Grubbing” of the Standard Specifications. The Contractor shall assume soil conditions that require scarification to facilitate grading and removal. Subgrade material shall conform to Section 301-1 “Subgrade Preparation” of the Standard Specifications. 301-1.3 “Relative Compaction” is amended to include the following sentence: The upper 6 inches of existing subgrade material shall be compacted to a relative compaction of 90 percent. Spreading shall comply with Subsection 301-2.2 “Spreading”. Compaction shall comply with Subsection 301-2.3 “Compacting”.

Application of Stalok Trail surface stabilizer shall conform to the manufacture’s recommendations. The work included in this item shall consist of all work required to import and install new decomposed granite material. The decomposed granite material is to be 4” thick after compaction and constructed as shown on plans. The exact limits for the equestrian trail shall be approved by the Engineer in the field prior to the start of work.

Payment for installing Stalok Decomposed Granite Path shall be paid at the Contract unit price on a per square foot basis and shall include subgrade preparation, hauling away of excess material, importing of subgrade material, transportation, spreading, and compaction operations associated with the installation of this item and shall be considered full compensation for furnishing all labor, materials, tools, equipment, and incidentals and no additional compensation will be allowed therefore.

SAWCUT AND REMOVE EXISTING A.C. PAVEMENT AND CONSTRUCT FULL DEPTH A.C. – BID ITEM 30
GENERAL:

All asphalt concrete pavement shall conform to Subsection 203-6, “Asphalt Concrete” of the Standard Specifications and all asphalt concrete pavement shall be constructed in accordance with Section 302-5, “Asphalt Concrete Pavement”, Section 300-2, “Unclassified Excavation,” and Section 401, “Removal” of the Standard Specifications and as modified herein, and to the lines and grades indicated in the project plans.

The contractor shall furnish to the City reports from the supplier certifying that the asphalt pavement materials and proportions comply with the designated classifications for asphalt concrete pavement as required herein, or as directed by the Engineer.

Prime Coat will not be required on this project. Tack Coat shall be required and uniformly applied to existing hard-surfaced pavement including the vertical portions of all A.C. and P.C.C. surfaces to be joined.

The asphalt concrete pavement shall conform to the following specifications:

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 35 Item Std. No
Full Depth Slot Cut C2-PG 64-10
There shall be no RAP in the wear course.

Existing asphalt concrete pavement to be joined shall be sawcut or ground on a neat straight line at the join location.

The final lift adjacent to the gutter shall create a lip not to exceed 3/8” above the edge of concrete gutter.

Subsection 302-5.4, “Tack Coat”:

Tack coat material shall be Grade SS-1h emulsified asphalt. Tack coat shall be applied at a rate of .05 gallons per square yard.

Payment for all materials, equipment and labor required to perform the work included in this bid item shall be included in the unit price bid and no additional compensation will be allowed.

Measurement shall be per unit price.

CONSTRUCT 18” HDPE PIPE, CONSTRUCT 6’ X 41’ CONTECH PERFORATED CMP WITH 24” RISER AND 12” STUBS, CONSTRUCT 12” HDPE PIPE, CONNECT 12” HDPE TO EXISTING CULVERT PER S.P.P.W.C. 335-2, CASE 3 - BID ITEM 32, 35, 36, 37 These Bid Items shall include all materials, labor, equipment, and services necessary to complete the installation of High Density Polyethylene (HDPE) drain pipe, including connecting to existing culvert per S.P.P.W.C. 335-2, Case 3, anchoring new pipe, installation of 6’ x 41’ Contech Perforated CMP with 24” Riser and 12” Stubs as shown on plans, initial and final cleaning, CCTV inspection, final testing of the pipe system, and pavement and striping restoration. The work included in these items shall consist of all the materials and work described in Section 209-5, “High-Density Polyethylene (HDPE) Solid Wall Pressure Pipe”, Section 306-8.6, “High-Density Polyethylene (HDPE) Pressure Pipe”, and Section 306, “Open Trench Conduit Construction” of the Standard Specifications.

Installation of HDPE pressure pipe shall include, but not be limited to the following items as shown on the Plans or as specified in the Standard Drawings.

Perform Site Investigation
Formulate and execute plans for insertion pit excavation Butt Fusion of All Joints and Fittings
Anchor Pipe
Install 8” Stub and Plugs
Perform Final Cleaning, Pressure Testing and Close Circuit TV (CCTV) Inspection Backfill, Compact, and Restore Excavation including Street Repairs/Restoration per Trench Repavement Detail on sheet 2 per Bid Item 39
Cleanup and Restore Existing Surface Condition and Structures Restore damaged portions of striping per Bid Item 39

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 36 Repair Defective Work (if necessary) Per Engineer’s Final Inspection Any modifications to the elevation or location shall be at the direction of and approved by the Engineer.

The HDPE pipe to be installed is a solid wall HDPE with a minimum SDR 17 wall thickness.

Following is clarification on the Trench Repavement Detail (38) on Sheet 2.

Note1: Trench Paving shall include installation of AC paving 1 inch deeper than existing AC pavement and installation of Class II Aggregate Base to a depth of 6 inches below the asphalt layer. Contractor may install an additional 3 inches of Class B AC (total depth of 4 inches below existing asphalt) in lieu of aggregate base.

Note 2: the contractor shall pave the trench flush with the existing asphalt. Upon completion of all trenching, the contractor will grind 1.5 inches and install an asphalt Concrete Overlay of C2 AC. No RAP in the C2 course. The C2 overlay shall be flush with the existing asphalt in accordance with the standard specifications.

Note 4: Backfill shall have a sand equivalent of not less than 30 and be compacted to a minimum of 90% relative compaction.

The Contractor is responsible for inlet protection/sediment control and cleaning around each Unit.

Payment for all materials, equipment and labor required to perform the work included in this bid item shall be included in the unit price bid and no additional compensation will be allowed.

Measurement shall be per unit price.

CONSTRUCT CURB OPENING CATCH BASIN WITH 3 GRATES PER S.P.P.W.C. 300- 4, CONSTRUCT LOCAL DEPRESSION PER S.P.P.W.C. 313-4, CASE D - BID ITEM 33,38 The material and work included in these Bid Items shall comply with the requirements and conditions of Section 303-1, “Concrete Structures”, Section 306, “Open Trench Conduit Construction” and Subsection 201-7.2, “Quick-Setting Grout of the Standard Specifications.

These items shall include the following: Miscellaneous excavation, saw cutting and removal of existing improvements required for the construction of the reinforced concrete catch basin, furnishing and installation of materials necessary for the construction of the items, bedding, compacted backfill.

The contractor shall furnish all labor, materials, tools, equipment transportation and all incidental work and services required to construct catch basins, and local depression as shown on the plans. The catch basin with 3 grates is to be constructed per SPPWC 302-4, and the Local Depression per SPPWC 313-4, Case D.

The Contractor shall not disturb or damage existing improvements to be protected in place.

Any damage done by Contractor and/or its equipment shall be repaired or replaced as called out in Section 400, “Protection and Restoration” of the Standard Specifications at Contractor's expense.

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 37 All removed material becomes the property of the Contractor and shall be hauled and disposed of properly outside of the roadway right of way.

Fill material and backfill operations shall conform to the specifications outlined in Bid Item

39. Payment for these items shall be per the contract unit price listed in the Bid Proposal and shall be considered as full compensation for furnishing all tools, labor, equipment, and materials and for doing all the work involved in the excavation, trenching, shoring, backfill, compaction, surface restoration, and no additional compensation will be allowed therefore.

CONSTRUCT “RARIN TO GO” 12’D X 24’L FREE-STANDING SHELTER – BID ITEM 34 The work included in this bid item shall include all purchase of the shelter, labor, materials, and equipment required to construct “Rarin to Go” 12’ H x 12’D x 24’L Free Standing Shelter, or City approved equal, as shown on plans. The contractor shall furnish all labor, materials, tools, equipment, transportation, site preparation, concrete footings and reinforcement, all require anchor bolts, brackets, fasteners, connectors and all incidental work and services required to construct the shelter in the location as shown on the plans.

This bid item includes tree trimming necessary to provide 5’ clear space around the shelter and any trimming required to balance the tree as directed by the City arborist.

Payment for all materials, equipment and labor required to perform the work included in this Bid Item shall be included in the unit price bid and no additional compensation will be allowed. Measurement shall be per each.

CONSTRUCT TRENCH REPAVEMENT – BID ITEM 39
The work included in this item shall consist of all work to permanently repair the street pavement per the details shown on the plans and in this bid item description. Contractor to repaint all striping and markings damaged by the construction of the trench repavement.

Asphalt concrete shall comply with the requirements of Section 203-6, “Asphalt Concrete” and Section 302-5, “Asphalt Concrete Pavement” of the Standard Specifications.

Class and grade of asphalt concrete shall be B-PG 64-10 for base course and C2-PG 64- 10 for final lift. There shall be no RAP in the wear course.

Crushed aggregate base shall conform to the requirements of Subsection 200-2.2 “Crushed Aggregate Base” of the Standard Specifications and crushed miscellaneous base shall conform to the requirements of Subsection 200-2.4 “Crushed Miscellaneous Base” of the Standard Specifications. Payment for crushed aggregate base shall be included in the unit bid price for trench repavement operations and shall be included in the unit cost per square feet and no additional compensation shall be made therefore.

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 38 Payment for this Bid Item shall be per square foot (SF) and shall be considered as full compensation for furnishing all tools, labor, equipment, and materials and for doing all the work involved in the permanent resurfacing of the roadway, and adjustment of manholes, and no additional compensation will be allowed therefore.

CONSTRUCT 5’ X 5’ GROUTED RIP RAP PAD – BID ITEM 41
The work included in this Bid Item includes all labor, material and equipment required for the construction of the rip-rap per the detail shown in the plans.

Payment for all materials, equipment and labor required to perform the work included in this Bid Item shall be included in the unit price bid and no additional compensation will be allowed. Measurement shall be per unit price.

REMOVE EXISTING ELECTRICAL PANEL IN RESTROOM BUILDING, INSTALL 1” PVC SCH80 CONDUIT, INSTALL 100 AMP RAINPROOF ELECTRICAL PANEL ON 4” METAL POST ON 4” THICK 24” X 24” CONCRETE PAD – BID ITEM 42, 43, 44 These Bid Items includes all labor, materials and equipment required to remove existing panel, location of existing 1 inch conduit and conductors and cost to furnish and install a new rainproof electrical panel, ground rods, pull box, conduit and conductors to reconnect to existing park electrical features and to provide a new electrical connection/conductors to all new electrical components. All work to be complete in accordance with current Electrical Code including two ground rods and a polymer concrete pull box for the ground rod.

Restoration of the existing surface due to installation of conduit runs shall be the responsibility of the Contractor.

Contractor shall maintain existing lighting or equivalent during construction.

Once the new electrical panel is energized, Contractor shall verify that all electrical components are receiving its intended power and functioning properly. Any modifications to faulty connections shall be made until all electrical components are functioning as intended and shall be a part of this Bid Item and no other compensation made thereof. There shall be no Interruptions to existing lighting. Contractor may submit temporary lighting proposal for City review.

WIRING
Connections between the existing electrical meter and the new electrical panel shall be made with #14 AWG solid copper conductors meeting the requirements of ASTM specification B-3. Conductors shall be insulated with Polyvinyl Chloride, 75°C rated conforming to UL Standards 493 and 83. All cables shall be tested physically and electrically in accordance with UL Standard 493, and 83 and should also be tested to CSA Rule C.22.2 No.75.

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 39 All wire splices shall be made with 600 VAC rated waterproof connectors.

Splices of the two-wire cable will not be allowed.

Electrical panel shall be grounded per the current electrical code This Bid Item shall also include the relocation of the existing timers from the restroom building prior to demolition and reinstalling them on the side of the new electrical panel and the installation of new electrical conductors from the existing electrical meter to the new electrical panel, and from the new electrical panel to the northlerly light, grounding rods and associated pull box all in accordance with current California electrical code.

Payment for all materials, equipment and labor required to perform the work included in this Bid Item shall be included in the unit price or lump sum bid and no additional compensation will be allowed.

CONSTRUCT WASH RACK, MODIFY WASH RACK – BID ITEM 45, 46 The work included in these items shall consist of any or all work described in Section 303- 5, “Concrete Curb, Walk, Gutters, Cross Gutters, Alley Intersections and Driveways,” Subsection 401-3 “Concrete and Masonry Improvements,” Section 300-2, “Unclassified Excavation,” and Section 401, “Removal,” of the Standard Specifications. All work shall be performed in accordance with the provisions of said Subsection 303.5 of the Standard Specifications.

Excavation necessary for this construction of the wash rack shall be included in this bid item and no additional compensation will be made therefore. Curing Compound shall be Type 1 clear conforming to the provisions in Section 201-4, “Concrete Curing Compound” of the Standard Specifications.

Subgrade shall be prepared in accordance with Section 301-1 of the Standard Specifications. The completed subgrade shall be tested for grade and cross-section by means of a template extending the full depth of the section and supported between the side forms. The subgrade and forms shall be thoroughly watered in advance of placing concrete.

Unless otherwise specified, all concrete items shall be constructed with Class 520-C-2500 concrete. Concrete aggregate shall be No. 3 grade conforming to the requirements prescribed in Section 200-1 of the Standard Specifications, unless specified otherwise by the Engineer.

All forms shall be set to the true lines and grades as shown on the plans and typical crosssections. The depth of forms for the gutter shall be equal to the full depth of the structure.

Timber forms if used, shall be surfaced on the side next to the concrete and on the upper edge and shall be of the required size and strength to maintain their rigidity when the concrete is placed. Timber forms on all straight work shall not be less than 1 5/8-inch in thickness after being surfaced.

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 40 All forms shall remain in place until the concrete is thoroughly set. Forms shall be cleaned thoroughly and coated with light oil before subsequent use, and as often as necessary to prevent the concrete from adhering to them. Warped or rough forms will be rejected.

Weakened plane joints shall be installed at regular intervals not exceeding 10 feet.

Weakened plane joints shall be constructed in accordance with Subsection 303-5.4.3 of the Standard Specifications.

Finishing of concrete items shall conform to Section 303-5.5 of the Standard Specifications.

A mortar finish will not be allowed or accepted under any circumstances.

Exposed concrete surfaces shall be cured in accordance with Section 303-5.6 of the Standard Specifications.

This Bid Item shall also include the construction of the 4” PCC curb as shown in the details.

The proposed curb shall be poured integral with the wash rack surface. The location and limits of the PCC curb will be determined by the Engineer. Metal hand rails per Bid item 17 shall be imbedded into the PCC curb. There shall be three stalls at each wash rack.

Any new work found to be defective or damaged prior to its acceptance shall be repaired or replaced by the Contractor at no expense to the City in accordance with Section 300-1.3 of the Standard Specifications. Prior to acceptance of wash rack, the Contractor shall perform a water flow test to ensure that ponding of water does not occur within the limits of the new construction.

Payment for this Bid Item shall be on a lump sum basis. Payment shall include full compensation for conforming to the requirements of this section, not otherwise provided for, shall be considered as included in the prices paid for the various contract items of work involved, and no additional compensation will be allowed therefore.

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 41 CONSTRUCTION CONTRACT NO. 2025-07 II

HORSETHIEF CANYON WATER QUALITY

MANAGEMENT IMPROVEMENTS
BIDDER’S PROPOSAL

TO THE SAN DIMAS CITY COUNCIL
The undersigned, as bidder, declares that this proposal is made without collusion with any other person, firm, or corporation; and that the only person or parties interested as principles are those named herein; that he has not accepted any bid from any subcontractor or materialman through any bid depository, the by-laws, rules, or regulations of which prohibit or prevent the Contractor from considering any bid from any subcontractor or materialman which is not processed through said bid depository, or which prevents any subcontractor or materialman from bidding to any Contractor who does not use the facilities of, or accept bids from or through such bid depository; and having carefully examined the site of the proposed work and plans and specifications, therefore, as well as the “Notice Inviting Bids,” all motions by the City Council pertaining thereto, and the proposed Contract, and The Contractor from considering any bid from any subcontractor or materialman which having informed himself fully in regard to the contemplated work, proposes and agrees in the event of the acceptance hereof, to enter into a Contract with the City Council of the City of San Dimas, to perform said proposed work in accordance with the terms of said Contract, and to furnish or provide all material, equipment, labor, tools, apparatus, and other means necessary so to do in accordance with the terms and provisions of said Contract, to wit:

BASE BID

ITEM QUANTITY DESCRIPTION OF BASE BID ITEM BID ITEM TOTAL 1 1 LS Mobilization, and NPDES/SWPPP Requirements
complete in place for the lump sum price of:
($___________________) per LS __________________
2 1 LS Traffic Control for the lump sum price of:
($___________________) per LS
__________________
3 1 LS General Earthwork and Unclassified Excavation
for the unit price of:
($___________________) per LS __________________

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 42 ITEM QUANTITY DESCRIPTION OF BASE BID ITEM BID ITEM TOTAL 4 3 EA Remove Existing Gate/Post for the unit price of:
($___________________) per EA
5 1 EA Remove Existing Palm Tree Stump for the unit
price of
($___________________) per EA
6 1 EA Remove Existing Drain Hose for the unit price of:
($___________________) per EA
7 290 SF Remove Existing Driveway Approach for the unit price of:
($___________________) per SF
8 1 EA Remove Existing Grated Inlet for the unit price of:
($___________________) per EA
9 1 EA Remove Existing Restroom Building/Concrete
Pad ans Cap Existing Sewer Outlet for the unit
price of:
($___________________) per EA
10 1 LS Remove Existing Fence and Reconstruct Corral
Fence to Clear Apron for the lump sum of:
($___________________) per LS
11 2 EA Relocate Existing Sign for the unit price of:
($___________________) per EA
12 1 EA Adjust Existing Water Meter Box to Grade for the unit price of:
($___________________) per EA
13 1 EA Tie into Existing 4” Sewer and Construct Sewer
Cleanout per SPPWC 204-3 for the unit price of:
($___________________) per EA

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 43 ITEM QUANTITY DESCRIPTION OF BASE BID ITEM BID ITEM TOTAL 14 13 EA Plant 24” Box Coast Live Oak Tree for the unit price of:
($___________________) per EA
15 3 EA Construct Sewer Cleanout per SPPWC 204-3 for
the unit price of:
($___________________) per EA
16 1 LS Construct Graded Swale at 2.0% Min Around
Shelter for the lump sum price of:
($___________________) per LS
17 112 LF Construct 42” High Metal Hand Railings per
S.P.P.W.C. 606-3 for the unit price of:
($___________________) per LF
18 2 EA Construct Jensen Precast 750 Gallon Clarifier for the unit price of:
($___________________) per EA
19 610 LF Construct 4” PVC SDR35 Pipe for the unit price of:
($___________________) per LF
20 80 LF Construct 2’ Wide Downdrain for the unit price of:
($___________________) per LF
21 3 EA Construct Jensen Precast 18” x 18” Catch Basin
(Traffic Rated) for the unit price of:
($___________________) per EA
22 55 LF Construct 6" PVC SDR35 Pipe for the unit price of:
($___________________) per LF
23 600 TON Construct 4” Thick B-PG 64-10 over Compacted Native with Thickened Edge for the unit price of:
($___________________) per TON

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 44 ITEM QUANTITY DESCRIPTION OF BASE BID ITEM BID ITEM TOTAL 24 145 LF Construct 8” Curb and Gutter Per S.P.P.W.C. 120- 3 for the unit price of:
($___________________) per LF
25 6,745 SF Construct 4” Thick Stabilized DG Path (STALOK) for the unit price of:
($___________________) per SF
26 1 EA Construct 4’ Wide Parkway Drain Per S.P.P.W.C.
151-3 (Inlet Type 2) for the unit price of:
($___________________) per EA
27 1 EA Construct 4” Concrete Apron for the unit price of:
($___________________) per EA
28 1 EA Connect to Existing Cleanout for the unit price of:
($___________________) per EA
29 290 SF Construct Driveway Approach Per S.P.P.W.C.
110-2 for the unit price of:
($___________________) per SF
30 300 LF Sawcut and Remove Existing AC Pavement and
Construct Full Depth AC for the unit price of:
($___________________) per LF
31 255 SF Construct P.C.C. Alley Intersection Per
S.P.P.W.C. 130-3 for the unit price of:
($___________________) per SF
32 105 LF Construct 18” HDPE Pipe for the unit price of:
($___________________) per LF
33 1 EA Construct Curb Opening Catch Basin with 3
Grates Per S.P.P.W.C. 300-4 for the unit price of:
($___________________) per EA

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 45 ITEM QUANTITY DESCRIPTION OF BASE BID ITEM BID ITEM TOTAL 34 2 EA Construct “Rarin to Go” 12’ H x 12’D x 24’L FreeStanding Shelter for the unit price of:
($___________________) per EA
35 1 EA Construct 6’ x 41’ Contech Perforated CMP with
24” CMP Riser and 12” Stubs for the unit price of:
($___________________) per EA
36 130 LF Construct 12” HDPE Pipe for the unit price of:
($___________________) per LF
37 1 EA Connect 12” HDPE to Existing Culvert Per
S.P.P.W.C. 335-2, Case 3 for the unit price of:
($___________________) per EA
38 1 EA Construct Local Depression Per S.P.P.W.C. 313-
4, Case D for the unit price of:
($___________________) per EA
39 550 SF Construct Trench Repavement for the unit price of:
($___________________) per SF
40 290 LF Construct 4’ Wide V-Ditch for the unit price of:
($___________________) per LF
41 25 SF Construct 5’ x 5’ Grouted Rip Rap Pad for the unit price of:
($___________________) per SF
42 1 LS Remove Existing Electrical Panel in Restroom
Building for the lump sum price of:
($___________________) per LS

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 46 ITEM QUANTITY DESCRIPTION OF BASE BID ITEM BID ITEM TOTAL 43 50 LF Install 1” PVC SCH 80 Conduit for the unit price of:
($___________________) per LF
44 1 LS Install 100 AMP Rainproof Electrical Panel on 4” Metal Post on 4” Thick 24” x 24” Concrete Pad
Including Relocation of Existing Timers and
Installation of New Conductor Wire for the lump
sum price of:
($___________________) per LS
45 1 LS Construct Wash Rack for the lump sum price of:
($___________________) per LS
46 1 LS Modify Wash Rack for the lump sum price of:
($___________________) per LS
47 1 EA Install 8" Valve Can & Sleeve over Ex. Water
Valve for the unit price of:
($___________________) per EA
48 550 SF Sawcut and Remove Existing Concrete for the unit price of:
($___________________) per SF
TOTAL All BASE BID ITEMS $ __________________
TOTAL ALL BASE BID IN WORDS:

COMPANY NAME: _____________________________________________________________ AUTHORIZED REPRESENTATIVE: _________________________________________________ (printed name and title)
SIGNATURE OF AUTHORIZED PARTY: ____________________________________________

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 47 STATE CONTRACTOR’S LICENSE NO._______________________ CLASS _______________ Department of Industrial Relations Registration Number: _____________________________

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 48 BIDDER'S BOND
KNOW ALL MEN BY THESE PRESENTS:

That we, , as Principal,
and , as Surety, are held and firmly bound unto the
City of San Dimas, State of California (hereinafter called "City"), in the penal sum of Ten Percent (10%) of the total aggregate amount of the bid of the Principal above-named, submitted by said Principal to City for the WORK described below, for the payment of which sum is lawful money of the United States, well and truly to be made, we bind ourselves, our heirs, executors, administrators, and successors, jointly and severally, firmly by these presents. In no case shall the liability of the Surety hereunder exceed the sum of ($ . ).

The condition of this obligation is such that a bid to City for certain construction specifically described as follows, for which bids are to be opened on _____________, has been submitted by Principal to City:

Whereas, Principal is hereby submitting a proposal per the plans and specifications for:

CC 2025-07 II HORSETHIEF CANYON EQUESTRIAN CENTER IMPROVEMENTS NOW, therefore, if the aforesaid Principal shall not withdraw said bid within the period specified therein after the opening of the same, or, if no period be specified, within ninety (90) days after said opening, and shall within the period specified thereby, or if no period be specified, within fourteen 14 days after the prescribed forms are presented to him for signature, enter into a written contract with City, in the prescribed form, in accordance with the bid as accepted, and file with City the certificates of insurance as stipulated in SP-6 of the Special Provisions and the two bonds, one to guarantee faithful performance and the other to guarantee payment for labor and materials, as required by law, then this obligation shall be null and void; otherwise, it shall be and remain in full force, virtue and effect. And the said Surety, for value received, hereby stipulates and agrees that no change, extension of time, alteration or addition to the terms of said contract or to the WORK to be performed hereunder or the specifications accompanying the same shall in any manner affect its obligations on this bond, and it does hereby waive notice of any such change, extension, alteration, or addition.

In the event suit is brought upon said bond by City/District and judgment is recovered, the Surety shall pay all costs incurred by City in such suit, including a reasonable attorney's fee to be fixed by the court. Death of the Principal shall not relieve Surety of its obligation hereunder.

IN WITNESS WHEREOF, we have hereunto set our hands and seals on this day of , 2026. (Seal) (Seal)
(Seal) (Seal)
(Seal) (Seal)
Principal Surety

_______________________________
Address
NOTE: Signatures of those executing for Surety must be properly acknowledged

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 49 CONTRACTOR'S CLASSIFICATION
The undersigned agrees, if awarded the Contract by the City, to execute the Contract and file the required bonds within ten (10) calendar days after notice of award by the City, and to commence work within 5 (5) calendar days of after issuance of the notice to proceed. A time limit of Seventy Five (75) working days from the date of starting work has been set for the completion of this project.

This bid is submitted in response to the "Notice Inviting Bids and pursuant to all of the documents and instructions for the Work as approved by the City Council. The undersigned person or company is licensed by the State of California, pursuant to Chapter 9, Division 3, of the Business and Professions Code, under STATE CONTRACTOR'S LICENSE NO. _______ CLASS _____, EXPIRATION DATE ______________. The undersigned bidder is:

INDIVIDUAL CONTRACTOR NAME: __________________________________ ADDRESS: ______________________________
________________________________________
PHONE: (_____) __________________________
PARTNERSHIP NAME: __________________________________
ADDRESS: ______________________________
________________________________________
PHONE: (______) _________________________
CORPORATION NAME: __________________________________
ADDRESS: ______________________________
________________________________________

PHONE: (______) _________________________
BY: _________________________, PRESIDENT
____________________________, SECRETARY

ORGANIZED UNDER THE LAWS OF THE
STATE OF ______________________________

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 50 BIDDER'S STATEMENT OF TECHNICAL ABILITY AND EXPERIENCE The bidder is required to state what work of a similar character to that included in this proposed Contract he has successfully performed in Los Angeles County within the last five years, and provide references which will enable the City Council to judge his responsibility, experience, skill and business standing. Said references shall include the name of the Supervisor responsible for the acceptance of the Work performed.

The undersigned submits herewith a statement of work which he has successfully performed of a character similar to that included in the proposed Contract.

1. JURISDICTION: _______________________________________________________ CONTACT PERSON: _______________________ PHONE: (_____) ____________ PROJECT PERFORMED: _______________________________________________

2. JURISDICTION: _______________________________________________________ CONTACT PERSON: _______________________ PHONE: (_____) ____________ PROJECT PERFORMED: _______________________________________________

3. JURISDICTION: _______________________________________________________ CONTACT PERSON: _______________________ PHONE: (_____) ____________ PROJECT PERFORMED: _______________________________________________

4. JURISDICTION: _______________________________________________________ CONTACT PERSON: _______________________ PHONE: (_____) ____________ PROJECT PERFORMED:

5. JURISDICTION: _______________________________________________________ CONTACT PERSON: _______________________ PHONE: (_____) ____________ PROJECT PERFORMED: _______________________________________________

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 51 DESIGNATION OF SUBCONTRACTORS
In compliance with the provisions of the Subletting and Subcontracting Fair Practices Act, Sections 4100 through 4114 of the California Public Contract Code, and any amendments thereof, the undersigned bidder has set forth below the name and location of the place of business of each subcontractor who will perform work or labor, or render service to the general Contractor, in or about the construction of the Work or improvement to be performed under the Contract Documents to which the attached bid is responsive, and the portion of the Work which will be done by each subcontractor for each subcontract in excess of one-half of one percent of this total bid.

The bidder understands that if he fails to specify a subcontractor for any portion of the Work to be performed under the Contract, he shall be deemed to have agreed to perform such portion of the Work himself and that he shall not be permitted to subject or subcontract that portion of the Work, except in cases of public emergency or necessity, and then only after a finding reduced in writing as a public record of the City setting forth the facts constituting the emergency or necessity.

1. ITEM: _______________________________________________________________ SUBCONTRACTOR: ___________________________________________________ ADDRESS: ___________________________________________________________ PHONE: (_____) ____________________ STATE LICENSE NO.: _____________ DIR NO._______________ % OF WORK PERFORMED:________________

2. ITEM: _______________________________________________________________ SUBCONTRACTOR: ___________________________________________________ ADDRESS: ___________________________________________________________ PHONE: (_____) _____________________ STATE LICENSE NO.: ____________

DIR NO._______________ % OF WORK PERFORMED: _______________

3. ITEM: _______________________________________________________________ SUBCONTRACTOR: ___________________________________________________ ADDRESS: ___________________________________________________________ PHONE: (_____) _____________________ STATE LICENSE NO.: ____________ DIR NO._______________ %OF WORK PERFORMED: ________________ (Attach sheet for additional subcontractors)

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 52 CERTIFICATE AS TO COMPLIANCE WITH CERTAIN REGULATIONS The Contractor shall furnish, in duplicate, to the City Engineer prior to the acceptance of the Work, a certificate in form substantially as follows:
"I/We hereby certify that all work has been performed and materials supplied in accordance with the plans, specifications, special conditions and other related Contract Documents for the above-work, and that:
a. No alien was employed on the Work in violation of the provisions of Article 4, Chapter 1, Part 7, Division 2 of the Labor Code.
b. Not less that the prevailing rates of wager as ascertained by the City Council has been paid to laborers, workmen, and mechanics employed on this work. c. There have been no unauthorized substitutions of subcontractors, nor have any unauthorized subcontracts been entered into.
d. No materials of foreign origin supplied by the Contractor were used in the Work, except where materials of domestic origin were not available. e. No subcontract was assigned or transferred or performed by anyone other than the original subcontractor, except as provided in of the Subletting and Subcontracting Fair Practices Act, Sections 4100 through 4114 of the California Public Contract Code, and any amendments thereof.
f. All claims for materials and labor, and other services performed in connection with these specifications have been paid."
BIDDER: _________________________________
BY: _________________________________
(Signature of Person Authorized to Sign for the Bidder)

_________________________________
(Print Name)

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 53 REJECTION OF BID FOR PRIOR DISQUALIFICATION REMOVAL OR

OTHERWISE PREVENTED FROM BIDDING BECAUSE OF VIOLATION OF

THE LAW OR A SAFETY REGULATION
Each bidder shall complete, under penalty of perjury, the questionnaire appearing in subpart (a) below, inquiring whether the bidder, any officer of the bidder, or any employee of such bidder who has a proprietary interest in such bidder, has ever been disqualified, removed, or otherwise prevented from bidding on, or completing a Federal, State, or local government project because of a violation of law or safety regulation, and if so, to explain the circumstances. A bid may be rejected on the basis of a bidder, any officer of such bidder, or any employee of such bidder who has a proprietary interest in such bidder, having been disqualified, removed, or otherwise prevented from bidding on, or completing a Federal, State, or local project because of a violation of the law or a safety regulation.
(a) Has any bid of the Contractor, any officer of the Contractor, or any employee of the Contractor who has a proprietary interest in the Contractor ever been disqualified, removed, or otherwise prevented from bidding on, or completing a Federal, State, or local project because of a violation of the law or a safety regulation?

YES ( ) NO ( )
(b) If the answer to subpart (a) above is “YES”, the bidding Contractor shall describe in detail the reasons the bidder, any officer of such bidder, or any employer of such bidder who has a proprietary interest in such bidder was so disqualified, removed, or otherwise prevented from bidding or completing such a project, the name of the Federal, State, or local agency or agencies for whom the Work was bid or being performed; the name of the contracting officer or other government official responsible for each such project, the date of each disqualification or removal, or other act to prevent completion of such a project; the nature of the project, and explain any other circumstances, including mitigating factors, that would assist the City in evaluating the bidding Contractor’ qualifications (if sufficient space is not provided, please attach additional pages as necessary, to answer this questionnaire). ___________________________________________________________________ ___________________________________________________________________ The questionnaire completed above as executed on this _____ day of ____________________, by the undersigned under penalty of perjury.

BY: _________________________________
(Signature of Person Authorized to Sign for the Bidder)

_________________________________
(Print Name)

_________________________________
(Position/Title)

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 54 QUESTIONNAIRE TO GENERAL CONTRACTORS
The Contractor shall be required to complete this form entitled, “Questionnaire to General Contractors.” The City will forward this form to the City Attorney’s Office for review.

1. Were bid depository or registry services used in obtaining subcontractor bid figures in order to compute your bid?
( ) YES ( ) NO

2. If the answer to No. 1 is “YES”, please attach a copy of the rules of each bid depository you used.

3. Did you have any source of subcontractors’ bids other than bid depositories? ( ) YES ( ) NO

4. Has any person or group threatened you with subcontractor boycotts, union boycotts, or other sanctions to attempt to convince you to use their services or abide by the rules of one or more bid depositories? ( ) YES ( ) NO

5. If the answer to No. 4 is “YES”, please explain the following details:
(a) Date
(b) Name of person or group:
(c) Job involved (if applicable)
(d) Nature of the threats: (use additional paper, if needed) (e) Additional comments: _______________________________________ _________________________________________________________ BIDDER: _________________________________
BY: _________________________________
(Signature of Person Authorized to Sign for the Bidder)

_________________________________
(Print Name)

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 55 CONSTRUCTION CONTRACT NO. 2025-07 II

NONCOLLUSION AFFIDAVIT TO BE EXECUTED

BY BIDDER AND SUBMITTED WITH BID

STATE OF CALIFORNIA )
)ss.

COUNTY OF _____________________ )
_____________________________________, being first duly sworn, deposes and says (name)
that he or she is _______________________________________________________ of (position / title)
_______________________________________________________________________, (the bidder)
the party making the foregoing bid; that the bid is not made in the interest of, or on behalf of , any undisclosed person, partnership, company, association, organization, or corporation; that the bid is genuine and not collusive or sham; that the bidder has not directly or indirectly induced or solicited any other bidder to put in a false sham bid, and has not directly or indirectly colluded, conspired, connived, or agreed with any bidder or anyone else to put in a sham bid, or that anyone shall refrain from bidding; that the bidder has not in any manner, directly or indirectly, sought by agreement, communication, or conference with anyone to fix the bid price of the bidder or any other bidder, or to fix any overhead, profit, or cost element of the bid price, or of that of any other bidder, or to secure any advantage against the public body awarding the contract of anyone interested in the proposed contract; that all statements contained in the bid are true; and, further, that the bidder has not, directly or indirectly, submitted his or her bid price or any breakdown thereof, or the contents thereof, or divulged information or data relative thereto, or paid, and will not pay, any fee to any corporation, partnership, company, association, organization, bid depository, or to any member or agent thereof to effectuate a collusive or sham bid.

DATED: _________________________ By ______________________________ (Person signing for bidder)

EXECUTE ATTACHED NOTARY ACKNOWLDGMENT,
(California Civil Code Section 1189)

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 56 CONSTRUCTION CONTRACT NO. 2025-07 II

NOTARY ACKNOWLEDGMENT
STATE OF _______________________ )
)
COUNTY OF _____________________ )
On _____________________________, before me, _________________________________, Notary Public, personally appeared _______________________________________, who proved to me on the basis of satisfactory evidence to be the person whose name is subscribed to the within instrument and acknowledged to me that he/she executed the same in his/her authorized capacity, and that by his/her signature on the instrument the person, or the entity upon behalf of which the person acted, executed the instrument.

I certify under PENALTY OF PERJURY under the laws of the State of California that the foregoing paragraph is true and correct.

WITNESS my hand and official seal.

Signature: (Seal)
A notary public officer completing this certificate verifies only the identity of the individual who signed the document to which this certificate is attached, not the truthfulness, accuracy, or validity of

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 57 APPENDIX A (Standard Plans)

Department of Public Works City of San Dimas, California CC 2025-07 II Horsethief Canyon Water Quality Management Improvements 58 APPENDIX B (Jensen Precast Clarifier)

Agenda Item Staff Report
To: Honorable Mayor and Members of City Council
For the Meeting of July 28, 2026
From: Brad McKinney, City Manager
Prepared by: Shari Garwick, Director of Public Works
Genevieve Amaro, Management Aide
Subject: Approve the Sole Source Purchase of 6 Brasco International Axle Retreat Bus Shelters for the Amount of $74,850.00 from Fund 72
____________________________________________________________________________

SUMMARY
At its April 12, 2022, meeting, the City Council adopted the Brasco International Axle Retreat prefabricated aluminum bus shelter as the City's standard bus shelter design. These shelters are replacing the City's aging wooden bus shelters, many of which have reached the end of their useful life.

As part of the City's ongoing bus shelter replacement program, staff requests approval of a sole-source purchase order with Brasco International in an amount not to exceed $74,850 for the purchase of six additional Axle Retreat bus shelters. The purchase includes benches, solar lighting, anti-graffiti coating, and delivery. Funding is available in the Fiscal Year 2026- 27 Budget within Proposition A Funds (Fund 72), which are restricted to transit-related projects.

Installation costs, including purchase cost of new shelter, demolition of existing shelters, concrete improvements, and installation, are estimated at approximately $22,000 per shelter, for a total estimated project cost of approximately $132,000.

Two of the six shelters are eligible for reimbursement through a $40,000 Bus Stop Enhancement Program (BSEP) grant awarded by Foothill Transit

RECOMMENDATION
Staff recommends that the City Council:

1. Find that the sole-source purchase of Brasco International Axle Retreat bus shelters from Brasco International is exempt from competitive bidding pursuant to Public Contract Code Section 3400(c)(2), because the Brasco International Axle Retreat shelter has

Authorize the Appropriation of $49,900 for the Purchase and Installation of Four Additional Bus Shelters Page 2
For the Meeting of July 28, 2026
been established as the City's standard bus shelter design and is necessary to match products already in use on a public improvement, based on the following findings:
a. The City Council formally adopted the Brasco International Axle Retreat as the City's standard bus shelter design in April 2022.
b. The City currently has eight Brasco International Axle Retreat shelters installed and in service.
c. The shelter has been engineered and approved by the City Engineer for California wind and seismic loading requirements and has been approved by Foothill Transit for use under the Bus Stop Enhancement Program. d. Standardizing on a single shelter model improves maintenance efficiency by using common replacement parts and components, reduces spare parts inventory, and provides a consistent appearance throughout the City's transit system.
e. Procuring the same shelter model avoids unnecessary engineering, design revisions, and additional project costs.
f. Specifying the Brasco International Axle Retreat shelter is necessary to match products already in use on a public improvement, consistent with Public Contract Code Section 3400(c)(2).

2. Authorize the Purchase of 6 Axle Retreat Bus Shelters from Brasco International in the amount not to exceed $74,850 from funds allocated for Bus Stop Maintenance in Fiscal Year 2026-27 Budget in Proposition A Funds (Fund 72).

GOVERNMENT CODE §84308 APPLIES:
https://leginfo.legislature.ca.gov
Yes

FISCAL IMPACT
The City is phasing in the replacement of all existing wooden bus shelters with the approved Brasco International Axle Retreat prefabricated metal bus shelters. Staff obtained an updated quotation from Brasco International for the purchase of six Brasco Axle Retreat bus shelters, including benches, solar lighting, and anti-graffiti coating. The total purchase cost for the six shelters is $74,850.

The estimated installation cost for all six shelters, including purchase of the shelter, demolition of the existing shelters, concrete foundations, and installation, is $132,000 (approximately $22,000 per shelter). These costs are included in the Fiscal Year 2026-27 Bus Stop Maintenance Budget and will be funded through Proposition A Funds (Fund 72).

In November 2025, the City Council received a $40,000 Bus Stop Enhancement Program (BSEP) grant from Foothill Transit for the replacement of two bus shelters located on Bonita Avenue at Walnut Avenue. These two shelters are included in the purchase order and once installation is complete, the $40,000 grant will reimburse expenditures from the Bus Stop Maintenance Fund.

BACKGROUND

Authorize the Appropriation of $49,900 for the Purchase and Installation of Four Additional Bus Shelters Page 3
For the Meeting of July 28, 2026
Foothill Transit owns and operates the public transit system serving the City of San Dimas; however, the City is responsible for the installation and maintenance of bus stop amenities, including shelters, benches, lighting, and related improvements. The City maintains approximately 35 bus stops, including 18 bus shelters using Proposition A transit funds (Fund 72) which are restricted to transit-related projects.

Many of the original wooden bus shelters have deteriorated due to age, weather exposure, vandalism, and increasing maintenance needs. In addition, the original manufacturer is no longer in business, making repairs increasingly difficult and costly. As a result, the City has implemented a long-term program to replace aging wooden shelters with durable prefabricated aluminum shelters.

In April 2022, the City Council selected the Brasco International Axle Retreat shelter design as the City's standard replacement shelter. Installation of the initial two shelters was completed in July 2024. The City now has a total of 8 Brasco International Axle Retreat bus shelters installed at this time.

The City has successfully secured two Bus Stop Enhancement Program (BSEP) grants from Foothill Transit totaling $80,000. The first $40,000 grant was awarded in 2022. In June 2026, Foothill Transit awarded the second grant of $40,000 and authorized the City to proceed with procurement of the associated bus shelters.

Staff subsequently obtained an updated quotation from Brasco International and expanded the order from two to six bus shelters as several wooden bus shelters need substantial repairs or replacement.

DISCUSSION/ANALYSIS
As part of the Foothill Transit BSEP program, the City was required to identify the bus shelter locations for the two shelters associated with the grant. Based on maintenance history, structural condition, and anticipated repair needs, staff named the following locations for replacement of the grant funded shelters:

The two grant-funded shelters will be installed at the following approved locations:

Bonita Avenue at Walnut Avenue (Eastbound)
Bonita Avenue at Walnut Avenue (Westbound)
The remaining four shelters will be installed at other priority bus stop locations throughout the City. While current priorities include locations along Bonita Avenue, Arrow Highway, and Foothill Boulevard, final installation locations may change based on structural condition, maintenance needs, vandalism, and operational priorities to ensure the City's most critical replacement needs are addressed.

The Brasco International Axle Retreat shelter was adopted by the City Council in April 2022 as the City's standard bus shelter design and has been engineered and approved by the City Engineer for California wind and seismic loading requirements. Foothill Transit has also approved the shelter for use under the BSEP program.

Standardizing on a single shelter model improves maintenance efficiency by allowing staff to use common replacement parts, hardware, lighting components, and batteries across all shelters. It

Authorize the Appropriation of $49,900 for the Purchase and Installation of Four Additional Bus Shelters Page 4
For the Meeting of July 28, 2026
also eliminates the need for additional engineering, plan revisions, and product evaluations for future replacements, reducing project costs and accelerating installation The Brasco International Axle Retreat has been adopted as the City's standard bus shelter, purchasing the same model ensures compatibility with existing installations, maintains a consistent appearance throughout the transit system, simplifies maintenance, reduces spare parts inventory, and avoids additional engineering and design costs. Accordingly, staff recommends using the exception to public bidding requirements provided under Public Contract Code Section 3400(c)(2).

The following findings support the use of this exception:
• The City Council formally adopted the Brasco International Axle Retreat as the City's standard bus shelter design in April 2022.
• The City currently has eight Brasco International Axle Retreat shelters installed and in service.
• The shelter has been engineered and approved by the City Engineer for California wind and seismic loading requirements and has been approved by Foothill Transit for use under the Bus Stop Enhancement Program.
• Standardizing on a single shelter model improves maintenance efficiency by using common replacement parts and components, reduces spare parts inventory, and provides a consistent appearance throughout the City's transit system. • Procuring the same shelter model avoids unnecessary engineering, design revisions, and additional project costs.
• Specifying the Brasco International Axle Retreat shelter is necessary to match products already in use on a public improvement, consistent with Public Contract Code Section 3400(c)(2).

Replacing aging wooden shelters with durable prefabricated aluminum shelters will improve passenger comfort and accessibility, enhance the appearance of the City's transit system, reduce long-term maintenance costs, and provide a more reliable and consistent transit amenity for residents and visitors.

ALTERNATIVES
The City Council may elect not to authorize the purchase of the four additional bus shelters. Under this alternative, staff would proceed with installation of only the two Foothill Transit grant-funded shelters located on Bonita Avenue at Walnut Avenue and defer replacement of the remaining deteriorated shelters until future funding becomes available.

ENVIRONMENTAL REVIEW
This project is categorically exempt from the California Environmental Quality Act (CEQA) pursuant to CEQA Guidelines Section 15301, which allows for the replacement of existing public facilities involving negligible or no expansion of use. Replacement of existing bus shelters qualifies for this exemption.

Respectfully submitted,

Authorize the Appropriation of $49,900 for the Purchase and Installation of Four Additional Bus Shelters Page 5
For the Meeting of July 28, 2026
Genevieve Amaro
Management Aide
Attachments:

1. Staff Report Acceptance of BSEP Grant and Foothill Transit Agreement

2. Brasco International Quote

3. Photo of Brasco International Axle Retreat Bus Shelter

4. Levine Act Disclosure

Agenda Item Staff Report
To: Honorable Mayor and Members of City Council
For the Meeting of November 12, 2025
From: Brad McKinney, City Manager
Prepared by: Genevieve Amaro, Management Aide
Subject: Approve and Authorize the City Manager to Execute a Bus Stop Enhancement Program (BSEP) Funds Agreement with Foothill Transit; Approve and Authorize the Appropriation of $40,000 Upon Receipt of the Grant Revenue Funds.
____________________________________________________________________________

SUMMARY
In September 2025, Foothill Transit approved the City’s application for a grant in the amount of $40,000 in Bus Stop Enhancements Program funds to improve two bus stops on Bonita Avenue at Walnut Avenue. In order to receive these funds, the City must enter into an Agreement with Foothill Transit. This item authorizes entering into the appropriate agreement with Foothill Transit and to make the appropriate budget appropriation to recognize receipt of the grant revenue.

RECOMMENDATION
Staff recommends that the City Council:

1. Authorize the City Manager, or his designee, to execute the Bus Stop Enhancement Program Agreement with Foothill Transit in a form approved by the City Attorney, and

2. Authorize the appropriation of revenue in the amount of $40,000 when the grant revenue is received.

GOVERNMENT CODE §84308 APPLIES:
https://leginfo.legislature.ca.gov
No

FISCAL IMPACT
ATTACHMENT 1

Authorize the City Manager to execute Bus Stop Enhancement Program (BSEP) Funds Agreement with Foothill Transit ad Appropriate the Grant Revenue Upon Receipt Page 2 For the Meeting of November 12, 2025
If the City elects to enter into an agreement with Foothill Transit, the City would receive $40,000 in Bus Stop Enhancement Program (BSEP) grant funding available for the installation of two new bus shelters with seats, and solar lighting along Bonita Avenue at Walnut Avenue. This grant does not require a City match and would offset the majority of the total project cost. Based on current quotes received, the total estimated cost is $45,446.12, which includes $25,200 for two shelters, seats, and solar lighting, $11,746.12 for concrete pad installation, and approximately $8,500.00 for removal of existing shelters and installation of new ones. The estimated amount over the grant money would be funded through Proposition A funds (Fund 72), which are restricted for use for transit purposes and are already budgeted for Bus Stop Maintenance in the Fiscal Year 2025- 2026 budget.

The City maintains 35 bus stops and receives funds through Proposition A for the maintenance costs. The federal bus stop standard changed in spring 2024 requiring the City to schedule upgrades for all bus stops. The grant money would help offset some of these costs which are otherwise entirely funded from the City’s share of Proposition A funds.

It should also be noted that the City previously utilized BSEP grant funding in March 2022 to successfully upgrade bus shelters along Foothill Boulevard and San Dimas Canyon Road, improving transit amenities for riders. The new shelter has reduced maintenance requirements and code compliance activities at these stops. Acceptance of the current BSEP grant would allow the City to continue these ongoing systemwide improvements with less impact to local transit funds.

BACKGROUND
On July 31, 2025, the City of San Dimas Public Works Department applied for a Bus Stop Enhancement Program (BSEP) grant with Foothill Transit. This marks the second time the City has applied for and been awarded funding through this grant program. Foothill Transit approved the 2025 application and is willing to award the City $40,000 to upgrade two existing bus stops on Bonita Avenue at Walnut Avenue. To receive these funds, the City must enter into an Agreement with Foothill Transit. The two proposed bus stop locations can be found in this report (Attachment 1).

DISCUSSION/ANALYSIS
The Bus Stop Enhancement Program (BSEP) was developed to enrich customers experience when riding Foothill Transit.

In order to receive BSEP funds, the City must execute the attached agreement and adhere to the scope of work outlined in the agreement (Attachment 2). The scope of work outlined in the agreement requires the City to provide the following information to Foothill Transit.

Submit and complete approved designs and construction drawings of bus stop enhancements by agreed date;
Provide monthly update reports on enhancements by fifth day of every month once construction begins;
Submit invoices for reimbursement within 30 days of completion; Operations & Maintenance Plan;
Post-Construction Monitoring; and
Submit Work Schedule and Completion Date.

Authorize the City Manager to execute Bus Stop Enhancement Program (BSEP) Funds Agreement with Foothill Transit ad Appropriate the Grant Revenue Upon Receipt Page 3 For the Meeting of November 12, 2025
Staff has identified the bus stops located on Bonita Avenue at Walnut Avenue (westbound and eastbound Bonita Avenue respectively) as priorities in need of upgrading and included them in the grant request. Both locations have existing wooden bus shelters which are aging poorly. Staff proposes to remove the existing wooden shelters and replace them with a prefabricated metal shelter, seating, and solar lighting. The cost for each location is estimated to be approximately $22,723.

ALTERNATIVES
The City Council may elect not to enter into an Agreement with Foothill Transit, thereby forgoing the grant award. The City would be required to use Proposition A funds (Fund 72) for required upgrades of the bus stops.

ENVIRONMENTAL REVIEW
In accordance with the California Environmental Quality Act (CEQA), this item is statutorily exempt pursuant to CEQA Guidelines section 15262. The discussion of grant acceptance will not have an impact on the environment.

Respectfully submitted,
Genevieve Amaro
Management Aide
Attachments:

Attachment 1: New Bus Shelter and Existing Bus Stops Proposed for Modification Attachment 2: Agreement between Foothill Transit and City of San Dimas

Figure 1: Bonita Avenue and Walnut Avenue (Westbound)
(34°06'24.5"N 117°48'10.8"W)

Figure 2: Bonita Avenue and Walnut Avenue (Eastbound)
(34°06'23.6"N 117°48'09.2"W)

NP26-006.4
Bus Stop Enhancement Program
Grant Agreement Between
Foothill Transit and City of San Dimas
THIS AGREEMENT is made and entered into as of the date signed by Foothill Transit by and between FOOTHILL TRANSIT, a joint powers agency organized under the laws of the State of California with its principal place of business at 100 South Vincent Avenue, Suite 200, West Covina, California 91790, hereinafter referred t CITY OF SAN DIMAS, a municipal corporation, with its principal place of business located at 245 East Bonita Avenue, San Dimas, California 91773, hereinafter Foothill Transit and Grantee are
WHEREAS, Foothill Transit is the primary bus service provider for the Pomona and eastern San Gabriel Valleys; and
WHEREAS, Foothill Transit has developed the BUS STOP ENHANCEMENT PROGRAM to support bus stop enhancements undertaken by cities and counties within service area; and WHEREAS, Grantee is located in service area and has filed an application for grant Exhibit A, which
WHEREAS, Foothill Transit desires to provide grant funds to Grantee in the amount of $40,000 for the bus stop enhancements proposed by Grantee in the Application; and WHEREAS, Grantee has agreed to provide all additional funding required to design and construct the Enhancements.

NOW, THEREFORE, IT IS MUTUALLY AGREED AS FOLLOWS:

Section 1. Purpose and Scope
transfer of the Grant Funds to Grantee for the design and construction of the Enhancements as described in the Application.

NP26-006.4
Section 2. Term
This Agreement is effective as of the Effective Date and will terminate on one (1) year from the completion of the Enhancements (the "Termination Date"), unless terminated earlier, as provided herein, or extended by written approval from Foothill Transit.

Section 3. Construction of Enhancements

1. Grantee agrees to provide Foothill Transit approved record design and construction the Enhancements no later than _________________ (the Record f If the Record Drawings are not provided by the Record Drawings Date, this Agreement shall terminate and be of no further force or effect. The Record Drawings Date may be extended with Foothill Transit

2. Grantee agrees to complete the Enhancements in accordance with the Record Drawings within ______________ weeks of the Record Drawings Date (the . If the Enhancements are not substantially completed by the Substantial Completion Date, Foothill Transit, in its sole discretion, may terminate this Agreement. Upon such termination, the Agreement shall be of no further force and effect and Foothill Transit shall have no obligation to reimburse Grantee for any funds expended by Grantee. For purposes of this Agreement, the the Enhancements is sufficiently complete such that Grantee could, if necessary, occupy and utilize the Enhancements for their intended use.

3. Grantee shall be solely responsible for furnishing all supplies, equipment, installation, and labor required for the Enhancements.

4. Grantee shall design and construct the Enhancements in accordance with all applicable standards, codes, and regulations. Grantee shall ensure that all bus stops meet the applicable Accessibility Guidelines for Transportation Facilities set out as Appendices B and D to 36 C.F.R. Part 1191 (formerly Appendix A to 49 C.F.R. Part 37). As applicable, Grantee shall comply with, and shall cause its contractors and subcontractors to comply with, all applicable provisions of Division 2, Part 7, Chapter 1 (commencing with Section 1720) of the California Labor Code relating to public works and Section 6109 of the California Public Contract Code.

Section 4. Grant Amount and Requirements; Reimbursement

1. Foothill Transit will allocate to Grantee funds from the Bus Stop Enhancement Program in the amount of $40,000.00

2. Grantee is obligated to contribute all funding beyond the Grant Amount that may be required to design and construct the Enhancements.

3. In consideration for Foothill Transit's payment to Grantee of the Grant Amount, Grantee shall use the Grant Funds and the Local Match to design and construct the Enhancements as described in the Enhancements, Grantee shall report this to Foothill Transit on or before the sixtieth (60th) day prior to the Termination Date. Any Grant Funds not utilized by the Termination Date of this Agreement are

NP26-006.4
automatically released from this Agreement and may be redistributed by Foothill Transit for its own purposes.

4. Grantee represents to Foothill Transit that it possess the present power, ability, and authority to enter into this Agreement and to complete the Enhancements and provide for the use of the Enhancements. Grantee shall notify Foothill Transit as soon as possible but not more than thirty (30) days after the occurrence of any change in conditions, any change in local law, or any other event that may significantly affect ability to complete the Enhancements in accordance with the terms of this Agreement.

5. Reimbursement.
a. The Grant Amount shall be provided to Grantee on a reimbursement basis for funds actually expended by Grantee for the Enhancements shown on the approved Record Drawings. Grantee shall not be entitled to reimbursement for any Enhancements or other work not reflected on the approved Record Drawings. b. Grantee shall submit to Foothill Transit its invoice requesting reimbursement, together with a detailed itemization of costs incurred for which reimbursement is sought, within thirty (30) days of the completion of the Enhancements. c. Foothill Transit shall reimburse Grantee for all costs Foothill Transit determines to be reimbursable, in an amount not to exceed the Grant Amount, within sixty (60) days of invoice.
d. of the
Grant Amount. Grantee will act as an independent contractor and assumes all responsibility for federal and state income tax withholding, FICA, SDI, and any other deductions from income that Grantee is properly required to make as an independent contractor. Grantee assumes all responsibility for payment of wages to its employees and for federal and state income tax withholding. Grantee hereby agrees to indemnify and hold Foothill Transit, its officers and employees, harmless from any and all claims that may be made against Foothill Transit based upon any contention by any employee of Grantee or by any third party including but not limited to any state or federal agency, that an employer-employee relationship or a substitute therefore exists for any purpose whatsoever by reason of this Agreement or by reason of the nature and/or performance of any obligation under this Agreement.

Section 5. Monthly Reporting
Grantee shall submit monthly update reports to Foothill Transit concerning the status of the Enhancements.
day of each month. The first report shall be due on the 5th business day of the month following the month in which the work is commenced. The Grantee shall submit reports every month thereafter until substantial completion.

NP26-006.4
Section 6. Continuing Obligations
Following completion of the Enhancements, Grantee shall maintain the Enhancements in good condition, including the physical integrity and appearance of the shelter and bus stop modules, and provide repairs completion of the Enhancements, Grantee shall repair or replace any portion of the Enhancements damaged, destroyed, or
Section 7. Limitation of Liability; Indemnification

1. Neither Foothill Transit nor any of its Members, officials, officers, volunteers, agents, and staff (hereinafter referred to as
reason of any acts or omissions by Grantee, its officers, employees, or agents under or in connection with this Agreement.

2. Pursuant to Section 895.4 of the California Government Code, Grantee agrees to indemnify and hold harmless Indemnitees from and against any and all liability or expense, including any claim of liability, and any and all losses or costs (including reasonable legal expenses and costs of expert witnesses and consultants) arising from any actions or failures to act by Grantee pursuant to or in furtherance of this Agreement.

3. Grantee further agrees to indemnify and hold harmless Indemnitees from and against any and all liability or expense, including any claim of liability, and any and all losses or costs (including reasonable legal expenses and costs of expert witnesses and consultants) that may be imposed upon Foothill Transit pursuant to Section 895.2 of the California Government Code.

Section 8. Federal Civil Rights Requirements

1. In accordance with Title VI of the Civil Rights Act, as amended, 42 U.S.C. § 2000d, et seq., Section 303 of the Age Discrimination Act of 1975, as amended, 42 U.S.C. § 6101, et seq., Section 202 of the Americans with Disabilities Act of 1990, 42 U.S.C. § 12101, et seq., and Federal transit law at 49 U.S.C. § 5332, Grantee will not discriminate on the basis of race, color, national origin, sex, sexual orientation, age, or disability. In addition, Grantee agrees to comply with applicable Federal implementing regulations.

2. Grantee will not discriminate against any employee or applicant for employment based on race, color, religion, sex, sexual orientation, national origin, age, and disability. The Contractor will comply with: (a) Title VII of the Civil Rights Act of 1964, as amended, 42 U.S.C. § 2000e, et seq.; (b) Title I of the Americans with Disabilities Act of 1990, as amended, 42 U.S.C. § 12101, et seq.; (c) section 4 of the Age Discrimination in Employment Act of 1967, as amended, 29 U.S.C. § 623, (d) section 102 of the Americans with Disabilities Act, as amended, 42 U.S.C. § 12112; (e) Federal transit law, specifically 49 for Federal Tr
C.F.R. part 1630; (h) U.S. Equal Opportunity Employment Commission reg and requirements. Grantee recognizes that Title VII of the Civil Rights Act of 1964, as amended, exempts Indian Tribe

NP26-006.4

3. Grantee agrees to include the provisions of this Section in all contracts related to the design and construction of the Enhancements, modified only if necessary to identify the affected partie.

Section 9. Retention of Records and Audits

1. Grantee shall maintain complete and accurate records with respect to all costs and expenses incurred under this Agreement in accordance with generally accepted accounting practices. All such records shall be clearly identifiable. Grantee agrees that Foothill Transit or any of its duly authorized representatives, shall, for the purpose of audit and examination, be permitted to inspect all work, materials, payrolls, and other data and records, and to audit and copy the books, records, and accounts relating to the performance of the Agreement. Further, Grantee agrees to maintain all required records for at least three (3) years after Foothill Transit has made final payment and all other pending matters are closed.

2. Appropriate financial adjustments may be made by Foothill Transit based upon any inconsistency, irregularity, discrepancy, or unsubstantiated billing revealed as a result of an audit.

Financial adjustments reflecting an overcharge to Foothill Transit may be charged against Grantee.

Section 10. Representatives and Notices
Any correspondence, communication, contact concerning, or notice required by this Agreement shall be directed to the following:

Grantee: City of San Dimas
Attn: _____________________
245 East Bonita Avenue
San Dimas, CA 91773
Email: ____________________
Foothill Transit: Foothill Transit
Attn: Planning Dept
100 South Vincent Avenue
Suite 200
West Covina, CA 91790
Email: [email protected]
Any notices required by this Agreement shall be deemed received on (a) the day of delivery if delivered or (b) on the second business day following deposit in the United States mail, postage prepaid, to the addresses set forth above, or to such other addresses as the Parties may, from time to time, designate in writing pursuant to the provisions of this Section. Actual notice shall be deemed adequate notice on the date actual notice occurred, regardless of the method of service.

Section 11. Termination

1. Termination by Mutual Agreement. Notwithstanding the term of this Agreement, Foothill Transit and Grantee may mutually terminate this Agreement upon ten (10) days written notice if approved by both parties.

NP26-006.4

2. Termination for Default.
a. Default under this Agreement is defined as one or more of the following: (i) Grantee fails to comply with the terms and conditions contained in this Agreement; (ii) Grantee fails to perform satisfactorily or to make sufficient progress toward substantial completion; (iii) Grantee makes a material change to the Enhancements without prior written consent or approval by Foothill Transit; or, (iv) Grantee is in default of any other applicable requirements of Foothill Transit.
b. In the event of a default by Grantee, Foothill Transit shall provide written notice of such default to Grantee. Grantee shall have 30 days to cure the default. In the event Grantee fails to cure the default, or commit to cure the default and commence the same, within such 30-day period to the satisfaction of Foothill Transit, Foothill Transit may take one or more of the following actions: (i) terminate this Agreement; or (ii) decline to pay the Grant Amount, or any portion thereof, to Grantee.
c. Effective upon receipt of written notice of termination from Foothill Transit, Grantee shall not undertake any new work or obligation with respect to this Agreement, and Foothill Transit shall have no obligation to reimburse Grantee for any funds expended by Grantee, except as otherwise agreed to by the Parties. d. The remedies described herein are not exclusive. Foothill Transit shall have the right to enforce any and all rights and remedies herein or which may be now or hereafter available at law or in equity.

3. Termination for Convenience. Foothill Transit may terminate this Agreement at any time and for any reason by providing Grantee written notice of such termination at least thirty (30) calendar days prior to the effective date of such termination. Upon such termination, Grantee shall be entitled to compensation for activities in accordance with this Agreement which were incurred prior to the effective date of the termination, but not exceeding the Grant Amount.

Section 12. General Provisions

1. This Agreement shall be subject to, governed by, and construed and interpreted solely according to the laws of the State of California. Grantee hereby consents and submits to the jurisdiction of the appropriate courts of California or of the United States having jurisdiction in California for adjudication of any suit or cause of action arising under or in connection with the Agreement, or the performance of such Agreement, and agrees that any such suit or cause of action may be brought in any such court.

2. This Agreement contains the entire agreement of the Parties with respect to the subject matter hereof, and supersedes all prior negotiations, understandings or agreements. No supplement, modification, or amendment of this Agreement shall be binding unless executed in writing and signed by both Parties.

3. This Agreement may be executed in multiple counterparts, each of which shall be an original but all of which shall constitute the same document. A signed copy of this Agreement delivered