Santa Monica City Council
September 26, 2023

1. Introduction
Moffatt & Nichol (M&N) was retained by the City of Santa Monica (City) to perform inspection, assessment, and rehabilitation engineering services for the Santa Monica Municipal Pier (Pier) facilities, located at the foot of Colorado Avenue in Santa Monica, California. This waterfront inspection report is part of an assessment project that will identify potential Pier defects and associated rehabilitation options.

Additional services required to produce engineering bid documents for the recommended repairs mentioned in this report for award to a marine contractor to construct are assumed to be outside the scope of this assessment but can be provided under a separate future task order.

The inspections were conducted between July 24 and September 7, 2018. The effort included inspection of above water and submerged (underwater) structural components. The field investigations were performed under the staff supervision of Jerry Holcomb, PE (Above Water Team Leader) and Mike Breitenstein, PE (Underwater Team Leader).

Inspection Scope of Work
The Scope of Work for this effort included above water and underwater inspection of the timber, concrete, and steel structural portions of the Santa Monica Municipal Pier. The Pier extends from the concrete approach bridge to and including the end platform for an overall length of approximately 1,600 feet. This Pier forms the main thoroughfare for pedestrian and vehicular access to the commercial and recreational areas of the Pier. Most of the Pier is comprised of timber, except the furthermost westerly 600 feet, including the end platform, which is concrete with timber decking. In general, the field investigations consisted of:
¾ Above Water Inspection.
o Visually inspect decking, stringers, blocking, pile caps, piles, cross bracing, and structural connections between these members utilizing M&N crew directly on the beach and with small work boat for use during under-deck site investigations. ¾ Underwater Inspection was performed by a 4-man surface supplied air (SSA) crew consisting of commercially trained M&N Engineer-Divers. Inspection efforts were in accordance with the American Society of Civil Engineers (ASCE) Manual No. 130, “Waterfront Facilities Inspection and Assessment” standard practices, as follows:
o Level I inspection effort of 100% of timber and concrete piles. This effort consists of a close visual examination of the entire submerged structure to detect obvious damage or deterioration. This effort will assess the integrity of the structural members as well as the detection of undermining or exposure of normally buried elements. o Level II inspection effort of 10% of timber and concrete piles chosen at random. This effort includes removal of marine growth in three 12-inch bands (splash zone, mudline, and middepth), and close examination of the underlying material. o Level III inspection effort is not included in the scope of this inspection. (This more detailed level of effort to assess health of piles could include dissolved oxygen laboratory testing, timber and concrete coring, or other means to detect deterioration. The determination of the need for this effort was to be made after the initial condition had been assessed.)

5.E.b
Packet Pg. 534 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

¾ Provide Summary Report with photographs and a description of the findings of the above and underwater inspection. The draft report is to be submitted as soon as possible after inspection.

Exclusions
The scope of the inspection and assessment services excluded certain landside and above-deck Pier support facilities, including but not limited to: Topside Buildings and Amusement Structures, Topside Architectural Furnishings (benches, light poles, etc.), Landside Concrete Abutments and/or Bulkhead Walls, and Waterside Shore Protection & Rock Revetments. The scope of work also excluded existing electrical and wet utilities, including but not limited to: Pier lighting, shore power, tie-ins to existing buildings, potable water, sewage, fire water, gas, storm drain, and other existing landside utilities.

Documentation Review
The following documents were provided by the City and reviewed by M&N prior to conducting this inspection and can be found in Appendix F:
¾ Record drawings titled, “Santa Monica Municipal Pier Railing and Lighting Replacement and Deck Upgrade- Area 4, SP 2465,” Prepared by City of Santa Monica, Department of Public Works, dated May 2017
¾ Record drawings and inspection report titled, “Construction Observations of Pacific Park Concrete Pile Repairs”, Prepared by AECOM, dated July 2016
¾ Record drawings titled, “Santa Monica Phase 4 Municipal Pier Replacement, SP 2124”, prepared by URS, dated October 2012
¾ Geotechnical soils report titled, “Clean Beaches Project, Geotechnical Investigation Report,” prepared by Tetra Tech, dated February 2017
¾ Record drawings titled, “Santa Monica Municipal Pier,” Prepared by Theodore E. Anvick, dated January 1989
¾ Previous pier assessment report titled, “Pier Infrastructure Assessment Study,” prepared by Moffatt & Nichol, dated November 2008

5.E.b
Packet Pg. 535 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

2. Background and Description of Facilities
Existing Facilities Description
The scope of this inspection and assessment focuses on the Pier, located within the Santa Monica Bay in Southern California. The Pier is located within the City limits of Santa Monica on the coast of the Pacific Ocean south of Malibu and north of Venice Beach, in Los Angeles County, 15 miles west of downtown Los Angeles (see Figure 2-1).

Figure 2-1: Project Location
The Santa Monica Bay is a naturally occurring littoral inlet cell that spans from Point Mugu to the Palos Verdes Peninsula. The Pier in its current configuration completed construction in 1996, with the official opening of the Pacific Park amusement park. The Pier is approximately 350,000 square feet in area and located at the approximate address of 200 Santa Monica Pier St., south of Colorado Ave. (see Figure 2-1).

The Pier extends from the concrete approach bridge to, and including, the end platform for an overall length of approximately 1,600 feet. The width of the Pier varies from approximately 300 feet at its widest to approximately 35 feet at its narrowest, towards the west end platform approach. Mudline elevations near the Pier at the western waterside portion vary from roughly 0-feet Mean Lower Low Water (MLLW) depth to -20-feet MLLW (see Figure 2-2). Beach elevations near the Pier at the eastern landside portion vary from roughly 0-feet MLLW to +10-feet MLLW.

5.E.b
Packet Pg. 536 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Figure 2-2: Aerial View of Project Site
The Santa Monica coastline has historically seen several different pier configurations since the early 1900s. The original pier configuration was constructed in 1909 to support, and house, an ocean outfall pipeline that carried treated sewage into the ocean. This original pier was one of the first of its kind to be constructed completely from concrete; however, due to harsh ocean conditions that caused rapid deterioration, this pier was demolished, and a new pier was erected in 1916 utilizing creosote treated timber piles. With the construction of the new pier, local entrepreneurs and City Council members saw the opportunity to reimagine the facilities as a pleasure pier and recreational fishing hub. Of the notable attractions on the new pier, The Hippodrome was a large building constructed to house a Pier Carousel that later became Santa Monica’s first national Historic landmark. Later in 1933, it was envisioned that a Santa Monica Yacht Harbor would be an attraction to offer a safe destination for vessel landings, and thus an offshore rubble-mound breakwater was constructed. The pier continued to undergo several fragmented repairs over the years until 1983, when the pier and breakwater were damaged by severe storms and condemned for safety reasons. By 1990 most of the pier had been rebuilt, and in 1996 the official opening of Pacific Park amusement park completed the pier we know today. This pier incorporated the portion of the original timber “Newcomb Pier” that survived the 1983 storms.

Pier ZONE Identification
A naming convention for the pier was adopted for ease in identifying the variety of structural elements that were inspected. The overall pier was broken into four (4) different ZONES that correspond to the vintage of pier construction, materials of construction, and location within the existing pier footprint. A layout of the overall pier describing the designated areas is shown in Figure 2-3. In addition, a description of each area has been provided later in this section for help in understanding the structure configuration.

5.E.b
Packet Pg. 537 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

The existing pier is constructed with approximately 103 pile bents (rows of piles). Refer to Appendix B for reference plan layouts of the existing pier. A breakdown of the different areas and description of locations is as follows:
x ZONE 1: Bent 0 through Bent 53
o Composed of primarily of restaurant buildings, concession buildings, and top-side pier parking lots.
o Structural composition is timber piles with timber deck support elements. x ZONE 2: Bent 35 through Bent 53
o Support the large foundations required for Pacific park amusement rides, games, and arcade areas.
o Structural composition is concrete piles with concrete deck support elements. x ZONE 3: Bent 42 through Bent 59.8
o Supports an approach walkway that leads to the west-end platform and is composed of mainly open space, benches, and architectural features. o Structural composition is concrete piles with concrete deck support elements. x ZONE 4: Bent 60 through Bent 103
o Composed of the west-end platform portion of the Pier that houses fishing platforms along the outboard edge and supports additional restaurant, concession, and local police buildings with a walkway in the center of the Pier. o Structural composition is concrete piles with concrete deck support elements.

Figure 2-3: Pier ZONE Identification System

5.E.b
Packet Pg. 538 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

ZONE 1 - Timber East-End Pier (Bent 0 – Bent 53)
Pier ZONE 1 facilities are comprised entirely of a fixed timber pier substructure with additional appurtenances that facilitate public use for its customers. ZONE 1 has open access to the public yearround and is mostly utilized by pedestrians, tourists, and those accessing the pier-side parking lots.

The pier substructure is comprised of timber piles, pile caps, stringers, lateral and transverse cross bracing, and deck planks. Loading on the top-deck of the pier is transferred through the deck boards to deck support stringer elements beneath. These elements rest on top of a pile cap member that then transfer loads to the timber piles, which are embedded deep into the ground to transfer load to surrounding soils.

The piles are also supported laterally with lateral bracing to adjacent piles in both the longitudinal and transverse axis of the pier. Located along the length of the pier are single-story commercial concession buildings and restaurants that are fully enclosed and various open-air patio areas for customers with a walkway on the northern and southern edges of the Pier. A partial cross section showing the typical Pier support substructure is provided in Figure 2-4.

Figure 2-4: Typical Pier Cross Section (ZONE 1: Municipal Pier & Newcomb Pier) (Moffatt & Nichol Engineers, Santa Monica Pier Assessment Report dated November 2008) ZONE 2 - Concrete Amusement Structure Pier (Bent 35 – Bent 53) Pier ZONE 2 facilities are comprised entirely of a fixed concrete pier with additional appurtenances that facilitate public use for its customers. ZONE 2 has limited access to the public year-round and has various

5.E.b
Packet Pg. 539 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

fences and gates to protect public safety due to amusement structures and is mostly utilized by pedestrians, tourists, and those accessing the amusement rides at Pacific Park.

The pier substructure is comprised of concrete piles, capitals, pile cap strut-and-tie elements, and supports timber stringers and deck planks. Loading on the top-deck of the pier is transferred through the deck boards to deck support timber stringer elements beneath. These elements rest on top of a concrete pile cap member that then transfer loads to the concrete piles, which are embedded deep into the ground to transfer load to surrounding soils. Located along the length of the pier are an array of amusement rides, games, and commercial concession buildings. A partial cross section showing the typical pier support substructure is provided in Figure 2-5.

Figure 2-5: Typical Pier Cross Section (ZONE 2: Amusement Structure) (AECOM Engineers, Pile Repair Project dated June 2016)
ZONE 3 - Concrete West-End Approach Pier (Bent 42 – Bent 59.8) Pier ZONE 3 facilities are comprised entirely of a fixed concrete pier with additional appurtenances that facilitate public use for its customers. ZONE 3 has open access to the public year-round and is mostly utilized by pedestrians, tourists, and fishermen.

The pier substructure is comprised of concrete piles, pile cap strut-and-tie elements, and supports timber stringers and deck planks. Loading on the top-deck of the pier is transferred through the deck boards to deck support timber stringer elements beneath. These elements rest on top of a concrete pile cap member that then transfer loads to the concrete piles, which are embedded deep into the ground to transfer load to surrounding soils. Located along the length of the pier are mainly open space, benches, and

5.E.b
Packet Pg. 540 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

architectural features. A general cross section showing the pier support substructure is provided in Figure 2-6.

Figure 2-6: Typical Pier Cross Section (ZONE 3: West-End Approach) (URS Engineers, Phase 4 Pier Upgrades Project dated September 2012) ZONE 4 - Concrete West-End Platform Pier (Bent 60 – Bent 103) Pier ZONE 4 facilities are comprised entirely of a fixed concrete pier with additional appurtenances that facilitate public use for its customers. ZONE 4 has open access to the public year-round and is mostly utilized by pedestrians, tourists, fishermen, and the local police and lifeguard.

The pier substructure is comprised of concrete piles, waffle slab elements, and supports timber sleepers and deck planks. Loading on the top-deck of the pier is transferred through the deck boards to deck support timber sleeper elements beneath. These elements rest on top of a concrete waffle slab that then transfer loads to the concrete piles, which are embedded deep into the ground to transfer load to surrounding soils. Located along the length of the pier are mainly fishing platforms along the outboard edge, restaurant, concession, and local police buildings. A general cross section showing the pier support substructure is provided in Figure 2-7.

5.E.b
Packet Pg. 541 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Figure 2-7: Typical Pier Cross Section (ZONE 4: West-End Platform) (Theodore E. Anvick Consulting Structural Engineers, Original Construction Project dated January 1989)

5.E.b
Packet Pg. 542 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

3. Repair Recommendation Criteria
Element Damage and Overall System Condition Assessment Ratings The ASCE Manual No. 130, “Waterfront Facilities Inspection and Assessment” includes standardized element-level damage ratings for structural elements of the various materials found in waterfront structures’ components and systems. The basic terms used to rate the damage of each element are listed below and will be used in this report to describe the severity of defects observed on structural elements. ¾ NI – Not Inspected
¾ ND – No Defects
¾ MN – Minor Damage
¾ MD – Moderate Damage
¾ MJ – Major Damage
¾ SV – Severe Damage
Individual element ratings details vary by an element’s material. Pertinent materials’ element ratings details and additional definitions and descriptions for overall system ratings can be found in Appendix A.

General Phasing of Repair Recommendations
Reference is made to the observations of defects and damages detailed in Section 4 of this report, and associated photos, which provide general descriptions for the findings of this inspection.

Repair recommendations are divided into four (4) repair priority categories:
¾ Priority Repairs – Components assigned a rating of “Severe” should be repaired or replaced immediately.
¾ Short-term Repairs – Complete repairs within 1-5 years. Those defect items that have been identified as having “Major Damage” should be monitored closely until repair has been completed.
¾ Long-term Repairs – A lower-priority repair is recommended for items identified as having “Moderate Damage.” It is anticipated components will require repairs or replacement within the next 5-10 years or following a significant storm wave or other significant event. ¾ Deferred Maintenance Recommendations – The lowest priority is given for ongoing maintenance items for “Minor Damage.” Components should continue to be monitored with follow-on inspections every five (5) to ten (10) years or following a significant storm wave or other significant event. Due to their low-priority, these Minor deficiencies are not detailed in this report; however, they can be viewed in the GIS Database provided in Appendix B.

It is recommended future Pier inspections be conducted at regular intervals according to normal industry standard, every five (5) to ten (10) years or following a significant storm wave or other significant event.

5.E.b
Packet Pg. 543 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

4. Municipal Pier Inspection Observations
General Observations
Visual inspection was performed on the pile-supported substructure and related structural components.

General arrangements of buildings on the top-side of the pier and additional pier appurtenances, were noted but not considered a part of this inspection. All structural elements were rated on a scale discussed in Section 3.1, “Element Damage and Overall System Condition Assessment Ratings,” and detailed in Appendix A. The results are summarized in the following observation and recommendation portions of this report. Only a summary of the observed conditions is noted in the body of this report, refer to Appendix E for a full summary of element defects and damage ratings.

To achieve acceptable and safe results, M&N used two four-person teams for the Above Water (AW) and Underwater (UW) inspections. AW inspections took place between July 24 and September 7, 2018. UW inspections took place between August 27 and August 31, 2018. For the underwater portion of the inspection, inspectors used SSA (Surface Supplied Air) from our company boat, and inspectors used all necessary safety equipment and precautions when preforming the inspections. In addition, two iPads were utilized to gather digital data entry for both the UW and AW inspections. The Pier inspection went from Bent 0 though Bent 103, splitting up the inspection into four sections, as shown in Figure 4-1.

The existing Pier is configured in a general rectangular shape on the larger landside portion and transitions to a narrower waterside approach and platform. Bents 0 through 53 form the larger landside abutment area while Bent 53 through 103 makeup the approach walkway that leads to the end platform and the west-end platform itself. The number of total piles that support the pier is approximately 2,180. The existing Pier has various previous repairs visible, which have been completed at various intervals in the past. This condition is typical for similar pier structures with regular maintenance cycles. Photos depicting the different Pier framing systems are provided below.

Figure 4-1: Pier Area Identification System

5.E.b
Packet Pg. 544 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Photo 4-1: Overall view of the Pier as seen from Palisades Park looking to the southwest.

Photo 4-2: Pier entrance as seen from entrance bridge structure looking west.

5.E.b
Packet Pg. 545 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Photo 4-3: ZONE 2 Amusement Structure transition from ZONE 1 East-End Structure as seen from the West-End Approach looking southeast.

Photo 4-4: Transition between ZONE 3 West-End Approach, ZONE 1 East-End Structure, and ZONE 2 Amusement Structure from boat looking to the east.

ZONE 2
Concrete
Structure
ZONE 1
Timber
Structure
ZONE 1
Timber
Structure
ZONE 3
Concrete
Structure
ZONE 2
Concrete
Structure

5.E.b
Packet Pg. 546 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Photo 4-5: ZONE 3 West-End Approach transition from ZONE 4 West-End Platform Structure Photo 4-6: West-End Platform portion of the Pier with concrete waffle slab.

ZONE 3
Concrete
Structure
ZONE 4
Concrete
Structure

5.E.b
Packet Pg. 547 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) This area of the Pier represents the remaining timber portion of the Pier; the newer concrete portions will be addressed later in the report. The Pier substructure and structural elements within this portion of the Pier include timber piles, timber pile caps, timber stringers, timber and steel lateral and transverse bracing, and timber deck elements. This portion of the Pier extends from Bent 0 from a concrete retaining wall to Bent 53, which includes in-water portions. Refer to Figure 4-2 below.

Figure 4-2: ZONE 1 Site Plan - Timber East-End Portion of Pier

4.2.1. Item 1- Timber Piles
The timber piles were inspected above and below water. Below water inspection comprised a Level I effort on all piles, and Level II effort on 10% of all piles. Level I effort is defined as visual inspection only, and Level II involves the removal of marine growth in three 1-foot wide bands near the waterline, at middepth, and near the mudline, as seen in Photo 4-7.

Photo 4-7: Typical timber pile condition under water (Level II inspection effort).

5.E.b
Packet Pg. 548 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

The timber piles supporting the Pier were identified to be round timber piles ranging from 10 inches to 16 inches in diameter. The exposed length of each timber pile supporting the Pier, from the sea floor to the underside of the Pier, varies from approximately 10 feet at the landside end of the pier to 40 feet towards the waterside end. The pile embedment depths were not verified as part of this investigation. As observed, ZONE 1 of the Pier is supported by a total of approximately 1,580 timber piles. These piles are responsible for transferring all applicable loading from the Pier to the beach and seabed.

All timber piles appear to be treated with preservative. Several of the piles observed appear to have previous jacket repairs or have a fiber wrap around the tide level. The jacket repairs and fiber wraps were likely applied to protect the piles from deterioration due to marine borers, fungal rot, insect attack, and other environmental factors. These repair methods serve to extend the service life of the piles and help to protect them from future deterioration.

Observations found defects that ranged in condition from Minor to Severe. Below is a summary of the observations for the ZONE 1, Item 1 - Timber Piles.
x 18 piles from the overall structure are categorized as having Severe defects. o Deficiencies noted included deterioration resulting in greater than a 50% loss of the expected structural capacity, significant voids, missing top connection, and excessive rotting and splitting. (See Photo 4-8 and Photo 4-9).
o A total of 10 of the 18 Severe piles are located beneath building structures. x 87 piles from the overall structure are categorized as having Major defects. o Deficiencies noted included deterioration resulting in a 25% to 50% loss of the expected structural capacity, significant splits, and apparent instability observed relative to some portions of the structural member. (See Photo 4-10).
o A total of 31 of the 87 Major piles are located beneath building structures. x 387 piles from the overall structure are categorized as having Moderate defects. Though not as urgent as other repairs, these defects should be addressed and/or monitored for future potential worsening of the deterioration.
o Note: Defects included deterioration resulting in a 5% to 25% loss of the expected structural capacity, missing or torn pile wraps, open bolt holes, and improper seating of piles at the pile cap (see Photo 4-11).
o A total of 145 of the 387 Moderate piles are located beneath building structures.

5.E.b
Packet Pg. 549 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Photo 4-8: ZONE 1 - Timber Pile Severe Defect,
Pile 11.5q
Photo 4-9: ZONE 1 - Timber Pile Severe Defect,
Pile 47i.7
Photo 4-10: ZONE 1 - Timber Pile Major Defect,
Pile 46f
Photo 4-11: ZONE 1 - Timber Pile Moderate Defect,
Pile 47c

5.E.b
Packet Pg. 550 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

4.2.2. Item 2 – Timber Pile Caps
The timber pile caps that support the pier deck were identified to consist of timber members ranging in size from 12-inch x 12-inch to 12-inch x 24-inch during the site inspection. The pile caps span along the bents in a north-south direction of the Pier with lengths varying depending on the width of the Pier. As observed, ZONE 1 of the Pier is supported by a total of approximately 53 timber bents. These timber pile caps are responsible for transferring all applicable loading from the upper deck elements to the piles beneath.

In some cases, previous repairs have been made to pile cap members either by splicing or with the addition of a ‘corbel’ underneath the existing pile cap where a new pile was used to make contact with the cap above.

Observations found defects that ranged in condition from Minor to Severe. Below is a summary of the observations for the ZONE 1, Item 2 - Timber Pile Caps. x 7 pile caps from the overall structure are categorized as having Severe defects. o Deficiencies noted included deterioration resulting in greater than a 50% loss of the expected structural capacity, significant voids, significant indication of ‘dry rot’, and excessive splitting. (See Photo 4-12 and Photo 4-13).
o A total of 1 of the 7 Severe pile cap locations are located beneath building structures. x 25 pile caps from the overall structure are categorized as having Major defects. o Deficiencies noted included deterioration resulting in a 25% to 50% loss of the expected structural capacity, significant splits, and apparent instability observed relative to some portions of the structural member. (See Photo 4-14).
o A total of 9 of the 25 Major pile cap locations are located beneath building structures. x 110 pile caps from the overall structure are categorized as having Moderate defects. Though not as urgent as other repairs, these defects should be addressed and/or monitored for future potential worsening of the deterioration.
o Note: Defects included deterioration resulting in a 5% to 25% loss of the expected structural capacity, missing hardware, open bolt holes, and improper seating of piles at the pile cap (see Photo 4-15).
o A total of 25 of the 110 Moderate pile cap locations are located beneath building structures.

5.E.b
Packet Pg. 551 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Photo 4-12: ZONE 1 - Timber Pile Caps Severe Defect,
Caps 31K-31O
Photo 4-13: ZONE 1 - Timber Pile Caps Severe Defect,
Caps 41K-41O
Photo 4-14: ZONE 1 - Timber Pile Caps Major Defect,
Caps 41a-41c
Photo 4-15: ZONE 1 - Timber Pile Caps Moderate
Defect, Caps 39M-39O

5.E.b
Packet Pg. 552 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

4.2.3. Item 3 – Timber/Steel Lateral and Transverse Bracing The timber lateral bracing that provides lateral support for the Pier structure was identified to consist of timber members approximately 4-inch x 8-inch in size. While the steel lateral bracing was identified to consist of steel tubular members approximately 3-inches in diameter x 1/4-inch thick. The lateral bracing spans between pile bents in both the longitudinal north-south direction and transverse east-west direction of the pier. These lateral bracing elements are responsible for transferring lateral loads between piles, allowing the Pier structure to act as a truss system.

There are several types of steel connecting hardware under the structure. In the marine environment, these elements typically fail as a result of steel corrosion. Galvanizing typically delays the onset of corrosion and application of coatings can be somewhat effective in mitigating rust. Most of the connectors are galvanized. The corrosion rating for most of the connectors fall within the Minor or Moderate categories. A lesser percentage of the connectors are rated as Major or Severe with up to 100% coating loss and moderate corrosion on the hardware.

Providing more detailed assessment of difficult-to-access hardware was outside of the safely allowed operational parameters of this inspection, but corrosion of steel connection hardware to some degree is typical throughout the structure. It is recommended that all hardware be inspected on a yearly basis and replaced with new hardware as needed.

Observations found defects that ranged in condition from Minor to Severe. Below is a summary of the observations for the ZONE 1, Item 3 - Timber/Steel Lateral and Transverse Bracing. x 46 brace members (38 timber / 8 steel) from the overall structure are categorized as having Severe defects.
o Deficiencies noted included deterioration resulting in greater than a 50% loss of the expected structural capacity, significant voids, significant indication of ‘dry rot,’ and full depth split at ends of bracing and failure in blocking between members. These lateral braces are split at the ends or have become disconnected from their mechanical connections. This condition will no longer allow the bracing to transfer lateral loads to the applicable members (see Photo 4-16 and Photo 4-17).
x 123 brace members (111 timber / 12 steel) from the overall structure are categorized as having Major defects.
o Deficiencies noted included deterioration resulting in a 25% to 50% loss of the expected structural capacity, significant splits, excessive corrosion at hardware, and major rotting. (See Photo 4-18).
x 475 brace members (461 timber / 14 steel) from the overall structure are categorized as having Moderate defects. Though not as urgent as other repairs, these defects should be addressed and/or monitored for future potential worsening of the deterioration. o Note: Defects included deterioration resulting in a 5% to 25% loss of the expected structural capacity, missing hardware, open bolt holes, and noticeable rotting (see Photo 4-19).

5.E.b
Packet Pg. 553 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Photo 4-16: ZONE 1 - Timber Bracing Severe Defect,
Pile 42n-43n
Photo 4-17: ZONE 1 - Timber Bracing Severe Defect,
Pile 41K-41M
Photo 4-18: ZONE 1 - Steel Bracing Major Defect,
Pile 47c-47d
Photo 4-19: ZONE 1 - Timber Bracing Moderate Defect,
Pile 43a-44a

5.E.b
Packet Pg. 554 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

4.2.4. Item 4- Timber Stringers
The timber stringers that support the Pier deck were identified to consist of timber members ranging in size from 3-inch x 12-inch to 4-inch x 16-inch during the site inspection. The stringers span across the bents in the east-west direction of the Pier with lengths varying depending on the bent spacing. As observed, the stringers are spaced varies from approximately 16 inches to 22 inches on-center along the pile bents. These timber stringers are responsible for transferring loading from the deck planks to the pile bents beneath.

Observations found defects that ranged in condition from Minor to Severe. Below is a summary of the observations for the ZONE 1, Item 4 - Timber Stringers. x 2 stringer locations from the overall structure are categorized as having Severe defects. o Deficiencies noted included deterioration resulting in greater than a 50% loss of the expected structural capacity, significant splitting, significant indication of ‘dry rot’, and in some instances missing stringers were noted. This can lead to localized sagging in the pier deck and cause a structural discontinuity. (See Photo 4-20 and Photo 4-21). x 11 stringer locations from the overall structure are categorized as having Major defects. o Deficiencies noted included deterioration resulting in a 25% to 50% loss of the expected structural capacity, significant splits, and apparent instability observed relative to some portions of the structural member. (See Photo 4-22).
x 25 stringer locations from the overall structure are categorized as having Moderate defects.

Though not as urgent as other repairs, these defects should be addressed and/or monitored for future potential worsening of the deterioration.
o Note: Defects included deterioration resulting in a 5% to 25% loss of the expected structural capacity, missing hardware, open bolt holes, and limited under deck stringer support in the vicinity of the pier entrance ramp (see Photo 4-23). In some locations stringers are spaced approximately 3 feet on-center along the length of the pier. Typical new construction would consider stringer spacing at 16 inches on-center. It is unclear if these members have sufficient structural capacity for the deck support above. Additional structural calculations could confirm the adequacy of these members.

5.E.b
Packet Pg. 555 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Photo 4-20: ZONE 1 - Stringer Area Severe Defect,
Pile 37k-37n-38k-38n
Photo 4-21: ZONE 1 - Stringer Area Severe Defect,
Pile 36l-36m-37l-37m
Photo 4-22: ZONE 1 - Stringer Area Major Defect,
Pile 6q-6p-7p-7o
Photo 4-23: ZONE 1 - Stringer Area Moderate Defect,
Pile 23p-23r-24r-24p

5.E.b
Packet Pg. 556 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

4.2.5. Item 5 - Timber Decking
The timber decking that provides a walking surface for the Pier was identified to consist of timber members 3-inch x 12-inch in size, laid flat. The deck boards span across the stringers in the north-south direction of the Pier and are fastened to the stringers beneath with nails.

The following is a summary of the conditions of the Pier timber decking from the recent site inspection.

The timber decking was in overall fair to poor condition and its condition should be monitored and maintenance repairs made as needed. Several previous repairs to the decking were noted during the inspection. These repairs were made to replace damaged decking and gaps that may have resulted in a tripping hazard. The defects observed were not considered structural in nature but consisted of split members and holes that should be monitored and repaired during normal maintenance cycles.

Observations found defects that ranged in condition from Minor to Major. Below is a summary of the observations for the ZONE 1, Item 5 – Timber Decking.
x 0 decking locations from the overall structure are categorized as having Severe defects. x 5 decking locations from the overall structure are categorized as having Major defects. o Deficiencies noted included deterioration resulting in a 25% to 50% loss of the expected structural capacity, significant splits, excessive corrosion at hardware, and major rotting. (See Photo 4-24 through Photo 4-26).
x 4 decking locations from the overall structure are categorized as having Moderate defects.

Though not as urgent as other repairs, these defects should be addressed and/or monitored for future potential worsening of the deterioration.
o Note: Defects included deterioration resulting in a 5% to 25% loss of the expected structural capacity, missing hardware, open gaps and holes, and noticeable splitting and rotting (see Photo 4-27).

5.E.b
Packet Pg. 557 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Photo 4-24: ZONE 1 - Decking Area Major Defect,
Defect Area 2
Photo 4-25: ZONE 1 - Decking Area Major Defect,
Defect Area 7
Photo 4-26: ZONE 1 - Decking Area Major Defect,
Defect Area 6
Photo 4-27: ZONE 1 - Decking Area Moderate Defect,
Defect Area 4

5.E.b
Packet Pg. 558 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

ZONE 2 - Concrete Amusement Structure Pier Segment (Bent 35 – Bent 53) This area of the Pier represents the concrete portion of the Pier that supports the amusement rides located within Pacific Park. The Pier substructure and structural elements within this portion of the Pier include concrete piles, concrete capitals, concrete pile caps, timber stringers, and timber deck elements.

This portion of the Pier extends from approximately Bent 35 to Bent 53, which includes support structures for the amusement rides located on the Pier as well as in-water portions. Refer to Figure 4-3 below.

Figure 4-3: Site Plan – Concrete Amusement Structure Portion of Pier

4.3.1. Item 6 - Concrete Piles
The concrete piles supporting the Pier were identified to be round concrete piles ranging from 18 inches to 24 inches in diameter. The exposed length of each concrete pile supporting the Pier varies from approximately 20 feet at the landside end of the pier to 40 feet towards the waterside end. As observed, ZONE 2 of the Pier is supported by a total of approximately 330 concrete piles. These piles are responsible for transferring applicable loading from the Pier to the seabed. Several of the piles observed appear to have previous jacket repairs near the top connection between the pile cap. (See Photo 4-28).

Photo 4-28:Typical Previous Concrete Pile Jacket Repair

5.E.b
Packet Pg. 559 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Observations found defects that ranged in condition from Minor to Major. Below is a summary of the observations for the ZONE 2, Item 6 – Concrete Piles.
x 0 piles from the overall structure are categorized as having Severe defects. x 1 pile from the overall structure are categorized as having Major defects. o Deficiencies noted included deterioration resulting in a 25% to 50% loss of the expected structural capacity, significant spalling, and exposed or corroded rebar in some portions of the structural member. (See Photo 4-29 and Photo 4-30). x 32 piles from the overall structure are categorized as having Moderate defects. Though not as urgent as other repairs, these defects should be addressed and/or monitored for future potential worsening of the deterioration.
o Note: Defects included deterioration resulting in a 5% to 25% loss of the expected structural capacity, rust bleeds, exposed jet tube voids, and notable cracking, spalling, and corrosion of piles at the pile cap (see Photo 4-31 and Photo 4-32).

Photo 4-29: ZONE 2 - Concrete Pile Major Defect,
Pile AS_24G
Photo 4-30: ZONE 2 - Concrete Pile Major Defect,
Pile AS_24G
Photo 4-31: ZONE 2 - Concrete Pile Moderate Defect,
Pile AS_32B
Photo 4-32: ZONE 2 - Concrete Pile Moderate Defect,
Pile 53q_W

5.E.b
Packet Pg. 560 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

4.3.2. Item 7 - Concrete Pile Capitals
The concrete pile capitals are mushroom caps at the top of the pile that connect the piles to the pile caps.

These members were identified to consist of concrete formed into an octagonal shape and approximately 36-inch x 36-inch in size. The pile capitals are located at the top of each pile. These concrete pile capitals are responsible for transferring all applicable loading from the pile caps to the piles beneath.

The following is a summary of the conditions of the Pier pile capitals from the recent site inspection.

Observations found defects that ranged in condition from Major to Minor. Below is a summary of the observations for the ZONE 2, Item 7 – Concrete Pile Capitals. x 0 pile capitals from the overall structure are categorized as having Severe defects. x 0 pile capitals from the overall structure are categorized as having Major defects. x 4 pile capitals from the overall structure are categorized as having Moderate defects. Though not as urgent as other repairs, these defects should be addressed and/or monitored for future potential worsening of the deterioration.
o Note: Defects included deterioration resulting in a 5% to 25% loss of the expected structural capacity, voids with rust bleeds, cracking and spalling, and improper forming at top of pile (see Photo 4-33 through Photo 4-35).

Photo 4-33: ZONE 2 - Concrete Pile Capital Moderate Defect, Pile 41s Photo 4-34: ZONE 2 - Concrete Pile Capital
Moderate Defect, Pile 42s
Photo 4-35: ZONE 2 - Concrete Pile Capital
Moderate Defect, Pile 43o

5.E.b
Packet Pg. 561 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

4.3.3. Item 8 – Concrete Pile Caps
The concrete pile caps that support the Pier deck consist of concrete beams approximately 12-inch x 24- inch in size. The pile caps span along the bents-and-rows in a grid system both in the north-south and east-west directions of the Pier. As observed, ZONE 2 of the Pier is supported by a total of approximately 18 concrete bents (Bent 35 to Bent 53).

Additional amusement structure caps were identified and placed under this category. These caps consist of larger concrete caps that act as foundations for the amusement rides above. These caps range in size from 5-foot x 10-foot to 15-foot x 50-foot. These structures act independently from the main Pier support bent-and-row grid system to support amusement structures in strategically placed locations. As observed, ZONE 2 of the Pier is supported by a total of approximately 37 concrete amusement caps.

Observations found defects that ranged in condition from Minor to Severe. Below is a summary of the observations for the ZONE 2, Item 8 – Concrete Pile Caps. x 2 pile caps from the overall structure are categorized as having Severe defects. o Deficiencies noted included deterioration resulting in greater than a 50% loss of the expected structural capacity, significant cracking and spalling, and exposed or corroded rebar. (See Photo 4-36 through Photo 4-39).
x 3 pile caps from the overall structure are categorized as having Major defects. o Deficiencies noted included deterioration resulting in a 25% to 50% loss of the expected structural capacity, and significant cracking and spalling. (See Photo 4-40). x 9 pile caps from the overall structure are categorized as having Moderate defects. Though not as urgent as other repairs, these defects should be addressed and/or monitored for future potential worsening of the deterioration.
o Note: Defects included deterioration resulting in a 5% to 25% loss of the expected structural capacity, rust bleeds, corroded attachment plates, and notable cracking, spalling, and corrosion of piles at the pile cap (see Photo 4-41).

Photo 4-36: ZONE 2 - Concrete Pile Cap Severe Defect, Pile AS_19

5.E.b
Packet Pg. 562 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Photo 4-37: ZONE 2 - Concrete Pile Cap
Severe Defect, Pile AS_23
Photo 4-38: ZONE 2 - Concrete Pile Cap
Severe Defect, Pile AS_19
Photo 4-39: ZONE 2 - Concrete Pile Cap Severe Defect, Pile AS_19

5.E.b
Packet Pg. 563 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Photo 4-40: ZONE 2 - Concrete Pile Cap
Major Defect, Pile AS_21
Photo 4-41: ZONE 2 - Concrete Pile Cap
Moderate Defect, Pile 41w-41y

4.3.4. Item 9 - Timber Stringers
The timber stringers that support the pier deck in ZONE 2 were identified to consist of similar members as found in ZONE 1, timber ranging in size from 3-inch x 12-inch to 4-inch x 16-inch. The stringers span across the bents in the east-west direction of the pier with lengths varying depending on the bent spacing.

As observed, the stringers are spaced approximately 16 inches on-center along the pile bents. These timber stringers are responsible for transferring loading from the deck planks to the pile bents beneath.

Observations did not find any noticeable defects in these members. Below is a summary of the observations for the ZONE 2, Item 9 - Timber Stringers. x 0 stringer areas from the overall structure are categorized as having Severe, Major, or Moderate defects.

4.3.5. Item 10 - Timber Decking
The timber decking that provides a walking surface for the pier deck in ZONE 2 were identified to consist of similar members as found in ZONE 1, timber approximately 3-inch x 12-inch in size, laid flat. The deck boards span across the stringers in the north-south direction of the Pier and are fastened to the stringers beneath with nails. These timber decking are responsible for transferring loading from the surface of the deck planks to the stringers beneath.

Observations did not find any noticeable defects in these members. Below is a summary of the observations for the ZONE 2, Item 10 - Timber Decking.
x 0 decking areas from the overall structure are categorized as having Severe, Major, or Moderate defects.

5.E.b
Packet Pg. 564 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

ZONE 3 - Concrete West-End Approach Pier Segment (Bent 42 – Bent 59.8) This area of the pier represents the concrete portion of the pier that was recently upgraded after the 2008-PIAS from a timber pile support system to a concrete support system under the Phase 4 upgrades to provide access for H-20 emergency vehicle loading. The pier substructure and structural elements within this portion of the pier include concrete piles, concrete pile caps, timber stringers, and timber deck elements. This portion of the pier extends from approximately Bent 42 to Bent 58.9, which includes the main approach walkway to the west-end platform structure. The 2008-PIAS pier numbering system was updated to reflect the construction of this new section, hence Bent 58.9 numbering designation. Refer to Figure 4-4 below.

Figure 4-4: Site Plan – Concrete West-End Approach Portion of Pier

4.4.1. Item 11 - Concrete Piles
The concrete piles supporting the Pier were identified to be round concrete piles approximately 18 inches in diameter. The exposed length of each concrete pile supporting the Pier, from the sea floor to the underside of the Pier, varies from approximately 30 feet at the landside end of the Pier to 40 feet towards the waterside end. The pile embedment depths were not verified as part of this investigation. As observed, ZONE 3 of the Pier is supported by a total of approximately 80 concrete piles. These piles are responsible for transferring all applicable loading from the Pier to the seabed.

All concrete piles appear to be precast and driven to depth. Plans were provided by the City titled, “Santa Monica Phase 4 Municipal Pier Replacement, SP 2124,” prepared by URS, dated October 2012. Given the recent upgrade to the pier, this portion of the structure contained fewer defects than any other portion.

Observations did not find any noticeable defects in these members. Below is a summary of the observations for the ZONE 3, Item 11 – Concrete Piles.
x 0 concrete piles from the overall structure are categorized as having Severe, Major, or Moderate defects.
o Since no significant deficiencies were noted, pictures are provided indicating the general configuration of these members. (See Photo 4-42 and Photo 4-43).

5.E.b
Packet Pg. 565 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Photo 4-42: ZONE 3 – Typical Concrete Pile,
Pile 49K
Photo 4-43: ZONE 3 - Typical Concrete Pile,
Pile 49N

4.4.2. Item 12 - Concrete Pile Caps
The concrete pile caps that support the Pier deck were identified to consist of concrete beams ranging in size from 12-inch x 24-inch in the east-west longitudinal direction and 4-feet x 3-feet pile caps in the northsouth transverse direction. The pile caps span along the bents-and-rows in a grid system both in the northsouth and east-west directions of the Pier. As observed, ZONE 3 of the pier is supported by a total of approximately 19 concrete bents (Bent 42 to Bent 59.8). These concrete pile caps are responsible for transferring all applicable loading from the upper deck elements to the piles beneath.

Observations found only Moderate defects in condition. Below is a summary of the observations for the ZONE 3, Item 12 – Concrete Pile Caps.
x 0 pile caps from the overall structure are categorized as having Severe defects. x 0 pile caps from the overall structure are categorized as having Major defects. x 1 pile cap from the overall structure are categorized as having Moderate defects. Though not as urgent as other repairs, these defects should be addressed and/or monitored for future potential worsening of the deterioration.
o Note: Defects included deterioration resulting in a 5% to 25% loss of the expected structural capacity, rust bleeds, corroded attachment plates, and notable cracking, spalling, and corrosion of piles at the pile cap (see Photo 4-44).

5.E.b
Packet Pg. 566 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Photo 4-44: ZONE 3 – Typical Concrete Pile Caps
Moderate Defect, Pile 51K-51L
Photo 4-45: ZONE 3 - Typical Concrete Pile Cap,
Pile 49K

4.4.3. Item 13 - Timber Stringers
The timber stringers that support the pier deck in ZONE 3 were identified to consist of similar members as found in ZONE 1, timber ranging in size from 3-inch x 12-inch to 4-inch x 16-inch. The stringers span across the bents in the east-west direction of the pier with lengths varying depending on the bent spacing.

As observed, the stringers spacing varied from approximately 16 inches to 22 inches on center along the pile bents.

Observations did not find any noticeable defects in these members. Below is a summary of the observations for the ZONE 3, Item 13 - Timber Stringers. x 0 stringer areas from the overall structure are categorized as having Severe, Major, or Moderate defects.

4.4.4. Item 14 - Timber Decking
The timber decking that provides a walking surface for the pier deck in ZONE 3 were identified to consist of similar members as found in ZONE 1, timber approximately 3-inch x 12-inch in size, laid flat. The deck boards span across the stringers in the north-south direction of the pier and are fastened to the stringers beneath with nails.

Observations did not find any noticeable defects in these members. Below is a summary of the observations for the ZONE 3, Item 14 - Timber Decking.

5.E.b
Packet Pg. 567 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

x 0 decking areas from the overall structure are categorized as having Severe, Major, or Moderate defects.

ZONE 4 - Concrete West-End Platform Pier Segment (Bent 60 – Bent 103) This area of the Pier represents the concrete portion of the Pier that is located furthest west over the ocean. The Pier substructure and structural elements within this portion of the Pier include concrete piles, concrete waffle slab, timber sleepers, and timber deck elements. This portion of the Pier extends from approximately Bent 60 to Bent 103, which comprises the main support system for the west-end platform structure. Refer to Figure 4-5 below.

Figure 4-5: Site Plan – Concrete West-End Platform Portion of Pier

4.5.1. Item 15 - Concrete Piles
The concrete piles supporting the Pier were identified to be round concrete piles approximately 18 inches in diameter. The exposed length of each concrete pile supporting the Pier, from the sea floor to the underside of the Pier, varies from approximately 40 feet at the landside end of the pier to 50 feet towards the waterside end. The pile embedment depths were not verified as part of this investigation. As observed, ZONE 4 of the Pier is supported by a total of approximately 190 concrete piles. These piles are responsible for transferring all applicable loading from the Pier to the seabed.

All concrete piles appear to be precast and driven to depth. Plans were provided by the City titled, “Santa Monica Municipal Pier,” prepared by Theodore E. Anvick, dated January 1989. Given the construction method used to upgrade the Pier, concrete piles with concrete slab, this portion of the structure contained very few defects.

Observations found only Moderate defects in condition. Below is a summary of the observations for the ZONE 4, Item 15 – Concrete Piles.
x 0 piles from the overall structure are categorized as having Severe defects. x 0 piles from the overall structure are categorized as having Major defects.

5.E.b
Packet Pg. 568 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

x 2 piles from the overall structure are categorized as having Moderate defects. Though not as urgent as other repairs, these defects should be addressed and/or monitored for future potential worsening of the deterioration.
o Note: Defects included deterioration resulting in a 5% to 25% loss of the expected structural capacity, rust bleeds, and notable cracking, spalling, and corrosion of piles at the waffle slab (see Photo 4-46 and Photo 4-47).

Photo 4-46: ZONE 4 – Concrete Pile Moderate
Defect, Pile 93E_E
Photo 4-47: ZONE 4 - Concrete Pile Moderate
Defect, Pile 95C

4.5.2. Item 16 - Concrete Waffle Slabs
The concrete waffle slab that support the Pier deck were identified to consist of concrete beam-slabs approximately 6-inches x 16-inches spaced every 2.5-feet in a grid pattern. The waffle slab spans along the bents-and-rows in both the north-south and east-west directions then are connected directly to the top of the piles with a thickened cap. These concrete waffle slabs are responsible for transferring all applicable loading from the upper deck elements to the piles beneath.

Observations found only Moderate defects in condition. Below is a summary of the observations for the ZONE 4, Item 16 – Concrete Waffle Slab.
x 0 waffle slab areas from the overall structure are categorized as having Severe defects. x 0 waffle slab areas from the overall structure are categorized as having Major defects. x 1 waffle slab areas from the overall structure are categorized as having Moderate defects.

Though not as urgent as other repairs, these defects should be addressed and/or monitored for future potential worsening of the deterioration.

5.E.b
Packet Pg. 569 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

o Note: Defects included deterioration resulting in a 5% to 25% loss of the expected structural capacity, rust bleeds, and notable cracking, spalling, and corrosion underneath the deck (see Photo 4-48 and Photo 4-49).

Photo 4-48: ZONE 4 – Concrete Waffle Slab
Moderate Defect, Defect Area 13
Photo 4-49: ZONE 4 - Concrete Waffle Slab
Moderate Defect, Defect Area 13

4.5.3. Item 17 - Timber Sleepers
The timber sleepers that support the pier deck in ZONE 4 were identified to consist of timber ranging in size from 3-inch x 4-inch to 4-inch x 6-inch. The sleepers are lain flat across the waffle slab elements in the east-west direction of the pier with lengths varying depending on the bent spacing. As observed, the sleepers are spaced approximately 16 inches on-center along the pile bents. These timber sleepers are responsible for transferring loading from the deck planks to the waffle slab beneath.

Observations did not find any noticeable defects in these members. Below is a summary of the observations for the ZONE 4, Item 17 - Timber Sleepers. x 0 stringer areas from the overall structure are categorized as having Severe, Major, or Moderate defects.

4.5.4. Item 18 – Timber Decking
The timber decking that provides a walking surface for the Pier was identified to consist of timber members 3-inch x 12-inch in size, laid flat. The deck boards span across the stringers in the north-south direction of the Pier and are fastened to the stringers beneath with nails.

5.E.b
Packet Pg. 570 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Observations found only Moderate defects in condition. Below is a summary of the observations for the ZONE 4, Item 18 – Timber Decking.
x 0 deck areas from the overall structure are categorized as having Severe defects. x 0 deck areas from the overall structure are categorized as having Major defects. x 2 deck areas from the overall structure are categorized as having Moderate defects. Though not as urgent as other repairs, these defects should be addressed and/or monitored for future potential worsening of the deterioration.
o Note: Defects included deterioration resulting in a 5% to 25% loss of the expected structural capacity, sunken deck boards, and noticeable splitting (see Photo 4-50 and Photo 4-51).

Photo 4-50: ZONE 4 – Deck Area Moderate Defect,
Defect Area 14
Photo 4-51: ZONE 4 - Deck Area Moderate Defect,
Defect Area 13

5.E.b
Packet Pg. 571 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Additional Defects Observed
In addition to the structural components listed in earlier sections of this report, other deficiencies were noted but were not necessarily in the scope of this inspection. These deficiencies ranged from broken and corroded utility supports, leaking wet utilities, corroded handrails, and observations that may result in future deficiencies in the structure. Providing more detailed assessment of difficult-to-access hardware was outside of the safely allowed operational parameters of this inspection, but corrosion of steel hardware to some degree is typical throughout the structure. It is recommended that all hardware, utilities, and handrails be inspected on a yearly basis and replaced with new as needed.

4.6.1. Item 19 – Below-Deck Additional Defects Observed Utility Supports
There are several types of steel connecting hardware under the structure. In the marine environment, these elements typically fail as a result of steel corrosion. Galvanizing typically delays the onset of corrosion and application of coatings can be somewhat effective in mitigating rust. Steel hangers are used to hang utility pipes below the Pier. As utilities were not included in the scope of this inspection, specific locations of defects were not recorded, only typical conditions. It is recommended that all utility hangers be inspected on a yearly basis and replaced with new hardware as needed.

The corrosion rating for most of the connectors fall within the ‘Minor’ or ‘Moderate’ categories with up to 100% coating loss and moderate corrosion on the hardware. A lesser percentage of the connectors are rated as ‘Major’ or ‘Severe.’ Some of these areas were noted, and pictures were taken to document their condition (see Photo 4-52 and Photo 4-53).

Photo 4-52: Additional Defects - Utility Supports,
Corroded Hangers near Pile 89H
Photo 4-53: Additional Defects - Utility Supports,
Corroded Hangers near Pile 29M

5.E.b
Packet Pg. 572 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Leaking Wet Utility Pipes
As stated, utilities were not included in the scope of this inspection. However, multiple broken water lines were noted during this inspection. The water lines were identified as approximately ¾-inch to 4-inch in diameter and were leaking water into the ocean and/or onto the beach. Leaking wet utilities were noticed in only localized areas, locations are shown in GIS database and additional info in Appendix B. Types of materials for the existing pipes varied from steel, PVC, and cast iron. It is recommended these waterlines be repaired under the “priority repair” urgency (see Photo 4-54 and Photo 4-55).

Photo 4-54: Additional Defects - Leaking Wet
Utility Pipes, Leaking PVC Line near Pile 34y
Photo 4-55: Additional Defects - Leaking Wet
Utility Pipes, Leaking Fire Line near Pile 29M

4.6.2. Item 20 – Above-Deck Additional Defects Observed Handrails
Handrails were not included in the scope of this inspection. However, multiple locations with excessive corrosion were noted in the steel handrails during this inspection. The corrosion rating for most of the handrails fall within the ‘Minor’ or ‘Moderate’ categories with up to 100% coating loss and moderate corrosion. A lesser percentage of the handrails are rated as ‘Major’ or ‘Severe’. It is recommended the handrails be repaired under the “long-term repair” urgency (see Photo 4-56 and Photo 4-57).

5.E.b
Packet Pg. 573 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Photo 4-56: Additional Defects - Handrail Corrosion
near Pile 76P
Photo 4-57: Additional Defects - Handrail Corrosion
near Pile 97A
ADA Accessibility
Providing a detailed ADA compliance assessment of the above-deck facilities was outside of the scope of this inspection. However, several locations were noted where potential upgrades are needed to meet ADA compliance. Photos were taken to document the deficiencies (see Photo 4-58 and Photo 4-59). It is recommended that a more detailed ADA assessment be done to understand full compliance requirements for the Pier. ADA upgrades may be desired to bring the Pier into current code compliance; however, specific upgrades have not been detailed at this time.

5.E.b
Packet Pg. 574 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Photo 4-58: Additional Defects - ADA Compliance
near Pile 86P
Photo 4-59: Additional Defects - ADA Compliance
near Pile 26c

5.E.b
Packet Pg. 575 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

5. Repair Observations Summary and Cost Estimate
The inspection and assessment were performed to support the development of repair recommendations for the Pier. The repair recommendations are presented below in a prioritized manner considering severity of damage, location, and impact of damage to the overall Pier structural integrity and operational use of the facilities. An attempt has also been made to categorize the deficiencies that will allow the City to choose a maintenance or replacement program that best suits their needs and budget. No attempt has been made to discuss environmental permitting requirements for the recommended repairs at this time.

This inspection report focuses on identification of deficiencies as part of an overall design repair project.

Providing engineering bid documents (repair plans, details, and specifications) for the recommended repairs are outside the scope of this inspection report. Based on input from the City of which repairs they would like to continue forward with, M&N can develop plans, details, and specifications for the necessary repairs identified under a separate task if desired. Due to the nature and configuration of repairs necessary, required repairs will likely entail water-based construction operations. Various techniques may be employed to conduct these repairs; it is recommended construction details be developed prior to construction.

Based on the structural element deficiencies identified in the observation portion of this report, it is our recommendation that reparative or further extensive replacement options are necessary to prevent future potential worsening of present Pier defects.

Geographic Information System (GIS) Database
The digital inspection records detailing the existing pier condition ratings and observations are provided as an ESRI (Environmental Systems Research Institute) file GIS geodatabase. The geodatabase contains the geometry of the Pier elements, inspection records, and inspection photographs. Relationships configured within the geodatabase link the structural elements to the inspection photographs. The ESRI file geodatabase must be viewed using ESRI software such as ArcMap and ArcGIS Pro. The inspection photos are also provided separately, as a zip file, so they can be viewed outside of the ESRI software suite.

Refer to figures in Appendix B for a summary.

Figure 5-1: Site Plan – GIS Map Used for Field Investigations

5.E.b
Packet Pg. 576 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Priority Repairs (Immediate Repair/Replacement)
Following is a summary of significant findings and recommendations, itemized on a priority basis as it relates to the urgency of proposed repairs. These recommendations classify the various repairs into priority (immediate), short-term (within 1 to 5 years), and long-term (within 5 to 10 years) categories.

Refer to Appendix E for a full itemized list of deficiencies and damage ratings.

Consistent with the previously described “priority-repair” recommendations, the repairs defined in this section are recommended to be accomplished as soon as feasible. Refer to Table 5-1 below.

Table 5-1: Priority Repair Summary

5.E.b
Packet Pg. 577 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Short-Term Repairs (Within 1-5 Years)
Consistent with the previously described short-term repair recommendations, the repairs defined in this section are recommended to be accomplished as soon as feasible but may be delayed for the first 1-5 years while the City appropriates funds. These repairs are important in prolonging the life of the structure by preventing a potential major failure due to weakening of existing support systems. Refer to Table 5-2 below.

Table 5-2: Short-term Repair Summary

5.E.b
Packet Pg. 578 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Long-Term Repairs (Within 5-10 Years)
Consistent with the previously described long-term repair recommendations, the repairs defined in this section are defects which are not as urgent as other repairs but should be done to prevent future potential worsening of the defects. These repairs are to be accomplished as soon as feasible but may be delayed until the City’s next planned maintenance cycle (5 to 10 years). Refer to Table 5-3 below.

Table 5-3: Long-term Repair Summary

5.E.b
Packet Pg. 579 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Additional Defect Repairs (Hardware and Appurtenances)
Providing a detailed assessment of specific deficiencies in relation to utilities, utility supports, and nonstructural hardware located above and below the Pier deck is outside the scope of work of this inspection.

However, some observed defects that warrant further evaluation and potential action were noted previously in Section 4, including but not limited to: Utility Supports, Leaking Wet Utility Pipes, Handrails, and ADA Accessibility. It is recommended that all hardware, utilities, and handrails be inspected on a yearly basis and replaced with new as needed. A description of the location and disposition of these items is also found in the GIS database provided in Appendix B.

Repair Cost Estimates
Estimates of probable construction costs have been produced for the three repair conditions “Priority,” “Short-term,” and “Long-term.” Cost estimates assume each of these repair phases will be done under a separate contractor mobilization effort. There may be an opportunity to save costs by conducting all repairs under a single contract or having an on-call agreement with a local marine construction contractor or by having the City maintenance staff conduct the repairs. Below is a summary of assumptions for the cost estimate. Refer to Appendix C for a full itemized cost estimate for recommended repairs.

5.6.1. Basis of Cost Estimates
The proposed repair cost estimate consists of the following basic elements:

1. General Requirements (Mobilization / Demobilization, Bonds & Insurance, and misc. allowances)

2. Demolition & Construction Waste Management (including Best Management Practices to minimize environmental impacts)

3. Pier System Repair Construction (Piles and Structural Components identified for repair, brokendown into ZONE locations)

4. Project Contingencies

1. General Requirements – This construction element includes allowances for probable cost of contractor mobilization and demobilization of construction equipment, acquiring necessary bonds and insurance, and allowances for stand-by due to foul weather or other environmental factors in order to facilitate over-water marine construction activities. The cost estimate assumes over water construction activities included in the contractor’s bid will require utilization of floating barges, landbased and/or water-based cranes, over-water construction crews, and other specialized marine construction equipment.

2. Demolition & Construction Waste Management – This construction element includes probable cost of demolition, removal, and disposal of the existing pier facilities (piles, structural framing members, decking, and appurtenances). M&N’s cost estimate assumes construction Best Management Practices (BMPs) will be included in the contractor’s bid and utilized in order to minimize and/or eliminate water pollution and control erosion and sediment.

3. Pier System Repair Construction – This construction element includes installation of pier system components identified for priority (immediate), short-term (within 1-5 years), and long-term (within 5-10 years) repair directives as defined in the previous sections of this report. Repair is assumed to consist of materials similar in composition and type of construction methods as utilized for installation of the existing pier structural components, and in the same location in accordance with the existing pier repair configurations shown in the GIS Database provided in Appendix B.

5.E.b
Packet Pg. 580 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

4. Project Contingencies – A 20% contingency has been added to the overall base construction cost estimate. This contingency is intended to account for unidentified expenses, to account for discrepancies in the contractors actual bid prices, and extent of repair required to correct identified deficiencies.

5.6.2. Cost Estimates
The costs have been developed based on historical and current data using in-house sources, information from previous studies, as well as budget price quotations solicited from local suppliers and contractors. A contingency amount has been included to cover undefined items of work that will have to be performed, and elements of costs that will be incurred, but are not explicitly detailed or described due to the level of investigation, engineering, and estimating completed. The opinion of probable construction cost is shown in Table 5-4 through Table 5-6.

Table 5-4: Priority Repair Cost Estimate

5.E.b
Packet Pg. 581 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Table 5-5: Short-term Repair Cost Estimate
Table 5-6: Long-term Repair Cost Estimate

5.E.b
Packet Pg. 582 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

6. Repair Recommendations
This section of the report is intended to provide guidance for recommended repairs and routine periodic inspection/maintenance of the Santa Monica Pier infrastructure. It is assumed that routine visual inspections will be carried out by City Maintenance Staff. Where specialized training or certification is required for specific inspections or testing, that requirement is stated. The frequencies of inspection given are always stated as the maximum time interval recommended. Record all repairs and field treatments of specific elements in the GIS database.

Timber Substructure Repair Recommendations
The timber substructure pier segment consists of timber piles, pile caps, pile to pile bracing, stringers, and decking. The majority of the timber pier segment is on the sand (onshore) and not subject to daily tidal inundation. However, some of the timber pier segment is located over water (offshore) and subject to tidal and wave action. It is recommended in the upgrade portion of this report to replace all of the offshore timber substructure with concrete substructure. Until the replacement with concrete, the recommendations in this section are applicable. A typical specification for replacement timbers required for repair is provided below.
x Timber Replacement Specification:
o Timber Piles: Nominal butt and tip diameter size as required and shall be clean-peeled and conform to ASTM D 25. Lengths may vary depending upon deck height and embedment requirements, a typical pile may range between 40ft to 80ft in length. When replacing piles, the Contractor shall confirm specifications for pile size and length with engineer prior to procurement of materials. Piles must be in one piece; splices will not be permitted. Provide High Density Polyethylene (HDPE) or fiberglass jacket prior to driving.

After driving, the jacket should measure from a minimum depth of 3 feet below mudline to a height 10 feet above mudline to prevent against marine borers. o Timber Members: Nominal size as required and shall conform to S4S No. 1 or better, Douglas Fir, in conformance with WWPA and SPIB respective grading rules. o Preservative Treatment: Treat wood to be used in contact with saltwater or saltwater splash in accordance with AWPA P5 (Material Subject to Marine Borer Exposure) with waterborne preservative, (ACZA - Ammoniacal Copper Zinc Arsenate) to (2.5 pcf) net retention.
o Steel Connection Hardware: Provide miscellaneous steel plates, straps, threaded rods, bolts, and shapes in conformance with ASTM A36. All hardware shall be zinc-coated or galvanized by the hot-dipped process in accordance with ASTM A 123 / A 153. o Steel Deck Screws: It is recommended to replace all smooth-shank deck spikes with lag screws with countersunk heads and washer to pull the planks down to reduce withdrawal.

Lag screws shall be SDWS Timber SS Screw, minimum 8-inches long (Model No.

SDWS27800SS) as manufactured by Simpson String-Tie or approved equal.

6.1.1. Item 1- Timber Piles
Severe and Major Defects
It is recommended that the repair of ‘severe’ and ‘major’ timber piles be performed by experienced and licensed marine contractors. Where practical, the preferred repair for piles with serious defects is

5.E.b
Packet Pg. 583 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

replacement with a new pile. Due to the difficult accessibility beneath the pier, it is generally not economical to repair piles by replacing the pile with a new pile. Therefore, it is recommended that they be repaired utilizing a jacket repair system.

The recommended repair method for timber piles with ‘severe’ and ‘major’ defects is to clean and remove excess material growth around existing member and install new Fiberglass Reinforced Polymer (FRP) Jacket and Backfill with High-Strength Epoxy Grout (Simpson Strong-Tie FX-70, or approved equal), refer to Figure 6-1 for details. Similar previous repairs to the pier were conducted in 2016, details of those repairs are provided in Appendix F.

Figure 6-1: Timber Pile FRP Jacket Repair Method (Five Star Marine, Inc.) Moderate Defects
Treated timber piles are typically wrapped with a solid barrier to prevent leaching of the preservative chemicals into the water. While a well-sealed barrier such as a polyethylene wrap can provide added protection, a poorly sealed barrier that allows exchange of water and oxygen can actually conceal damage from organisms that are able to get past the barrier. All wrapping should be replaced where indicated to minimize potential future worsening of defects. City maintenance staff would likely be able to perform most of these repairs to onshore piles, but because offshore piles are subject to tidal and wave action and have build-up of marine growth, both the inspection and maintenance of these piles requires a much greater effort and task knowledge than onshore piles.

The recommended repair method for timber piles with ‘moderate’ defects is as follows:
x Physical Damage: Field treat physical damage that is observed during inspection with an appropriate compound to restore the surface resistance to fungi and insects in accordance with American Wood Preservers' Association, Standard M4, Standard for the Care of PreservativeTreated Wood Products. x Fungal Damage: Treat surface damage from fungal attack with a fungicide such as Borate. Borates are available in many forms including fumigants, liquids, and solids. Significant dry rot that has more than surface depth should be cut out and the hole filled with an epoxy filler, and then the area around the hole treated.

5.E.b
Packet Pg. 584 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

6.1.2. Item 2- Timber Pile Caps
Severe and Major Defects
It is recommended that the repair of ‘severe’ and ‘major’ timber pile caps be performed by experienced and licensed marine contractors. This is mostly due to the difficult accessibility to these members beneath the Pier. Work may require erecting temporary support and scaffolding for the deck above in order for a new timber pile cap member to be placed on top of the piles.

The recommended repair method for timber pile caps with ‘severe’ and ‘major’ defects is to replace the pile caps that have loss of bearing strength due to rot, and caps that have significant splitting and deflection with new pressure treated members of the same or greater size. All missing hardware and components must be replaced with hot dipped galvanized elements, or a steel strap that is thru-bolted the pile on both sides is the most likely type of hardware. It is recommended that all hardware be inspected on a yearly basis and replaced with new as needed. If no connecting hardware is showing and there are no bolt holes, then the connecting hardware is likely a vertical drift pin completely embedded in the two pieces of timber.

Moderate Defects
Most repairs for ‘moderate’ defects may be performed by City maintenance staff. At the bearing surfaces, where the pile cap rests on the pile or where stringers rest on the cap, look for indications that one element is crushing the other element, as this is a sign that rot is taking place, and normally would occur where there is excessive moisture. Look for sources of excessive moisture. For the connecting hardware, look for signs of rust or missing elements such as nuts or entire bolts. Inspect caps for horizontal splits that are visible on both sides of the cap and for deflection (sagging) between piles. The location, width and the length of splits should be noted. Splitting and deflection of a cap may indicate a failure condition due to overloading.

Caps with physical damage and/or surface fungal damage but no loss of bearing capacity should be treated in the same manner as describe under Item 1 – Timber Piles “Moderate Defects.” Clean and paint existing connecting hardware showing rust and provide new hardware where missing or damaged.

6.1.3. Item 3 – Timber/Steel Lateral and Transverse Bracing Severe and Major Defects
City maintenance staff would likely be able to perform most of the ‘severe’ and ‘major’ timber/steel bracing repairs to onshore bracing, but because offshore bracing is subject to tidal and wave action, these bracing require a much greater effort and task knowledge than onshore bracing.

The recommended repair method for timber/steel bracing with ‘severe’ and ‘major’ defects is to replace timber bracing with pressure treated timber at all braces that are broken or are split at the connecting bolt hole. Also, replace any brace that has over 30 percent of its cross-section lost due to physical damage, insect damage, or rot. Replace steel bracing with galvanized steel tubing of the same size or larger than existing. Clean and paint existing connecting hardware showing rust and provide new hardware where missing or damaged. It is recommended that all hardware be inspected on a yearly basis and replaced with new as needed.

Moderate Defects
Again, City maintenance staff would likely be able to perform most of the ‘moderate’ timber/steel bracing defects. It is recommended that timber bracing be inspected at least once every five years, and those subject to wave action after every major storm. The inspector should note overall brace condition, the specific condition at the connections, and the connecting bolts. Of all of the Pier structural elements, the

5.E.b
Packet Pg. 585 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

bracing is the most vulnerable to physical damage due to impact. Braces are relatively small members for the length of span and are easily broken if hit from the side.

The recommended repair method for timber/steel bracing with ‘moderate’ defects is to treat braces with damage or surface fungi in the same manner as described under Item 1 – Timber Piles “Moderate Defects.”

6.1.4. Item 4, 9, 13, and 17 – Timber Stringers
Severe and Major Defects
City maintenance staff would likely be able to perform most of the ‘severe’ and ‘major’ timber stringer repairs. However, for replacement of stringers over larger areas (> 2,000 square feet) it is recommended that repairs be performed by experienced and licensed marine contractors. These efforts will require temporary removal of the decking above and installation of clips or nailing from above.

The recommended repair method for timber stringers with ‘severe’ and ‘major’ defects is replace or supplement (install new stringer next to existing) broken stringers as soon as possible. Replace stringers with loss of bearing strength due to dry rot.

Moderate Defects
Again, City maintenance staff would likely be able to perform most of the ‘moderate’ timber stringer defects. Treat stringers showing damage or surface fungi as described under Item 1 – Timber Piles “Moderate Defects.”

6.1.5. Item 5, 10, 14, and 18– Timber Decking
Severe and Major Defects
City maintenance staff would likely be able to perform most of the ‘severe’ and ‘major’ timber decking repairs. However, for replacement of decking over larger areas (> 2,000 square feet) it is recommended that repairs be performed by experienced and licensed marine contractors. These efforts will require temporary removal of the existing decking and installation of new decking using clips or nailing from above.

The recommended repair method for timber decking with ‘severe’ and ‘major’ defects is to replace decking when wear has reduced the thickness to less than 2-1/4 inch, or the where uneven surface wear creates a significant tripping hazard. Replace all broken planks.

Moderate Defects
Again, City maintenance staff would likely be able to perform most of the ‘moderate’ timber decking defects. Where the vertical difference between planks is caused by bowing of one plank and it is no longer bearing on the stringers, replace the spikes with lag screws with countersunk heads and washer to pull the plank down to bearing. Where the vertical difference between planks is caused by a plank that is thicker than the adjacent plank and the adjacent plank is at least 2 3/8-inch-thick, grind the thicker plank to match using a slope across the entire plank. Where the vertical difference between planks is caused by a plank that is thinner than the adjacent plank and the adjacent plank is at least 2 3/8-inch-thick, replace the thinner plank with a new pressure treated 3-inch nominal (2 1/2-inch net) plank.

Concrete Substructure Repair Recommendations
The concrete substructure pier segments consist of concrete piles, pile capitals, pile caps, and waffle slabs.

The majority of the concrete substructures are offshore and subject to daily tidal inundation. In both the

5.E.b
Packet Pg. 586 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

ZONE 2 Pacific Park amusement area and ZONE 3 West-End Approach area, the concrete substructure consists of prestressed concrete piles with concrete pile caps and strut beams. In the ZONE 4 West-End Platform area the concrete substructure consists of prestressed concrete piles with a concrete waffle slab matrix above.

Deterioration of concrete in the marine environment is most commonly caused by corrosion of the reinforcing steel or physical damage from impact. Deterioration of concrete piles can also be caused by cracking during an earthquake. Sometimes, but rarely, deterioration is caused by excessive loads other than earthquake. Deterioration takes the form of concrete cracks, spalling (loss of surface concrete), and corrosion of the reinforcing steel evidenced by rust stains. Figure 6-2 below is a graphic depicting the progression of reinforcement corrosion, which can lead to more serious defects such as spalling and cracking.

Figure 6-2: Concrete Corrosion and Spalling Progression Recommendations for repairs to existing deficient concrete members focus on removing existing rust and deleterious material, splicing new steel reinforcing (if required), and patching with an epoxy grout material to prevent further corrosion. As an added level of protection, the City may want to consider the inclusion of sacrificial anodes in order to slow the rate of corrosion of reinforcement within the concrete. The anodes act as an electron current pacification system in order to draw harmful chloride ions away from the reinforcing steel, as a result instead of corroding the rebar the chloride ions will corrode the anode first. Figure 6-3 below depicts the process and shows the general location of anodes cast into the concrete. It should be noted that removal of concrete down to the reinforcing steel is required for this type of repairs, combined with the anode the cost is typically 30%-50% higher than typical concrete spall repairs. A typical specification for grout required for repair to concrete members is provided below.

Figure 6-3: Rebar Corrosion Without and With Sacrificial Anodes (Vector Corrosion)

5.E.b
Packet Pg. 587 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

x Concrete Spall and Crack Repair Specification:
o Marine grade non-shrink epoxy grout: Minimum 28-day compressive strength (f’c) = 7,000 PSI. The grout shall be in accordance with ASTM C1107 (Grade C). o Five Star Fluid Grout UW or approved equal
x Supplier / Manufacturer:
o Five Star Products, Inc.
60 Parrott Drive
Shelton, CT 06484
Tel: (203) 336-7900

6.2.1. Item 6, 11, and 15 - Concrete Piles
Severe and Major Defects
It is recommended that the repair of ‘severe’ and ‘major’ concrete piles be performed by experienced and licensed marine contractors. Because the offshore portions of the Pier are located high above the water, scaffolding will need to be constructed to provide access for the repair contractor. It is recommended that a detailed inspection, including sounding with a hammer or ultrasonic device be performed over all of the members, before repairs begin, and any additional damage repaired at the same time. Visual inspection will need to be performed from a combination of locations including the existing utility catwalks, the lower fishing platforms, the lower catwalk along the southern edge, and possibly by boat. The close spacing of the beams and the limited clearance between the utility catwalks and the bottom of the concrete will make the inspection of more than two or three beams beyond the catwalk difficult.

The recommended repair method for concrete piles with ‘severe’ and ‘major’ defects is an FRP jacket repair system. More detail on this repair method is found in Item 1 – Timber Piles “Severe and Major Defects.” The most common location for corrosion damage in round concrete piles is at the top of the pile where the prestressing forces are reduced and possible overstress from driving is likely, and vertical cracks along the face of the pile. Existing surfaces should be cleaned of all loose material by chipping with hand tools and/or sand blasting. Splicing or new steel reinforcement may be required where corrosion of existing rebar is excessive. Additional spiral reinforcement is the most common type of steel reinforcement that would be required, and example of a previous repair project where this type of repair was conducted in provided in Appendix F. If formwork is required in the splash zone, care should be taken to provide water-tight formwork and/or pump water out of formwork or provide underwater selfconsolidating concrete to displace water within the formwork.

Moderate Defects
It is recommended that the repair of ‘moderate’ concrete piles also be performed by an experienced concrete repair specialist. Generally, it is not economical to repair moderate damages to individual concrete piles. However, major damages should be repaired as soon as practical and all moderate to minor repairs included in the same project.

Visual inspection of concrete piles is recommended at least once every five years. Note all surface damages, cracks, and rust stains on piles. Note the size and location of all observed defects. Especially note any exposed reinforcing steel. Compare noted defects with those in the GIS database for the previous inspection. If minor defects are unchanged from the prior inspection, then immediate repair is not

5.E.b
Packet Pg. 588 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

warranted. Major deterioration or deterioration that has significantly increased since the prior inspection should be scheduled for repair.

The recommended repair method for concrete piles with ‘moderate’ defects is to clean and remove excess material growth around existing pile and install new formwork and/or fill cracks with grout.

6.2.2. Item 7, 8, and 12 - Concrete Pile Caps and Pile Capitals Severe and Major Defects
It is recommended that the repair of ‘severe’ and ‘major’ concrete piles be performed by experienced and licensed marine contractors. Again, this is due to the offshore portions of the Pier being located high above the water, which will require scaffolding to provide access for the repair contractor.

The recommended repair method for concrete pile caps and pile capitals with ‘severe’ to ‘major’ defects is to clean and remove excess material growth around existing member by chipping with hand tools and/or sand blasting and install new formwork, dowel rebar (if required), and cast new concrete repair section around the existing member. No portion of pile caps and capitals is anticipated to be prestressed.

An alternative method of construction would be to wrap the member in an FRP composite to provide additional strength and prevent against future corrosion.

The most common location for corrosion damage in beams is at the lower corners where cracking from bending is likely and the infiltration of chlorides can approach from both the bottom and the side faces.

In these corners the concentration of chloride ions increases twice as fast at the reinforcing steel as it does at steel with only one close face. Figure 6-4 below depicts this and areas that typically require repair.

Figure 6-4: Repair of Concrete Corrosion and Spalling
Moderate Defects
The recommended repair method for concrete pile caps and pile capitals with ‘moderate’ defects is to clean and remove excess material growth around existing member and install new formwork, dowel rebar, and fill cracks with grout.

Visual inspection of concrete caps and capitals is recommended at least once every five years. Pay close attention to the exposed corners. Note all defects observed including cracks, spalls, and rust stains. Note the location and approximate size of all defects observed, especially note cracks on both faces that form a corner. This can indicate corrosion in the corner reinforcing bar even without visible rust stains.

5.E.b
Packet Pg. 589 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

6.2.3. Item 16- Concrete Waffle Slab
Moderate Defects
Defects that are ‘sever’ or ‘major’ in nature were not identified for any portion of the waffle slab structure.

It is recommended that the repair of ‘moderate’ concrete waffle slabs be performed by an experienced concrete repair specialist. Scaffolding will need to be constructed to provide access for the repair contractor, it is recommended that a detailed inspection, including sounding with a hammer or ultrasonic device be performed over all of the members, before repairs begin, and any additional damage repaired at the same time. However, major damages should be repaired as soon as practical and all moderate to minor repairs included in the same project.

The recommended repair method for concrete waffle slabs with ‘moderate’ defects is to clean and remove excess material growth around existing member by chipping with hand tools and/or sand blasting and install new formwork and/or fill cracks with grout. No portion of waffle slab is anticipated to be prestressed. An alternative method of construction would be to wrap the member in an FRP composite to provide additional strength and prevent against future corrosion.

Since there is no redundancy in the reinforce steel of the waffle slab, any indication of corrosion in the bottom bar, such as rust stains or longitudinal cracks in the bottom face or sides near the bottom, should trigger a repair project within the following five years.

Other surface defects without rust stains are not a trigger for repair but need to be watched for continued deterioration or appearance of rust stains.

5.E.b
Packet Pg. 590 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

7. Upgrades Assessment and Related Studies
This upgrades assessment was performed to support the development of future capital improvements programs for the Santa Monica Pier. This section of the report contains the findings and recommendations of potential upgrades to the Pier. However, planning for future changes to Pier specific uses, load requirements, and zoning is outside the scope of this report. Current direction given by the City has been to focus on updating load requirements to H-15 (15 ton) for delivery truck access and H-20 (20 ton) for emergency vehicle access. The current conditions that the upgrades assessment is based on include the findings of the visual inspection of the pier as part of the PIAS-2018, results of previous studies from the PIAS-2008, and subsequent upgrades that have been completed on the pier since 2008. Upgrades in most cases are beyond repairs recommended in the “observations and repairs” portion of this report. However, if upgrades are made in an area, then it is assumed the repairs would automatically be taken care of for that area.

This upgrades assessment report focuses on identification of upgrades necessary to achieve necessary load requirements or future maintenance goals as part of the overall pier capital improvements program.

Providing engineering bid documents (upgrade plans, details, and specifications) for the recommended upgrades are outside the scope of this report.

Pier Load Rating and Upgrades Assessment
The results of the pier load assessment are broken into localized Areas corresponding to the type of construction, anticipated loading, and age of construction. Recommendations from the previous PIAS2008 study have been incorporated into this PIAS-2018, and recommended upgrades updated to reflect actual Pier conditions at the time of inspections as well as to consider upgrades completed to the Pier since the last inspection in 2008. Figure 7-1 below depicts the different pier areas, and a complete map of the pier load rating can be found in Appendix D.

Figure 7-1: Site Plan – Pier Load Rating Map

5.E.b
Packet Pg. 591 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

7.1.1. Area 1 - Pedestrian area bounded by Piles 1h, 1o, 3h, and 3o Current Load Rating
Uniform Live Load: 50 psf
Vehicle Live Load: 2 Tons (4,000 pounds)
Upgrades Recommendation: Upgrade to 100 psf Uniform Live Load and H-5 (5 Ton) Vehicle Live Load In this zone the stringers are 3-inches x 10-inches at 18 inches on-center. The calculated capacity for this area is approximately 50 psf and a maximum vehicle weight of 4,000 pounds. This is less capacity than the adjacent aquarium roof, and less than the code capacity for pedestrian assembly areas of 100 psf. It is recommended that this area be upgraded by adding additional 3-inches x 10-inches at 18 inches oncenter. These could be centered between the existing stringers or placed next to them. Either configuration would result in an allowable uniform live load of 100 psf and a vehicle weight of 5 Tons (10,000 pounds).

7.1.2. Area 2 - Parking area bounded by Bents 3 and 4 on the east, Bent 12 on the west, existing buildings on the north and the edge of the pier on the south Current Load Rating
Uniform Live Load: 65 psf
Vehicle Live Load: 2.75 Tons (5,500 pounds)
Upgrades Recommendation: Upgrade to allow H-15 (regularly)/H-20 (occasionally) Vehicle Live Load (Included in M&N Current Contract with City for Pier Upgrades) In this zone the stringers are 3-inches x 12-inches at 22 inches on-center, with 2-inch nominal decking.

The calculated capacity for this area is 65 psf and a maximum vehicle weight of 5,500 pounds. It is recommended this area be upgrades to meet H-20 vehicle capacity for occasional occurrences and H-15 vehicle capacity for regular occurrences. To accomplish this the stringers in this area must be removed and replaced with 16-inch deep stringers. In most cases the pile caps have an additional 4-inch thick member on the top, which could be removed to maintain the same top of stringer elevation. In cases where this 4-inch member does not exist, the pile caps would need to be lowered. To accommodate the transverse aisle at the east end of the parking lot, the stringers between Bent 4 and 6 are recommended to be 6-inches x 16-inches at 16 inches on center with at least 3-inch nominal decking. For the longitudinal aisles and parking spaces from Bent 6 to Bent 12 the stringers are recommended to be 4-inches x 16- inches at 16 inches on-center with at least 3-inch nominal decking.

7.1.3. Area 3 – The walkway north of the buildings between Bent 3 and Bent 16 Current Load Rating
Uniform Live Load: 125 psf
Vehicle Live Load: 6 Tons (12,000 pounds)
Upgrades Recommendation: Upgrade to allow H-10 (10 Ton) Delivery Vehicle Live Load In this zone the stringers are 3-inches x 16-inches at 22 inches on-center. The calculated capacity for this area is approximately 125 psf and a vehicle weight of 12,000 pounds. The code requirement for a sidewalk is to allow for up-to an 8,000-pound concentrated load for occasional vehicles, which corelates to an H10 (10 Ton) truck. It is recommended that this area be upgraded to sidewalk standards with 3-inch x 16- inch or 4-inch x 16-inch stringers placed between the existing stringers and 3-inch decking to allow access for maintenance vehicles and possibly delivery vehicles.

5.E.b
Packet Pg. 592 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

7.1.4. Area 4 – Parking area bounded by Bent 12 on the east, Bent 16 on the west, existing building on the north and the edge of the pier on the south Current Load Rating
Uniform Live Load: 200 psf
Vehicle Live Load (Regularly Occurring): 15 Tons (30,000 pounds) Vehicle Live Load (Occasionally Occurring): 20 Tons (40,000 pounds) Upgrades Recommendation: No Upgrades Recommended at This Time This zone connects the east and west portions of the on-pier parking lot and was previously upgraded with supplemental stringers that were previously spaced 22 inches on-center. This deck area now has 4- inch x 16-inch stringers at 11 inches on-center and has the capacity to support H-15 (15 Ton) truck loading on a regular basis and H-20 (20 Ton) trucks on an occasional basis.

7.1.5. Area 5 – Pedestrian area bounded by Bent 15 on the east, Bent 16 on the west, Area 3 on the north and Area 4 on the south
Current Load Rating
Uniform Live Load: 150 psf
Vehicle Live Load: 7 Tons (14,000 pounds)
Upgrades Recommendation: No Upgrades Recommended at This Time This zone has 3-inch x 16-inch stringers at 18 inches on center. The calculated capacity of this area is approximately 150 psf or a vehicle weight of 14,000 pounds running in the transverse direction. Since this is currently a pedestrian area within the building zone, it is not necessary to upgrade this area at this time.

However, if stringers must be replaced due to damage or deterioration, they should be replaced with 4- inch x 16-inch stringers. If the use of the area is ever changed to a vehicular driveway then the stringers should be replaced with 6-inch x 16-inch stringers at 16 inches on-center.

7.1.6. Area 6 – The parking entrance and the central transverse aisle (Events Lane) between Bents 16 and 19 from the Municipal Pier to the southern edge of the pier; except an area between Bents 18 and 19 from Pile Row a to Pile Row f Current Load Rating
Uniform Live Load: 200 psf
Vehicle Live Load (Regularly Occurring): 15 Tons (30,000 pounds) Vehicle Live Load (Occasionally Occurring): 20 Tons (40,000 pounds) Upgrades Recommendation: No Upgrades Recommended at This Time This area was previously upgraded with 6-inch x 16-inch stringers at 16 inches on-center and has the capacity to support H-15 (15 Ton) truck loading on a regular basis and H-20 (20 Ton) trucks on an occasional basis.

7.1.7. Area 7 – Portion of Entrance Lane and a parking area bounded by Piles 18a, 18f, 21a, and 21f
Current Load Rating
Uniform Live Load: 125 psf

5.E.b
Packet Pg. 593 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Vehicle Live Load: 6 Tons (12,000 pounds)
Upgrades Recommendation: Upgrade to allow H-15 (regularly)/H-20 (occasionally) Vehicle Live Load This area has 4-inch x 16-inch stringers at 22 inches on-center and has a calculated capacity to support a maximum vehicle weight of 12,000 pounds. It is recommended this area be upgrades to meet H-20 vehicle capacity for occasional occurrences and H-15 vehicle capacity for regular occurrences. To accomplish this, the portion of the area between Bents 18 and 19 should be upgraded to 6-inch x 16-inch stringers at 16 inches on-center to complete the Entrance Lane upgrade; or supplement the existing stringers with 6-inch x 16-inch stringers. The remainder of the area between Bent 19 and Bent 21 should be upgraded to 4-inch x 16-inch stringers at 16 inches on-center or supplement with new 3-inch x 16-inch or 4-inch x 16-inch stringers between each existing stringer.

7.1.8. Area 8 – Parking area bounded by Piles 19f, 19m, 21f and 21m Current Load Rating
Uniform Live Load: 125 psf
Vehicle Live Load: 6 Tons (12,000 pounds)
Upgrades Recommendation: Upgrade to allow H-15 (regularly)/H-20 (occasionally) Vehicle Live Load In this zone the stringers are 3-inches x 16-inches at 22 inches on-center with 3-inch nominal decking. The calculated capacity for this area is 125 psf or a vehicle weight of 12,000 pounds. It is recommended this area be upgrades to meet H-20 vehicle capacity for occasional occurrences and H-15 vehicle capacity for regular occurrences. To accomplish this, these stringers need to be supplemented. It is recommended that 4-inch x 16-inch stringers be added between the existing stringers.

7.1.9. Area 9 – Longitudinal aisle and parking area bounded by Piles 19m, 19o, 23m and 23o Current Load Rating
Uniform Live Load: 200 psf
Vehicle Live Load (Regularly Occurring): 15 Tons (30,000 pounds) Vehicle Live Load (Occasionally Occurring): 20 Tons (40,000 pounds) Upgrades Recommendation: No Upgrades Recommended at This Time This zone connects the Events Lane to the Maintenance Building entrance and was previously upgraded with 6-inch x16-inch stringers at 16 inches on-center and has the capacity to support H-15 truck loading on a regular basis and H-20 (20 ton) trucks on an occasional basis.

7.1.10. Area 10 – Parking area bounded by Piles 19m, 35m and the southern edge of the pier, excluding Area 9
Current Load Rating
Uniform Live Load: 150 psf
Vehicle Live Load: 7 Tons (14,000 pounds)
Upgrades Recommendation: Upgrade to allow H-15 (regularly)/H-20 (occasionally) Vehicle Live Load This area has 4-inch x 16-inch stringers at 22 inches on-center. The calculated capacity for this area is 150 psf or a vehicle weight of 14,000 pounds. It is recommended this area be upgraded to meet H-20 vehicle capacity for occasional occurrences and H-15 vehicle capacity for regular occurrences. To accomplish this, these stringers should be supplemented. It is recommended that 3-inch x 16-inch or 4-inch x 16-inch

5.E.b
Packet Pg. 594 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

stringers be added between the existing stringers from Bent 19 to Bent 29 and Bent 31 to Bent 32; and 6- inch x 16-inch stringers be added between Bent 29 and Bent 31. The area between Bent 32 and Bent 35 is within the fence of Pacific Park but is still part of the timber structure. It is recommended that this area be upgraded in a manner similar to the area from Bent 19 to Bent 32 if the use changes, or vehicles are anticipated.

7.1.11. Area 11 – Pedestrian area Bents 26 and 28, and between Area 10 and the walkway adjacent to the Municipal Pier
Current Load Rating
Uniform Live Load: 180 psf
Vehicle Live Load: 7.5 Tons (15,000 pounds)
Upgrades Recommendation: No Upgrades Recommended at This Time This area has 4-inch x 12-inch stringers at 12 inches on-center. The calculated capacity for this area is 180 psf or a vehicle weight of 15,000 pounds. This area meets the required capacity for pedestrian areas but is slightly less than our recommended capacity for the building areas. However, this was determined to be adequate based on the load requirements for the lighter type of building construction used in the Central Restrooms and other building loads. Upgrades are not recommended at this time.

7.1.12. Area 12 – The walkway area between the building zone and the Municipal Pier from Bent 26 to Bent 51
Current Load Rating
Uniform Live Load: 65 psf
Vehicle Live Load: 3 Tons (6,000 pounds)
Upgrades Recommendation: Upgrade to allow H-10 (10 Ton) Delivery Vehicle Live Load This walkway has 3-inch x 12-inch and 4-inch x 12-inch stringers at spacings from 12 inches to 24 inches.

The calculated capacity for this area is approximately 65 psf or a vehicle weight of 6,000 pounds. Between Bent 26 and Bent 27 the 4-inch x 12-inch stringers have been supplemented with 4-inch x 16-inch stringers to provide maintenance vehicle and vender delivery truck access to Area 11 and the current cart storage area. All of this walkway should be upgraded to 4-inch x 16-inch stringers at 16 inches on-center to allow for maintenance vehicles and vender delivery truck access.

7.1.13. Area 13 – Building area between Bents 36 and 40 and between Pile Rows c and n occupied by the Trapeze School
Current Load Rating
Uniform Live Load: 200 psf
Vehicle Live Load: 9 Tons (18,000 pounds)
Upgrades Recommendation: No Upgrades Recommended at This Time This zone has 4-inch x 16-inch stingers at 18 inches on-center. The calculated capacity for this area is 200 psf or a vehicle weight of 18,000 pounds and meets our recommendations for building areas. As such, no upgrades are recommended at this time.

5.E.b
Packet Pg. 595 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

7.1.14. Area 14 – Pedestrian and vehicular passageway from Bent 51 to Bent 48, and from the southern edge of the Municipal Pier Phase 4 Upgrade to the Expansion Joint at Pile Row n
Current Load Rating
Uniform Live Load: 200 psf
Vehicle Live Load: 7.5 Tons (15,000 pounds)
Upgrades Recommendation: Upgrade from Timber Substructure to Concrete Substructure in Tidal Zone This area has 3-inch x 14-inch stringers at 12 inches on-center. The calculated capacity for this area is approximately 200 psf or a vehicle weight of 15,000 pounds. This area has timber piles that are within the tidal zone and are subject to wave action. It is recommended that this area reconstructed using concrete piles and caps within the tidal zone. In order to maintain the westernmost building of Pacific Park, the zone of reconstruction would be limited to the western twenty-seven feet of the pier between Pile Rows a and n.

7.1.15. Area 15 – Pedestrian and vehicular passageway from Bent 52 to Bent 49, and from the Expansion Joint at Pile Row n to the southern edge of the Pier Current Load Rating
Uniform Live Load: 200 psf
Vehicle Live Load: 9 Tons (18,000 pounds)
Upgrades Recommendation: Upgrade to allow H-15 (regularly)/H-20 (occasionally) Vehicle Live Load This area has 3-inch x 14-inch stringers at 12 inches on-center. The calculated capacity for this area is approximately 200 psf or a vehicle weight of 18,000 pounds. It is recommended this area be upgraded to meet H-20 vehicle capacity for occasional occurrences and H-15 vehicle capacity for regular occurrences.

To accomplish this, the existing stringers should be supplemented with 6-inch x 14-inch stringers between each existing.

7.1.16. Area 16 – Pedestrian and vehicular passageway from Bent 35 to Bent 48, and from the Pacific Park fence to the southern edge of the Pier
Current Load Rating
Uniform Live Load: 200 psf
Vehicle Live Load: 12 Tons (24,000 pounds)
Upgrades Recommendation: Upgrade to allow H-15 (regularly)/H-20 (occasionally) Vehicle Live Load This area has 3-inch x 16-inch stringers at 12 inches on-center. The calculated capacity for this area is approximately 200 psf or a vehicle weight of 24,000 pounds. It is recommended this area be upgraded to meet H-20 vehicle capacity for occasional occurrences and H-15 vehicle capacity for regular occurrences.

To accomplish this, the existing stringers should be supplemented with 3-inch x 16-inch or 4-inch x 16- inch stringers between each existing.

7.1.17. Area 17 – Pacific Park building area from Bent 40 to Bent 51 and from Pile Row a to n Current Load Rating
Uniform Live Load: 200 psf
Vehicle Live Load: 7.5 Tons (15,000 pounds)

5.E.b
Packet Pg. 596 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Upgrades Recommendation: Upgrade from Timber Substructure to Concrete Substructure in Tidal Zone This area has 3-inch x 14-inch stringers at 12 inches on-center. The calculated capacity for this area is approximately 200 psf or a vehicle weight of 15,000 pounds. Just as with Area 14, it is the goal to have concrete piles in the tidal zone. However, since this is an active commercial area it is reasonable that this upgrade would not be implemented until either the buildings are scheduled for redevelopment, or there is a need for major pier structure reconstruction. The estimated cost of this upgrade using the same substructure as the Municipal Pier Phase 4 and 4-inch x 16-inch stringers at 18 inches on-center.

7.1.18. Area 18 – Pier Entrance Driveway
Current Load Rating
Uniform Live Load: 200 psf
Vehicle Live Load (Regularly Occurring): 15 Tons (30,000 pounds) Vehicle Live Load (Occasionally Occurring): 20 Tons (40,000 pounds) Upgrades Recommendation: No Upgrades Recommended at This Time This area was previously upgraded with 6-inch x 16-inch stringers at 16 inches on-center and has the capacity to support H-15 truck loading on a regular basis and H-20 (twenty ton) trucks on an occasional basis.

7.1.19. Aquarium Roof Area
Current Load Rating
Uniform Live Load: 85 psf
Vehicle Live Load: 3 Tons (6,000 pounds)
Upgrades Recommendation: Upgrade to 100 psf Uniform Live Load and H-5 (5 Tons) Vehicle Live Load This area has 4-inch x 10-inch stringers at 16 inches on-center. The calculated capacity for this area is 85 psf or a vehicle weight of 6,000 pounds. It is recommended this area be upgraded to the code required capacity for pedestrian assembly areas of 100 psf. To accomplish this, the existing 4-inch x 10-inch at 16 inches on-center stringers could be supplemented with either 3-inch x 10-inch or 4-inch x 10-inch stringers. The 3-inch x 10-inch supplement would result in a live load capacity of 150 psf or a maximum vehicle weight of 12,000 pounds; while the 4-inch x 10-inch supplement would increase the live load capacity to 180 psf or a 14,000 pound vehicle.

7.1.20. Municipal Pier Phase 4 Area
Current Load Rating
Uniform Live Load: 200 psf
Vehicle Live Load (Regularly Occurring): 15 Tons (30,000 pounds) Vehicle Live Load (Occasionally Occurring): 20 Tons (40,000 pounds) Upgrades Recommendation: No Upgrades Recommended at This Time This zone connects the West-End Platform to the rest of the municipal pier and was previously upgraded with 4-inch x 16-inch stringers at 16 inches on-center and has the capacity to support H-15 (15 Ton) truck loading on a regular basis and H-20 (20 Ton) trucks on an occasional basis.

5.E.b
Packet Pg. 597 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

7.1.21. Concrete Waffle Slab Area
Current Load Rating
Uniform Live Load: 180 psf
Vehicle Live Load: 7.5 Tons (15,000 pounds)
Upgrades Recommendation: Upgrade to allow H-15 (regularly)/H-20 (occasionally) Vehicle Live Load (Included in M&N Current Contract with City for Pier Upgrades) Figure 7-2: H7.5 Truck Loading
This zone consists of the West-End Platform that houses the Harbor Patrol and Lifeguard Offices and other restaurant buildings. This area is composed of a concrete waffle slab 16-inches thick overlain with 3-inch x 6-inch timber sleepers and timber decking. The City has contracted with M&N to perform a design to upgrade this area of the pier to support H-15 (15 Ton) truck loading on a regular basis and H-20 (20 Ton) trucks on an occasional basis.

Pier Load Ratings and Upgrades Summary
A summary has been provided that details the load rating or each area and associated upgrades required to bring area up to required load rating capacity, as shown in Table 7-1.

5.E.b
Packet Pg. 598 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Table 7-1: Deck Area Upgrades Summary

5.E.b
Packet Pg. 599 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Table 7-1: Deck Area Upgrades Summary (Continued)
Pier Upgrades Cost Estimate
Estimates of probable construction costs have been produced for the recommended upgrades for the pier deck areas to achieve necessary load requirements for future maintenance goals as part of the overall pier capital improvements program. Cost estimates assume each of these upgrade phases will be done under a separate contractor mobilization effort. There may be an opportunity to save costs by conducting all upgrades under a single contract, by having an on-call agreement with a local marine construction contractor, or by having the City maintenance staff conduct the upgrades. Refer to Appendix D for a full itemized cost estimate for recommended upgrades.

The costs have been developed based on historical and current data using in-house sources, information from previous studies, as well as budget price quotations solicited from local suppliers and contractors. A contingency amount has been included to cover undefined items of work which will have to be performed, and elements of costs which will be incurred, but which are not explicitly detailed or described due to the level of investigation, engineering, and estimating completed. The opinion of probable construction cost is shown in Table 7-2 through Table 7-4.

5.E.b
Packet Pg. 600 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Table 7-2: Deck Area Upgrades Cost Estimate

5.E.b
Packet Pg. 601 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Table 7-3: Area 14 Concrete Substructure Upgrades Cost Estimate Table 7-4: Area 17 Concrete Substructure Upgrades Cost Estimate

5.E.b
Packet Pg. 602 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Sea Level Rise

7.4.1. Sea Level Rise Scenarios
The 2018 update of the California Ocean Protection Council’s (OPC) Sea-Level Rise (SLR) Guidance has been identified by the California Coastal Commission (CCC) as the current best-available science on the subject. This report provides probabilistic SLR projections under high and low-emissions scenarios from 2030-2150. The 2018 OPC report lists the likely range of SLR in Santa Monica under a high emission, “business as usual” scenario as 0.3 – 0.5 feet by 2030, 0.6 – 1.1 feet by 2050, and 1.5 – 3.3 feet by 2100.

These projections are identified by the CCC as being appropriate for low risk aversion activities. For medium risk aversion activities under the same scenario, the CCC recommends planning for 0.8 feet of SLR by 2030, 1.9 feet by 2050, and 6.8 feet by 2100. The range of SLR projections for each risk aversion curve are provided in Figure 7-3. These OPC projections vary slightly from projections listed in the City of Santa Monica Local Coastal Program Update - Land Use Plan (Public Draft dated February 2018) but in general remain consistent for each time horizon.

Figure 7-3: California Ocean Protection Council SLR Projections and Associated Risk Recommendations

7.4.2. Potential Vulnerabilities
Future vulnerabilities due to SLR primarily result from increases in coastal flood elevations, rates of erosion, and wave action. While the Santa Monica Pier itself is elevated on piles, coastal processes influenced by SLR may result in physical impacts to different elements of the pier structure. Some of the processes influenced by SLR that have the potential to result in impacts to the Pier are described below:

5.E.b
Packet Pg. 603 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

Beach Erosion
A widely accepted consequence of SLR is the landward and upward shift of the beach profile in response to the water levels and wave action reaching higher elevations. The Santa Monica shoreline in the vicinity of the Pier has been relatively stable due to historic beach nourishment activities and wave protection provided by the submerged offshore breakwater. However, SLR will result in long-term retreat of the beach profile, eventually exposing more segments of the Pier to the dynamic nearshore coastal processes.

This will potentially expand the inspection and maintenance requirements as more of the piles will be subject to the harsh environmental factors that typically occur where piles are subject to fluctuations in water levels, sand levels, and wave action.

Extreme Events
Extreme events where large waves coincide with high water levels have been responsible for most of the damage to coastal piers in California, including the failure of the outer portion of the Santa Monica Pier in 1983. These events often occur during winter months and are associated with strong El Niño Southern Oscillation patterns, which typically result in above average water levels and larger wave events along the coast of Southern California. SLR will result in less freeboard between the Pier deck and the wave crest elevation during such extreme events. A review of the basis of design documents for the outer section of the Santa Monica Pier may provide the design freeboard, an indication of how much SLR could be accommodated before impacts to the pier deck, piles, cross-bracing, utilities or other elements would be expected. The future risk of damage from an extreme wave event also depends on the continued effectiveness of the submerged offshore breakwater at reducing wave heights and water depths in the vicinity of the Pier.

A summary of the potential impacts from increased beach erosion and extreme wave events due to SLR is as follows:
x Increased erosion of underlying beach and exposure of piles that were previously outside of the dynamic nearshore tidal zone (i.e. increased inspection, maintenance and repair required to maintain safety and/or functionality).
x Increased wave forces on piles already suffering from deterioration due to the harsh marine environment.
x Uplift and impact forces on piles and deck during some combination of extreme wave event + SLR. x Damage and potential failure of piles, bracing and under-deck utilities as a result of increased wave loading.
x Loss of operational functions due to flooding of ground level parking and access locations.

7.4.3. Potential Impacts and Next Steps
The Pier structure consists of a variety of materials and configurations and therefore the exposure to coastal hazards and potential impacts will vary greatly throughout the structure. For example, older timber piles that exhibit deterioration near the tidal zone would be more vulnerable to the effects of increased wave action driven by SLR than the newer reinforced concrete piles. Likewise, different locations of the Pier will experience different types of coastal processes. Extreme events, where highwater levels coincide with large wave heights, are a concern for over-water sections of the Pier, but less of a concern at the base of the Pier where storm wave energy would have dissipated across the beach

5.E.b
Packet Pg. 604 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225

profile. In addition to direct impacts to the Pier, there are also in-direct impacts such as flooding or erosion of ground level parking or access structures that could impact the function and usage of the Pier.

The next step in understanding the Pier vulnerabilities is to identify the thresholds of SLR that would be problematic for the different segments of the Pier. This information would be useful to factor into planning and design of major improvements to the Pier and associated structures. This condition assessment provides a first step in describing the current state of the Pier and identifying areas in need of repair or improvement. The next step, outside the scope of this study, would be to compare this information against coastal hazard projections for a range of SLR increments. This effort would involve characterizing the site-specific hazards such as long-term shoreline erosion, storm-related erosion, and extreme wave crest profiles in relation to the Pier deck elevations. Each of these factors are influenced by the submerged breakwater located offshore of the Pier. SLR will reduce the effectiveness of the offshore breakwater, exposing the shoreline and Pier structures to additional wave energy that could increase the potential vulnerabilities. At this time, these site-specific details are not well resolved in regional efforts such as the Adapt LA Sea Level Rise Vulnerability Assessment nor the coastal hazard projections published by USGS as part of the CoSMoS program.

5.E.b
Packet Pg. 605 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225
Appendix A:

Material Element & Overall System Condition Assessment Ratings

5.E.b
Packet Pg. 606 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225
Damage Ratings for Timber Elements
Damage Rating Existing Damage1
Exclusions
[Defects Requiring Elevation to the Next
Higher Damage Rating(s)]
NI
Not
Inspected
Not inspected, inaccessible, or passed by2
ND No Defects Sound surface material
MN Minor Checks, splits, and gouges less than 0.5 in. wide Evidence of marine borers or fungal decay
Minor damage not appropriate if:
x Loss of cross section
x Marine borer infestation
x Displacements, loss of bearing,
or connections
MD Moderate Remaining diameter loss up to 15%
Checks and splits wider than 0.5 in.

Cross section area loss up to 25%
Corroded hardware
Evidence of marine borers or fungal decay, with loss
of section
Moderate damage not appropriate if:
x Displacements, loss of bearing
or connections
MJ Major Remaining diameter loss 15 to 30%
Checks and splits through full depth of cross section
Cross-section area loss 25 to 50%; heavily corroded
hardware
Displacement and misalignments at connections
Major damage not appropriate if:
x Partial or complete breakage
SV Severe Remaining diameter loss more than 30%
Cross section area loss more than 50%
Loss of connections and/ or fully nonbearing
condition
Partial or complete breakage
1 Any defect listed below is sufficient to identify relevant damage grade. 2 If not inspected due to inaccessibility or passed by, note as such.

5.E.b
Packet Pg. 607 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225
Damage Ratings for Timber Elements

5.E.b
Packet Pg. 608 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225
Damage Ratings for Steel Elements
Damage Rating Existing Damage1
Exclusions
[Defects Requiring Elevation to the Next
Higher Damage Rating(s)]
NI
Not
Inspected
Not inspected, inaccessible, or passed by2
ND No Defects
Protective coating or wrap intact
Light surface rust
No apparent loss of material
MN Minor
Protective coating or wrap damaged and loss of
thickness up to 15% of nominal at any location
Less than 50% of perimeter or circumference
affected by corrosion at any elevation or cross
section
Loss of thickness up to 15% of nominal at any
location
Minor damage not appropriate if:
x Changes in straight line
configuration or local buckling
x Corrosion loss exceeding
fabrication tolerances (at any
location)
MD Moderate
Protective coating or wrap damaged and loss of
thickness 15 to 30% of nominal at any location
More than 50% of perimeter or circumference
affected by corrosion at any elevation or cross
section
Loss of thickness 15 to 30% of nominal at any
location
Moderate damage not appropriate if:
x Changes in straight line
configuration or local buckling
x Loss of thickness exceeding
30% of nominal at any
location
MJ Major
Protective coating or wrap damaged and loss of
nominal thickness 30 to 50% at any location
Partial loss of flange edges or visible reduction of
wall thickness on pipe piles
Loss of nominal thickness 30 to 50% at any location
Major damage not appropriate if:
x Changes in straight line
configuration or local buckling
x Perforations or loss of wall
thickness exceeding 50% of
nominal
SV Severe
Protective coating or wrap damaged and loss of
wall thickness exceeding 50%of nominal at any
location
Structural bends or buckling, breakage and
displacement at supports, lose or lost
connections
Loss of wall thickness exceeding 50% of nominal at
any location
1 Any defect listed below is sufficient to identify relevant damage grade. 2 If not inspected due to inaccessibility or passed by, note as such.

5.E.b
Packet Pg. 609 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225
Damage Ratings for Steel Elements

5.E.b
Packet Pg. 610 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225
Damage Ratings for Reinforced Concrete Elements
Damage Rating Existing Damage1
Exclusions
[Defects Requiring Elevation to the Next
Higher Damage Rating(s)]
NI Not
Inspected
x Not inspected, inaccessible, or passed by2
ND No Defects x Good original hard surface, hard material, sound MN Minor
x Mechanical abrasion or impact spalls up to 1 in. in
depth
x Occasional corrosion stains or small pop-out
corrosion spalls
x General cracks up to 1/16 in. in width
Minor damage not appropriate if
x Structural damage
x Corrosion cracks
x Chemical deterioration3
MD Moderate
x Structural cracks up to 1/16 in. in width
x Corrosion cracks up to 1/4 in. in width
x Chemical deterioration: Random cracks up to 1/16
in. in width; "Soft" concrete and/or rounding of
corners up to 1 in. deep
x Mechanical abrasion or impact spalls greater than
1 in. in depth
Moderate damage not appropriate if
x Structural breakage and/or spalls
x Exposed reinforcement
x Loss of cross section due to chemical
deterioration beyond rounding of
corner edges
MJ Major
x Structural cracks 1/16 in. to 1/4 in. in width and
partial breakage (through section cracking with
structural spalls)
x Corrosion cracks wider than 1/4 in. and open or
closed corrosion spalls (excluding pop-outs)
x Multiple cracks and disintegration of surface layer
due to chemical deterioration
x Mechanical abrasion or impact spalls exposing the
reinforcing
Major damage not appropriate if
x Loss of cross section exceeding 30%
due to any cause
SV Severe
x Structural cracks wider than 1/4 in. or complete
breakage
x Complete loss of concrete cover due to corrosion
of reinforcing steel with more than 30% of
diameter loss for any main reinforcing bar
x Loss of bearing and displacement at connections
x Loss of concrete cover (exposed steel) due to
chemical deterioration
x Loss of more 30% of cross section due to any
cause 1 Any defect listed below is sufficient to identify relevant damage grade. 2 If not inspected due to inaccessibility or passed by, note as such. 3 Chemical deterioration: Sulfate attack, alkali-silica reaction, alkali-aggregate reaction, alkali-carbonate reaction ettringite distress, or other chemical/concrete deterioration.

5.E.b
Packet Pg. 611 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225
Damage Ratings for Reinforced Concrete

5.E.b
Packet Pg. 612 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225
Appendix B:

GIS Database Pier Inspection Summary Figures

5.E.b
Packet Pg. 613 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
structure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
structure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
structure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
structure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
structure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
structure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
structure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
structure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225
Appendix C:

Detailed Pier Repair Cost Summary

5.E.b
Packet Pg. 622 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

M&N JOB ORDER NUMBER DATE PREPARED
10225-00 15-Nov-18

ITEM DESCRIPTION NUMBER UNIT UNIT COST SUBTOTAL TOTAL
General Requirements
Mobilization / Demobilization (including specialty equipment) 1 LS $37,627.00 $37,627.00 Supervision 1 LS $18,232.00 $18,232.00
Bonds, Insurance, Overhead and Profit 1 LS $34,185.00 $34,185.00 Site Survey / Construction Survey Crew 1 DAY $2,000.00 $2,000.00 Stand-By Allowance Due to Inclement Weather / Ocean Conditions 0 DAY $0.00 $0.00 General Requirements Subtotal $92,044
Construction Waste Management and Temporary Site BMP's
Waste Disposal & BMP's for Waterside Demolition 1 LS $40,000.00 $40,000.00 Ɣ&RQVWUXFWLRQ:DVWH0DQDJHPHQW 'LVSRVDO)HHV 1 LS $20,000.00 $20,000.00 Ɣ%03
V:DWHU3ROOXWLRQ&RQWURO(URVLRQ 6HGLPHQW&RQWURO 1 LS $5,000.00 $5,000.00 Ɣ7HPSRUDU\)HQFLQJ6LJQDJHDQG7UDIILF&RQWURO 1 LS $15,000.00 $15,000.00 Construction Waste Management Subtotal $40,000
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 1: Timber Pile Repairs
1 7 15 Timber Pile Repair (Severe) 1 LS $48,650.00 $48,650.00 Ɣ6(&7,21/266255277,1*'$0$*(
Ɣ&OHDQDQG5HPRYH0DULQH*URZWK$URXQG([LVWLQJ3LOH 7 EA $500.00 $3,500.00 Ɣ,QVWDOOQHZ6LPSVRQ6WURQJ7LH);3LOH5HSDLU-DFNHW 105 LF $430.00 $45,150.00

1.1 11 2 Timber Pile Repair (Severe) 1 LS $11,000.00 $11,000.00 Ɣ0,66,1*723&211(&7,21
Ɣ,QVWDOOQHZ7LPEHU&RUEHO
['RXJ)LU
ZLWK6WHHO+DUGZDUH 11 EA $1,000.00 $11,000.00
Timber Pile Repairs (ZONE No. 1) Subtotal $59,650
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 1: Timber Pile Cap Repairs
2 7 10 Timber Pile Cap Repair (Severe) 1 LS $28,000.00 $28,000.00 Ɣ63/,77,1*'()(&7,9(+$5':$5($1'5277,1*'$0$*(
Ɣ3URYLGHWHPSRUDU\VKRULQJRISLOHFDSORFDWLRQWRIDFLOLWDWHLQVWDOODWLRQ 7 EA $1,000.00 $7,000.00 Ɣ'HPR ,QVWDOOQHZ7LPEHU3LOH&DS
['RXJ)LU
ZLWK6WHHO+DUGZDUH 70 LF $300.00 $21,000.00
Timber Pile Cap Repairs (ZONE No. 1) Subtotal $28,000
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 1: Timber Bracing Repairs
3 38 15 Timber Lateral/Transverse Brace Repair (Severe) 1 LS $48,450.00 $48,450.00 Ɣ63/,77,1*'()(&7,9(+$5':$5($1'5277,1*'$0$*(
Ɣ'HPR ,QVWDOOQHZ7LPEHU%UDFH
['RXJ)LU
ZLWK6WHHO+DUGZDUH 570 LF $85.00 $48,450.00
Timber Bracing Repairs (ZONE No. 1) Subtotal $48,450
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 1: Steel Bracing Repairs

3.1 8 10 Steel Lateral/Transverse Brace Repair (Severe) 1 LS $8,800.00 $8,800.00 Ɣ&25526,21'()(&7,9(+$5':$5($1'92,'6
Ɣ'HPR ,QVWDOOQHZ6WHHO7XEH%UDFH
'LDPHWHU
ZLWK6WHHO+DUGZDUH 80 LF $110.00 $8,800.00
Steel Bracing Repairs (ZONE No. 1) Subtotal $8,800
Item
No.

Total
(ea)
Repair
Area (ft) ZONE 1: Timber Stringer Repairs
4 1 1000 Timber Stringer Repair (Severe) 1 LS $25,000.00 $25,000.00 Ɣ%52.(163/,77,1*$1'5277,1*'$0$*(
Ɣ'HPR ,QVWDOOQHZ7LPEHU6WULQJHUV
['RXJ)LU
ZLWK6WHHO6SLNHV 1,000 SF $25.00 $25,000.00
Timber Stringer Repairs (ZONE No. 1) Subtotal $25,000
Item
No.

Total
(ea)
Repair
Area (ft) ZONE 1: Timber Decking Repairs
5 0 0 Timber Decking Repair (Severe) 1 LS $0.00 $0.00
Ɣ127$33/,&$%/(
1$

Timber Decking Repairs (ZONE No. 1) Subtotal $0
ZONE No. 1: Timber East-End Pier Segment Subtotal $169,900 TOTAL
ZONE 1: Timber East-End Pier Segment

QUANTITY
Santa Monica Pier Infrastructure Assessment and Upgrades - Santa Monica, CA

PREPARED BY PREPARED FOR
City of Santa Monica
Civil Engineering Division

OPINION OF PROBABLE COST (OPC)

PROJECT DESCRIPTION
Recommended for Immediate Repairs
Santa Monica Municipal Pier Inspection (Priority Repairs)

PROJECT TITLE

5.E.b
Packet Pg. 623 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

M&N JOB ORDER NUMBER DATE PREPARED
10225-00 15-Nov-18

ITEM DESCRIPTION NUMBER UNIT UNIT COST SUBTOTAL TOTAL

QUANTITY TOTAL
Santa Monica Pier Infrastructure Assessment and Upgrades - Santa Monica, CA

PREPARED BY PREPARED FOR
City of Santa Monica
Civil Engineering Division

OPINION OF PROBABLE COST (OPC)

PROJECT DESCRIPTION
Recommended for Immediate Repairs
Santa Monica Municipal Pier Inspection (Priority Repairs)

PROJECT TITLE
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 2: Concrete Pile Repairs
6 0 0 Concrete Pile Repair (Severe) 1 LS $0.00 $0.00
Ɣ127$33/,&$%/(
1$

Concrete Pile Repairs (ZONE No. 2) Subtotal $0
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 2: Concrete Capital Repairs
7 0 0 Concrete Capital Repair (Severe) 1 LS $0.00 $0.00 Ɣ127$33/,&$%/(
1$

Concrete Capital Repairs (ZONE No. 2) Subtotal $0
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 2: Concrete Pile Cap Repairs
82 10 Concrete Pile Cap Repair (Severe) 1 LS $16,000.00 $16,000.00 Ɣ&5$&.,1*(;326('5(%$5$1'5867%/(('6
Ɣ3URYLGHWHPSRUDU\VFDIIROGLQJWRIDFLOLWDWHLQVWDOODWLRQ 2 EA $2,000.00 $4,000.00 Ɣ&OHDQDQG5HPRYH([FHVV0DWHULDODQG*URZWK$URXQG([LVWLQJ$UHD 2 EA $1,000.00 $2,000.00 Ɣ,QVWDOOQHZIRUPZRUNGRZHOUHEDUDQGJURXW5HSDLU 20 LF $500.00 $10,000.00 Concrete Pile Cap Repairs (ZONE No. 2) Subtotal $16,000 Item Total Repair ZONE 2: Timber Stringer Repairs
9 0 0 Timber Stringer Repair (Severe) 1 LS $0.00 $0.00
Ɣ127$33/,&$%/(
1$

Timber Stringer Repairs (ZONE No. 2) Subtotal $0
Item
No.

Total
(ea)
Repair
Area (ft) ZONE 2: Timber Decking Repairs
10 0 0 Timber Decking Repair (Severe) 1 LS $0.00 $0.00
Ɣ127$33/,&$%/(
1$

Timber Decking Repairs (ZONE No. 2) Subtotal $0
ZONE No. 2: Concrete Amusement Structure Pier Segment Subtotal $16,000 Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 3: Concrete Pile Repairs
11 0 0 Concrete Pile Repair (Severe) 1 LS $0.00 $0.00
Ɣ127$33/,&$%/(
1$

Concrete Pile Repairs (ZONE No. 3) Subtotal $0
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 3: Concrete Pile Cap Repairs
12 0 0 Concrete Pile Cap Repair (Severe) 1 LS $0.00 $0.00 Ɣ127$33/,&$%/(
1$

Concrete Pile Cap Repairs (ZONE No. 3) Subtotal $0
Item
No.

Total
(ea)
Repair
Area (ft) ZONE 3: Timber Stringer Repairs
13 0 0 Timber Stringer Repair (Severe) 1 LS $0.00 $0.00 Ɣ127$33/,&$%/(
1$

Timber Stringer Repairs (ZONE No. 3) Subtotal $0
Item
No.

Total
(ea)
Repair
Area (ft) ZONE 3: Timber Decking Repairs
14 0 0 Timber Decking Repair (Severe) 1 LS $0.00 $0.00
Ɣ127$33/,&$%/(
1$

Timber Decking Repairs (ZONE No. 3) Subtotal $0
ZONE 3: Concrete West-End Approach Pier Segment Subtotal $0 Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 4: Concrete Pile Repairs
15 0 0 Concrete Pile Repair (Severe) 1 LS $0.00 $0.00
Ɣ127$33/,&$%/(
1$

Concrete Pile Repairs (ZONE No. 4) Subtotal $0
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 4: Concrete Waffle Slab Repairs
16 0 0 Concrete Waffle Slab Repair (Severe) 1 LS $0.00 $0.00 Ɣ127$33/,&$%/(
1$

Concrete Waffle Slab Repairs (ZONE No. 4) Subtotal $0
Item
No.

Total
(ea)
Repair
Area (ft) ZONE 4: Timber Sleeper Repairs
17 0 0 Timber Sleeper Repair (Severe) 1 LS $0.00 $0.00
Ɣ127$33/,&$%/(
1$

Timber Sleeper Repairs (ZONE No. 4) Subtotal $0
Item
No.

Total
(ea)
Repair
Area (ft) ZONE 4: Timber Decking Repairs
18 0 0 Timber Decking Repair (Severe) 1 LS $0.00 $0.00
Ɣ127$33/,&$%/(
1$

Timber Decking Repairs (ZONE No. 4) Subtotal $0
ZONE 4: Concrete West-End Platform Pier Segment Subtotal $0 ZONE 2: Concrete Amusement Structure Pier Segment
ZONE 3: Concrete West-End Approach Pier Segment
ZONE 4: Concrete West-End Platform Pier Segment

5.E.b
Packet Pg. 624 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

M&N JOB ORDER NUMBER DATE PREPARED
10225-00 15-Nov-18

ITEM DESCRIPTION NUMBER UNIT UNIT COST SUBTOTAL TOTAL

QUANTITY TOTAL
Santa Monica Pier Infrastructure Assessment and Upgrades - Santa Monica, CA

PREPARED BY PREPARED FOR
City of Santa Monica
Civil Engineering Division

OPINION OF PROBABLE COST (OPC)

PROJECT DESCRIPTION
Recommended for Immediate Repairs
Santa Monica Municipal Pier Inspection (Priority Repairs)

PROJECT TITLE
TOTAL CONSTRUCTION (BEFORE MARKUPS) $317,940
Project Contingencies
Construction Contingency 20.00% $63,588
Engineering, CA/CM & Permitting Fee (NOT INCLUDED) $0

20.00% subtotal $63,588
WATERSIDE IMPROVEMENTS TOTAL (WITH MARKUPS) $382,000
HIGH-END AND LOW-END OPC RANGE (CLASS 4 ESTIMATE)
Plus 30% 30.00% $115,000 $497,000
Minus 20% 20.00% $76,000 $306,000
Notes: Price based on inspection conducted between July -September of 2018 Price assumes a suitable laydown area is available on-site at no cost to the contractor Pricing is in US Dollars, 3rd quarter 2019, and based on locally available resources Price is based on unencumbered contractor access to the site and assumes contractor has access along pedestrian walkway for construction equipment Price does not include environmental restrictions and assumes No weather risk included (force majeure) Escalation expense is not included
Estimate class based on AACE No. 56R-08
Price does not consider associated costs due to hazardous waste. Treated timber, steel ,and plastic material is assumed to be accepted as "controlled waste" Owner's costs (engineering, project management, owners overhead, third party QA/QC, etc.) are not included When reviewing the above estimated costs it is important to note the following:
-
-
-
A contingency amount has been included to cover undefined items, due to the level of engineering carried out at this time. The contingency is not a reflection of the accuracy of the estimates but covers items of work which will have to be performed, and elements of costs which will be incurred, but which are not explicitly detailed or described due to the level of investigation, engineering and estimating completed today.

This construction cost estimate is an 'Opinion of Probable Cost' made by a consultant. In providing opinions of construction cost, it is recognized that neither the client nor the consultant has control over the cost of labor, equipment, materials, or the contractor's means and methods of determining constructability, pricing or schedule. This opinion of construction cost is based on the consultant's reasonable professional judgement and experience and does not constitute a warranty, expressed or implied, that contractor's bids or negotiated prices for the work will not vary from The costs have been developed based on historical and current data using in-house sources, information from previous studies as well as budget price quotations solicited from local suppliers and contractors.

5.E.b
Packet Pg. 625 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

M&N JOB ORDER NUMBER DATE PREPARED
10225-00 15-Nov-18

ITEM DESCRIPTION NUMBER UNIT UNIT COST SUBTOTAL TOTAL
General Requirements
Mobilization / Demobilization (including specialty equipment) 1 LS $157,230.25 $157,230.25 Supervision 1 LS $91,834.00 $91,834.00
Bonds, Insurance, Overhead and Profit 1 LS $172,188.75 $172,188.75 Site Survey / Construction Survey Crew 1 DAY $2,000.00 $2,000.00 Stand-By Allowance Due to Inclement Weather / Ocean Conditions 0 DAY $0.00 $0.00 General Requirements Subtotal $423,253
Construction Waste Management and Temporary Site BMP's
Waste Disposal & BMP's for Waterside Demolition 1 LS $60,000.00 $60,000.00 Ɣ&RQVWUXFWLRQ:DVWH0DQDJHPHQW 'LVSRVDO)HHV 1 LS $35,000.00 $35,000.00 Ɣ%03
V:DWHU3ROOXWLRQ&RQWURO(URVLRQ 6HGLPHQW&RQWURO 1 LS $5,000.00 $5,000.00 Ɣ7HPSRUDU\)HQFLQJ6LJQDJHDQG7UDIILF&RQWURO 1 LS $20,000.00 $20,000.00 Construction Waste Management Subtotal $60,000
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 1: Timber Pile Repairs
1 44 10 Timber Pile Repair (Major) 1 LS $211,200.00 $211,200.00 Ɣ6(&7,21/266255277,1*'$0$*(
Ɣ&OHDQDQG5HPRYH0DULQH*URZWK$URXQG([LVWLQJ3LOH 44 EA $500.00 $22,000.00 Ɣ,QVWDOOQHZ6LPSVRQ6WURQJ7LH);3LOH5HSDLU-DFNHW 440 LF $430.00 $189,200.00

1.1 43 2 Timber Pile Repair (Major) 1 LS $38,700.00 $38,700.00 Ɣ63/,77,1*'()(&7,9(+$5':$5($1'60$//92,'6
Ɣ&OHDQDQG5HPRYH0DULQH*URZWK$URXQG([LVWLQJ3LOH 43 EA $400.00 $17,200.00 Ɣ,QVWDOOQHZ*DOYDQL]HG6WHHO6WUDSV
IW2&7RWDOHD
ZLWK+DUGZDUH 43 EA $500.00 $21,500.00
Timber Pile Repairs (ZONE No. 1) Subtotal $249,900
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 1: Timber Pile Cap Repairs
2 25 10 Timber Pile Cap Repair (Major) 1 LS $100,000.00 $100,000.00 Ɣ63/,77,1*'()(&7,9(+$5':$5($1'5277,1*'$0$*(
Ɣ3URYLGHWHPSRUDU\VKRULQJRISLOHFDSORFDWLRQWRIDFLOLWDWHLQVWDOODWLRQ 25 EA $1,000.00 $25,000.00 Ɣ'HPR ,QVWDOOQHZ7LPEHU3LOH&DS
['RXJ)LU
ZLWK6WHHO+DUGZDUH 250 LF $300.00 $75,000.00
Timber Pile Cap Repairs (ZONE No. 1) Subtotal $100,000
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 1: Timber Bracing Repairs
3 111 15 Timber Lateral/Transverse Brace Repair (Major) 1 LS $141,525.00 $141,525.00 Ɣ63/,77,1*'()(&7,9(+$5':$5($1'5277,1*'$0$*(
Ɣ'HPR ,QVWDOOQHZ7LPEHU%UDFH
['RXJ)LU
ZLWK6WHHO+DUGZDUH 1,665 LF $85.00 $141,525.00
Timber Bracing Repairs (ZONE No. 1) Subtotal $141,525
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 1: Steel Bracing Repairs

3.1 12 10 Steel Lateral/Transverse Brace Repair (Severe) 1 LS $13,200.00 $13,200.00 Ɣ&25526,21'()(&7,9(+$5':$5($1'92,'6
Ɣ'HPR ,QVWDOOQHZ6WHHO7XEH%UDFH
'LDPHWHU
ZLWK6WHHO+DUGZDUH 120 LF $110.00 $13,200.00
Steel Bracing Repairs (ZONE No. 1) Subtotal $13,200
Item
No.

Total
(ea)
Repair
Area (ft) ZONE 1: Timber Stringer Repairs
4 1 10000 Timber Stringer Repair (Major) 1 LS $250,000.00 $250,000.00 Ɣ%52.(163/,77,1*$1'5277,1*'$0$*(
Ɣ'HPR ,QVWDOOQHZ7LPEHU6WULQJHUV
['RXJ)LU
ZLWK6WHHO6SLNHV 10,000 SF $25.00 $250,000.00
Timber Stringer Repairs (ZONE No. 1) Subtotal $250,000
Item
No.

Total
(ea)
Repair
Area (ft) ZONE 1: Timber Decking Repairs
5 1 30000 Timber Decking Repair (Major) 1 LS $300,000.00 $300,000.00 Ɣ%52.(163/,77,1*$1'&211(&7,21'$0$*(
Ɣ,QVWDOOQHZ7LPEHU'HFNLQJ
['RXJ)LU
ZLWK6WHHO6SLNHV 30,000 SF $10.00 $300,000.00
Timber Decking Repairs (ZONE No. 1) Subtotal $300,000
ZONE No. 1: Timber East-End Pier Segment Subtotal $1,054,625 Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 2: Concrete Pile Repairs
6 1 10 Concrete Pile Repair (Major) 1 LS $7,300.00 $7,300.00 Ɣ&5$&.,1*(;326('5(%$5$1'5867%/(('6
Ɣ3URYLGHWHPSRUDU\VFDIIROGLQJWRIDFLOLWDWHLQVWDOODWLRQ 1 EA $2,000.00 $2,000.00 Ɣ&OHDQDQG5HPRYH([FHVV0DWHULDODQG*URZWK$URXQG([LVWLQJ3LOH 1 EA $1,000.00 $1,000.00 Ɣ,QVWDOOQHZ6LPSVRQ6WURQJ7LH);3LOH5HSDLU-DFNHW 10 LF $430.00 $4,300.00 Concrete Pile Repairs (ZONE No. 2) Subtotal $7,300
ZONE 1: Timber East-End Pier Segment
ZONE 2: Concrete Amusement Structure Pier Segment

OPINION OF PROBABLE COST (OPC) PREPARED BY PREPARED FOR PROJECT DESCRIPTION City of Santa Monica
Santa Monica Municipal Pier Inspection (Short-Term Repairs) Civil Engineering Division Recommended for Repair within 1-5 Years

PROJECT TITLE
Santa Monica Pier Infrastructure Assessment and Upgrades - Santa Monica, CA

QUANTITY TOTAL

5.E.b
Packet Pg. 626 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

M&N JOB ORDER NUMBER DATE PREPARED
10225-00 15-Nov-18

ITEM DESCRIPTION NUMBER UNIT UNIT COST SUBTOTAL TOTAL

OPINION OF PROBABLE COST (OPC) PREPARED BY PREPARED FOR PROJECT DESCRIPTION City of Santa Monica
Santa Monica Municipal Pier Inspection (Short-Term Repairs) Civil Engineering Division Recommended for Repair within 1-5 Years

PROJECT TITLE
Santa Monica Pier Infrastructure Assessment and Upgrades - Santa Monica, CA

QUANTITY TOTAL
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 2: Concrete Capital Repairs
7 0 0 Concrete Capital Repair (Major) 1 LS $0.00 $0.00
Ɣ127$33/,&$%/(
1$

Concrete Capital Repairs (ZONE No. 2) Subtotal $0
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 2: Concrete Pile Cap Repairs
8 3 10 Concrete Pile Cap Repair (Major) 1 LS $24,000.00 $24,000.00 Ɣ&5$&.,1*(;326('5(%$5$1'5867%/(('6
Ɣ3URYLGHWHPSRUDU\VFDIIROGLQJWRIDFLOLWDWHLQVWDOODWLRQ 3 EA $2,000.00 $6,000.00 Ɣ&OHDQDQG5HPRYH([FHVV0DWHULDODQG*URZWK$URXQG([LVWLQJ$UHD 3 EA $1,000.00 $3,000.00 Ɣ,QVWDOOQHZIRUPZRUNGRZHOUHEDUDQGJURXW5HSDLU 30 LF $500.00 $15,000.00 Concrete Pile Cap Repairs (ZONE No. 2) Subtotal $24,000 Item
No.

Total
(ea)
Repair
Area (ft) ZONE 2: Timber Stringer Repairs
9 0 0 Timber Stringer Repair (Major) 1 LS $0.00 $0.00
Ɣ127$33/,&$%/(
1$

Timber Stringer Repairs (ZONE No. 2) Subtotal $0
Item
No.

Total
(ea)
Repair
Area (ft) ZONE 2: Timber Decking Repairs
10 0 0 Timber Decking Repair (Major) 1 LS $0.00 $0.00
Ɣ127$33/,&$%/(
1$

Timber Decking Repairs (ZONE No. 2) Subtotal $0
ZONE No. 2: Concrete Amusement Structure Pier Segment Subtotal $31,300 Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 3: Concrete Pile Repairs
11 0 0 Concrete Pile Repair (Major) 1 LS $0.00 $0.00
Ɣ127$33/,&$%/(
1$

Concrete Pile Repairs (ZONE No. 3) Subtotal $0
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 3: Concrete Pile Cap Repairs
12 0 0 Concrete Pile Cap Repair (Major) 1 LS $0.00 $0.00 Ɣ127$33/,&$%/(
1$

Concrete Pile Cap Repairs (ZONE No. 3) Subtotal $0
Item
No.

Total
(ea)
Repair
Area (ft) ZONE 3: Timber Stringer Repairs
13 0 0 Timber Stringer Repair (Major) 1 LS $0.00 $0.00
Ɣ127$33/,&$%/(
1$

Timber Stringer Repairs (ZONE No. 3) Subtotal $0
Item
No.

Total
(ea)
Repair
Area (ft) ZONE 3: Timber Decking Repairs
14 0 0 Timber Decking Repair (Major) 1 LS $0.00 $0.00
Ɣ127$33/,&$%/(
1$

Timber Decking Repairs (ZONE No. 3) Subtotal $0
ZONE 3: Concrete West-End Approach Pier Segment Subtotal $0 Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 4: Concrete Pile Repairs
15 0 0 Concrete Pile Repair (Severe) 1 LS $0.00 $0.00
Ɣ127$33/,&$%/(
1$

Concrete Pile Repairs (ZONE No. 4) Subtotal $0
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 4: Concrete Waffle Slab Repairs
16 0 0 Concrete Waffle Slab Repair (Severe) 1 LS $0.00 $0.00 Ɣ127$33/,&$%/(
1$

Concrete Waffle Slab Repairs (ZONE No. 4) Subtotal $0
Item
No.

Total
(ea)
Repair
Area (ft) ZONE 4: Timber Sleeper Repairs
17 0 0 Timber Sleeper Repair (Severe) 1 LS $0.00 $0.00
Ɣ127$33/,&$%/(
1$

Timber Sleeper Repairs (ZONE No. 4) Subtotal $0
Item
No.

Total
(ea)
Repair
Area (ft) ZONE 4: Timber Decking Repairs
18 0 0 Timber Decking Repair (Severe) 1 LS $0.00 $0.00
Ɣ127$33/,&$%/(
1$

Timber Decking Repairs (ZONE No. 4) Subtotal $0
ZONE 4: Concrete West-End Platform Pier Segment Subtotal $0 ZONE 3: Concrete West-End Approach Pier Segment
ZONE 4: Concrete West-End Platform Pier Segment

5.E.b
Packet Pg. 627 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

M&N JOB ORDER NUMBER DATE PREPARED
10225-00 15-Nov-18

ITEM DESCRIPTION NUMBER UNIT UNIT COST SUBTOTAL TOTAL

OPINION OF PROBABLE COST (OPC) PREPARED BY PREPARED FOR PROJECT DESCRIPTION City of Santa Monica
Santa Monica Municipal Pier Inspection (Short-Term Repairs) Civil Engineering Division Recommended for Repair within 1-5 Years

PROJECT TITLE
Santa Monica Pier Infrastructure Assessment and Upgrades - Santa Monica, CA

QUANTITY TOTAL
TOTAL CONSTRUCTION (BEFORE MARKUPS) $1,569,180
Project Contingencies
Construction Contingency 20.00% $313,836
Engineering, CA/CM & Permitting Fee (NOT INCLUDED) $0

20.00% subtotal $313,836
WATERSIDE IMPROVEMENTS TOTAL (WITH MARKUPS) $1,883,000
HIGH-END AND LOW-END OPC RANGE (CLASS 4 ESTIMATE)
Plus 30% 30.00% $565,000 $2,448,000
Minus 20% 20.00% $377,000 $1,506,000
Notes: Price based on inspection conducted between July -September of 2018 Price assumes a suitable laydown area is available on-site at no cost to the contractor Pricing is in US Dollars, 3rd quarter 2019, and based on locally available resources Price is based on unencumbered contractor access to the site and assumes contractor has access along pedestrian walkway for construction equipment Price does not include environmental restrictions and assumes No weather risk included (force majeure) Escalation expense is not included
Estimate class based on AACE No. 56R-08
Price does not consider associated costs due to hazardous waste. Treated timber, steel ,and plastic material is assumed to be accepted as "controlled waste" Owner's costs (engineering, project management, owners overhead, third party QA/QC, etc.) are not included When reviewing the above estimated costs it is important to note the following:
-
-
- This construction cost estimate is an 'Opinion of Probable Cost' made by a consultant. In providing opinions of construction cost, it is recognized that neither the client nor the consultant has control over the cost of labor, equipment, materials, or the contractor's means and methods of determining constructability, pricing or schedule. This opinion of construction cost is based on the consultant's reasonable professional judgement and experience and does not constitute a warranty, expressed or implied, that contractor's bids or negotiated prices for the work will not vary from The costs have been developed based on historical and current data using in-house sources, information from previous studies as well as budget price quotations solicited from local suppliers and contractors.

A contingency amount has been included to cover undefined items, due to the level of engineering carried out at this time. The contingency is not a reflection of the accuracy of the estimates but covers items of work which will have to be performed, and elements of costs which will be incurred, but which are not explicitly detailed or described due to the level of investigation, engineering and estimating completed today.

5.E.b
Packet Pg. 628 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

M&N JOB ORDER NUMBER DATE PREPARED
10225-00 15-Nov-18

ITEM DESCRIPTION NUMBER UNIT UNIT COST SUBTOTAL TOTAL
General Requirements
Mobilization / Demobilization (including specialty equipment) 1 LS $282,920.75 $282,920.75 Supervision 1 LS $169,182.00 $169,182.00
Bonds, Insurance, Overhead and Profit 1 LS $317,216.25 $317,216.25 Site Survey / Construction Survey Crew 1 DAY $2,000.00 $2,000.00 Stand-By Allowance Due to Inclement Weather / Ocean Conditions 0 DAY $0.00 $0.00 General Requirements Subtotal $771,319
Construction Waste Management and Temporary Site BMP's
Waste Disposal & BMP's for Waterside Demolition 1 LS $75,000.00 $75,000.00 Ɣ&RQVWUXFWLRQ:DVWH0DQDJHPHQW 'LVSRVDO)HHV 1 LS $50,000.00 $50,000.00 Ɣ%03
V:DWHU3ROOXWLRQ&RQWURO(URVLRQ 6HGLPHQW&RQWURO 1 LS $5,000.00 $5,000.00 Ɣ7HPSRUDU\)HQFLQJ6LJQDJHDQG7UDIILF&RQWURO 1 LS $20,000.00 $20,000.00 Construction Waste Management Subtotal $75,000
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 1: Timber Pile Repairs
1 206 10 Timber Pile Repair (Moderate) 1 LS $288,400.00 $288,400.00 Ɣ6(&7,21/266255277,1*'$0$*(
Ɣ&OHDQDQG5HPRYH0DULQH*URZWK$URXQG([LVWLQJ3LOH 206 EA $400.00 $82,400.00 Ɣ,QVWDOOQHZ)LEHUJODVV:UDSSLQJ3LOH5HSDLU 2,060 LF $100.00 $206,000.00

1.1 181 2 Timber Pile Repair (Moderate) 1 LS $117,650.00 $117,650.00 Ɣ63/,77,1*'()(&7,9(+$5':$5($1'60$//92,'6
Ɣ&OHDQDQG5HPRYH0DULQH*URZWK$URXQG([LVWLQJ3LOH 181 EA $400.00 $72,400.00 Ɣ,QVWDOOQHZ*ODY6WHHO6WUDSV+DUGZDUHDQGRU)LOO9RLGVZLWK(SR[\ 181 EA $250.00 $45,250.00 Timber Pile Repairs (ZONE No. 1) Subtotal $406,050
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 1: Timber Pile Cap Repairs
2 13 10 Timber Pile Cap Repair (Moderate) 1 LS $52,000.00 $52,000.00 Ɣ5277,1*'$0$*( 6(&7,21/266
Ɣ3URYLGHWHPSRUDU\VKRULQJRISLOHFDSORFDWLRQWRIDFLOLWDWHLQVWDOODWLRQ 13 EA $1,000.00 $13,000.00 Ɣ'HPR ,QVWDOOQHZ7LPEHU3LOH&DS
['RXJ)LU
ZLWK6WHHO+DUGZDUH 130 LF $300.00 $39,000.00

2.1 97 2 Timber Pile Cap Repair (Moderate) 1 LS $63,050.00 $63,050.00 Ɣ63/,77,1*'()(&7,9(+$5':$5($1'60$//92,'6
Ɣ&OHDQDQG5HPRYH0DULQH*URZWK$URXQG([LVWLQJ&DS 97 EA $400.00 $38,800.00 Ɣ,QVWDOOQHZ*ODY6WHHO6WUDSV+DUGZDUHDQGRU)LOO9RLGVZLWK(SR[\ 97 EA $250.00 $24,250.00 Timber Pile Cap Repairs (ZONE No. 1) Subtotal $115,050
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 1: Timber Bracing Repairs
3 201 15 Timber Lateral/Transverse Brace Repair (Moderate) 1 LS $256,275.00 $256,275.00 Ɣ5277,1*'$0$*( 6(&7,21/266
Ɣ'HPR ,QVWDOOQHZ7LPEHU%UDFH
['RXJ)LU
ZLWK6WHHO+DUGZDUH 3,015 LF $85.00 $256,275.00

3.1 260 15 Timber Lateral/Transverse Brace Repair (Moderate) 1 LS $65,000.00 $65,000.00 Ɣ'()(&7,9(+$5':$5($1'60$//92,'6
Ɣ,QVWDOOQHZ*ODY6WHHO+DUGZDUHDQGRU)LOO9RLGVZLWK(SR[\ 260 EA $250.00 $65,000.00 Timber Bracing Repairs (ZONE No. 1) Subtotal $321,275
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 1: Steel Bracing Repairs

3.2 14 10 Steel Lateral/Transverse Brace Repair (Moderate) 1 LS $15,400.00 $15,400.00 Ɣ&25526,21'()(&7,9(+$5':$5($1'92,'6
Ɣ'HPR ,QVWDOOQHZ6WHHO7XEH%UDFH
'LDPHWHU
ZLWK6WHHO+DUGZDUH 140 LF $110.00 $15,400.00
Steel Bracing Repairs (ZONE No. 1) Subtotal $15,400
Item
No.

Total
(ea)
Repair
Area (ft) ZONE 1: Timber Stringer Repairs
4 1 17000 Timber Stringer Repair (Moderate) 1 LS $425,000.00 $425,000.00 Ɣ%52.(163/,77,1*$1'5277,1*'$0$*(
Ɣ'HPR ,QVWDOOQHZ7LPEHU6WULQJHUV
['RXJ)LU
ZLWK6WHHO6SLNHV 17,000 SF $25.00 $425,000.00
Timber Stringer Repairs (ZONE No. 1) Subtotal $425,000
Item
No.

Total
(ea)
Repair
Area (ft) ZONE 1: Timber Decking Repairs
5 1 60000 Timber Decking Repair (Moderate) 1 LS $600,000.00 $600,000.00 Ɣ%52.(163/,77,1*$1'&211(&7,21'$0$*(
Ɣ,QVWDOOQHZ7LPEHU'HFNLQJ
['RXJ)LU
ZLWK6WHHO6SLNHV 60,000 SF $10.00 $600,000.00
Timber Decking Repairs (ZONE No. 1) Subtotal $600,000
ZONE No. 1: Timber East-End Pier Segment Subtotal $1,882,775 ZONE 1: Timber East-End Pier Segment

OPINION OF PROBABLE COST (OPC) PREPARED BY PREPARED FOR PROJECT DESCRIPTION City of Santa Monica
Santa Monica Municipal Pier Inspection (Long-Term Repairs) Civil Engineering Division Recommended for Repair within 5-10 Years

PROJECT TITLE
Santa Monica Pier Infrastructure Assessment and Upgrades - Santa Monica, CA

QUANTITY TOTAL

5.E.b
Packet Pg. 629 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

M&N JOB ORDER NUMBER DATE PREPARED
10225-00 15-Nov-18

ITEM DESCRIPTION NUMBER UNIT UNIT COST SUBTOTAL TOTAL

OPINION OF PROBABLE COST (OPC) PREPARED BY PREPARED FOR PROJECT DESCRIPTION City of Santa Monica
Santa Monica Municipal Pier Inspection (Long-Term Repairs) Civil Engineering Division Recommended for Repair within 5-10 Years

PROJECT TITLE
Santa Monica Pier Infrastructure Assessment and Upgrades - Santa Monica, CA

QUANTITY TOTAL
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 2: Concrete Pile Repairs
6 32 5 Concrete Pile Repair (Moderate) 1 LS $96,000.00 $96,000.00 Ɣ&5$&.,1*(;326('5(%$5$1'5867%/(('6
Ɣ&OHDQDQG5HPRYH([FHVV0DWHULDODQG*URZWK$URXQG([LVWLQJ$UHD 32 EA $500.00 $16,000.00 Ɣ,QVWDOOQHZIRUPZRUNGRZHOUHEDUDQGJURXW5HSDLU 160 LF $500.00 $80,000.00 Concrete Pile Repairs (ZONE No. 2) Subtotal $96,000
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 2: Concrete Capital Repairs
7 4 5 Concrete Capital Repair (Moderate) 1 LS $12,000.00 $12,000.00 Ɣ&5$&.,1*(;326('5(%$5$1'5867%/(('6
Ɣ&OHDQDQG5HPRYH([FHVV0DWHULDODQG*URZWK$URXQG([LVWLQJ$UHD 4 EA $500.00 $2,000.00 Ɣ,QVWDOOQHZIRUPZRUNGRZHOUHEDUDQGJURXW5HSDLU 20 LF $500.00 $10,000.00 Concrete Capital Repairs (ZONE No. 2) Subtotal $12,000
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 2: Concrete Pile Cap Repairs
8 9 5 Concrete Pile Cap Repair (Moderate) 1 LS $27,000.00 $27,000.00 Ɣ&5$&.,1*(;326('5(%$5$1'5867%/(('6
Ɣ&OHDQDQG5HPRYH([FHVV0DWHULDODQG*URZWK$URXQG([LVWLQJ$UHD 9 EA $500.00 $4,500.00 Ɣ,QVWDOOQHZIRUPZRUNGRZHOUHEDUDQGJURXW5HSDLU 45 LF $500.00 $22,500.00 Concrete Pile Cap Repairs (ZONE No. 2) Subtotal $27,000 Item
No.

Total
(ea)
Repair
Area (ft) ZONE 2: Timber Stringer Repairs
9 0 0 Timber Stringer Repair (Moderate) 1 LS $0.00 $0.00 Ɣ127$33/,&$%/(
1$

Timber Stringer Repairs (ZONE No. 2) Subtotal $0
Item
No.

Total
(ea)
Repair
Area (ft) ZONE 2: Timber Decking Repairs
10 0 0 Timber Decking Repair (Moderate) 1 LS $0.00 $0.00 Ɣ127$33/,&$%/(
1$

Timber Decking Repairs (ZONE No. 2) Subtotal $0
ZONE No. 2: Concrete Amusement Structure Pier Segment Subtotal $135,000 Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 3: Concrete Pile Repairs
11 0 0 Concrete Pile Repair (Moderate) 1 LS $0.00 $0.00 Ɣ127$33/,&$%/(
1$

Concrete Pile Repairs (ZONE No. 3) Subtotal $0
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 3: Concrete Pile Cap Repairs
12 1 5 Concrete Pile Cap Repair (Moderate) 1 LS $3,000.00 $3,000.00 Ɣ&5$&.,1*(;326('5(%$5$1'5867%/(('6
Ɣ&OHDQDQG5HPRYH([FHVV0DWHULDODQG*URZWK$URXQG([LVWLQJ$UHD 1 EA $500.00 $500.00 Ɣ,QVWDOOQHZIRUPZRUNGRZHOUHEDUDQGJURXW5HSDLU 5 LF $500.00 $2,500.00 Concrete Pile Cap Repairs (ZONE No. 3) Subtotal $3,000
Item
No.

Total
(ea)
Repair
Area (ft) ZONE 3: Timber Stringer Repairs
13 0 0 Timber Stringer Repair (Moderate) 1 LS $0.00 $0.00 Ɣ127$33/,&$%/(
1$

Timber Stringer Repairs (ZONE No. 3) Subtotal $0
Item
No.

Total
(ea)
Repair
Area (ft) ZONE 3: Timber Decking Repairs
14 0 0 Timber Decking Repair (Moderate) 1 LS $0.00 $0.00 Ɣ127$33/,&$%/(
1$

Timber Decking Repairs (ZONE No. 3) Subtotal $0
ZONE 3: Concrete West-End Approach Pier Segment Subtotal $3,000 Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 4: Concrete Pile Repairs
15 2 5 Concrete Pile Repair (Moderate) 1 LS $10,000.00 $10,000.00 Ɣ&5$&.,1*(;326('5(%$5$1'5867%/(('6
Ɣ3URYLGHWHPSRUDU\VFDIIROGLQJWRIDFLOLWDWHLQVWDOODWLRQ 2 EA $2,000.00 $4,000.00 Ɣ&OHDQDQG5HPRYH([FHVV0DWHULDODQG*URZWK$URXQG([LVWLQJ$UHD 2 EA $500.00 $1,000.00 Ɣ,QVWDOOQHZIRUPZRUNGRZHOUHEDUDQGJURXW5HSDLU 10 LF $500.00 $5,000.00 Concrete Pile Repairs (ZONE No. 4) Subtotal $10,000
ZONE 2: Concrete Amusement Structure Pier Segment
ZONE 3: Concrete West-End Approach Pier Segment
ZONE 4: Concrete West-End Platform Pier Segment

5.E.b
Packet Pg. 630 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

M&N JOB ORDER NUMBER DATE PREPARED
10225-00 15-Nov-18

ITEM DESCRIPTION NUMBER UNIT UNIT COST SUBTOTAL TOTAL

OPINION OF PROBABLE COST (OPC) PREPARED BY PREPARED FOR PROJECT DESCRIPTION City of Santa Monica
Santa Monica Municipal Pier Inspection (Long-Term Repairs) Civil Engineering Division Recommended for Repair within 5-10 Years

PROJECT TITLE
Santa Monica Pier Infrastructure Assessment and Upgrades - Santa Monica, CA

QUANTITY TOTAL
Item
No.

Total
(ea)
Repair
Len. (ft) ZONE 4: Concrete Waffle Slab Repairs
16 1 5 Concrete Waffle Slab Repair (Moderate) 1 LS $5,000.00 $5,000.00 Ɣ&5$&.,1*(;326('5(%$5$1'5867%/(('6
Ɣ3URYLGHWHPSRUDU\VFDIIROGLQJWRIDFLOLWDWHLQVWDOODWLRQ 1 EA $2,000.00 $2,000.00 Ɣ&OHDQDQG5HPRYH([FHVV0DWHULDODQG*URZWK$URXQG([LVWLQJ$UHD 1 EA $500.00 $500.00 Ɣ,QVWDOOQHZIRUPZRUNGRZHOUHEDUDQGJURXW5HSDLU 5 LF $500.00 $2,500.00 Concrete Waffle Slab Repairs (ZONE No. 4) Subtotal $5,000 Item
No.

Total
(ea)
Repair
Area (ft) ZONE 4: Timber Sleeper Repairs
17 0 0 Timber Sleeper Repair (Moderate) 1 LS $0.00 $0.00 Ɣ127$33/,&$%/(
1$

Timber Sleeper Repairs (ZONE No. 4) Subtotal $0
Item
No.

Total
(ea)
Repair
Area (ft) ZONE 4: Timber Decking Repairs
18 1 200 Timber Decking Repair (Moderate) 1 LS $2,000.00 $2,000.00 Ɣ%52.(163/,77,1*$1'&211(&7,21'$0$*(
Ɣ,QVWDOOQHZ7LPEHU'HFNLQJ
['RXJ)LU
ZLWK6WHHO6SLNHV 200 SF $10.00 $2,000.00
Timber Decking Repairs (ZONE No. 4) Subtotal $2,000
ZONE 4: Concrete West-End Platform Pier Segment Subtotal $17,000 TOTAL CONSTRUCTION (BEFORE MARKUPS) $2,884,090
Project Contingencies
Construction Contingency 20.00% $576,818
Engineering, CA/CM & Permitting Fee (NOT INCLUDED) $0

20.00% subtotal $576,818
WATERSIDE IMPROVEMENTS TOTAL (WITH MARKUPS) $3,461,000
HIGH-END AND LOW-END OPC RANGE (CLASS 4 ESTIMATE)
Plus 30% 30.00% $1,038,000 $4,499,000
Minus 20% 20.00% $692,000 $2,769,000
Notes: Price based on inspection conducted between July -September of 2018 Price assumes a suitable laydown area is available on-site at no cost to the contractor Pricing is in US Dollars, 3rd quarter 2019, and based on locally available resources Price is based on unencumbered contractor access to the site and assumes contractor has access along pedestrian walkway for construction equipment Price does not include environmental restrictions and assumes No weather risk included (force majeure) Escalation expense is not included
Estimate class based on AACE No. 56R-08
Price does not consider associated costs due to hazardous waste. Treated timber, steel ,and plastic material is assumed to be accepted as "controlled waste" Owner's costs (engineering, project management, owners overhead, third party QA/QC, etc.) are not included When reviewing the above estimated costs it is important to note the following:
-
-
- This construction cost estimate is an 'Opinion of Probable Cost' made by a consultant. In providing opinions of construction cost, it is recognized that neither the client nor the consultant has control over the cost of labor, equipment, materials, or the contractor's means and methods of determining constructability, pricing or schedule. This opinion of construction cost is based on the consultant's reasonable professional judgement and experience and does not constitute a warranty, expressed or implied, that contractor's bids or negotiated prices for the work will not vary from The costs have been developed based on historical and current data using in-house sources, information from previous studies as well as budget price quotations solicited from local suppliers and contractors.

A contingency amount has been included to cover undefined items, due to the level of engineering carried out at this time. The contingency is not a reflection of the accuracy of the estimates but covers items of work which will have to be performed, and elements of costs which will be incurred, but which are not explicitly detailed or described due to the level of investigation, engineering and estimating completed today.

5.E.b
Packet Pg. 631 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier Upgrades (Area 14)
Recommended Upgrades for Area 14

M&N JOB ORDER NUMBER DATE PREPARED
10225-00 15-Nov-18

ITEM DESCRIPTION NUMBER UNIT UNIT COST SUBTOTAL TOTAL
General Requirements
Mobilization / Demobilization (including specialty equipment) 1 LS $122,140.00 $122,140.00 Supervision 1 LS $70,240.00 $70,240.00
Bonds, Insurance, Overhead and Profit 1 LS $131,700.00 $131,700.00 Site Survey / Construction Survey Crew 1 DAY $2,000.00 $2,000.00 Stand-By Allowance Due to Inclement Weather / Ocean Conditions 0 DAY $0.00 $0.00 General Requirements Subtotal $326,080
Construction Waste Management and Temporary Site BMP's
Waste Disposal & BMP's for Waterside Demolition 1 LS $40,000.00 $40,000.00 Ɣ&RQVWUXFWLRQ:DVWH0DQDJHPHQW 'LVSRVDO)HHV 1 LS $20,000.00 $20,000.00 Ɣ%03
V:DWHU3ROOXWLRQ&RQWURO(URVLRQ 6HGLPHQW&RQWURO 1 LS $5,000.00 $5,000.00 Ɣ7HPSRUDU\)HQFLQJ6LJQDJHDQG7UDIILF&RQWURO 1 LS $15,000.00 $15,000.00 Construction Waste Management Subtotal $40,000
Item No. Demolish Existing Structure
1 Remove and Demolish Existing Substructure and Superstructure 1 LS $102,500.00 $102,500.00 Ɣ'HPRWLPEHUSLOHVXEVWUXFWXUHDQGWLPEHUGHFNVXSHUVWUXFWXUH 4,100 SF $25.00 $102,500.00 Demolish Existing Structure Subtotal $102,500
Item No. Concrete Substructure
2 Furnish & Install Concrete Piles 1 LS $200,000.00 $200,000.00 Ɣ1HZ'LD&RQFUHWHSLOHV 1,000 LF $200.00 $200,000.00 3 Furnish & Install Concrete Caps and Struts 1 LS $225,000.00 $225,000.00 Ɣ1HZ&RQFUHWH&DSV
IW[IW
100 CY $1,500.00 $150,000.00
Ɣ1HZ&RQFUHWH6WUXWV
IW[IW
50 CY $1,500.00 $75,000.00
Concrete Substructure Subtotal $425,000
Item No. Timber Superstructure
4 Furnish & Install Timber Stringers 1 LS $102,500.00 $102,500.00 Ɣ,QVWDOOQHZ7LPEHU6WULQJHUV
['RXJ)LU
ZLWK6WHHO6SLNHV 4,100 SF $25.00 $102,500.00
5 Furnish & Install Timber Decking 1 LS $41,000.00 $41,000.00 Ɣ,QVWDOOQHZ7LPEHU'HFNLQJ
['RXJ)LU
ZLWK6WHHO6SLNHV 4,100 SF $10.00 $41,000.00
Timber Superstructure Subtotal $143,500
Item No. Appurtenances
6 Furnish & Install Steel Handrails 1 LS $45,000.00 $45,000.00 Ɣ,QVWDOOVWHHOKDQGUDLOIWKLJK0DWFKH[LVWLQJ 150 LF $300.00 $45,000.00 7 Furnish & Install Under Pier Catwalk System 1 LS $45,000.00 $45,000.00 Ɣ,QVWDOOWLPEHUFDWZDONEHORZGHFN
['RXJ)LU
150 LF $300.00 $45,000.00
8 Furnish & Install Pier Lighting 1 LS $25,000.00 $25,000.00 Ɣ,QVWDOOIWWDOOOLJKWSROHZLWKIL[WXUH 5 EA $5,000.00 $25,000.00 9 Furnish & Install Utilities 1 LS $50,000.00 $50,000.00 Ɣ,QVWDOOQHZXWLOLWLHV
DVVXPHUHSODFHLQNLQGRIH[LVWLQJ
1 LS $50,000.00 $50,000.00
Appurtenances Subtotal $165,000
Area 14: Upgrade to Concrete Substructure Subtotal $836,000 TOTAL CONSTRUCTION (BEFORE MARKUPS) $1,202,080
Project Contingencies
Construction Contingency 20.00% $240,416
Engineering, CA/CM & Permitting Fee (NOT INCLUDED) $0

20.00% subtotal $240,416
WATERSIDE IMPROVEMENTS TOTAL (WITH MARKUPS) $1,442,000
HIGH-END AND LOW-END OPC RANGE (CLASS 4 ESTIMATE)
Plus 30% 30.00% $433,000 $1,875,000
Minus 20% 20.00% $288,000 $1,154,000
Santa Monica Pier Infrastructure Assessment and Upgrades - Santa Monica, CA

PREPARED BY PREPARED FOR
City of Santa Monica
Civil Engineering Division

OPINION OF PROBABLE COST (OPC)

PROJECT DESCRIPTION

PROJECT TITLE
TOTAL
Area 14: Upgrade to Concrete Substructure

QUANTITY

5.E.b
Packet Pg. 632 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier Upgrades (Area 17)
Recommended Upgrades for Area 17

M&N JOB ORDER NUMBER DATE PREPARED
10225-00 15-Nov-18

ITEM DESCRIPTION NUMBER UNIT UNIT COST SUBTOTAL TOTAL
General Requirements
Mobilization / Demobilization (including specialty equipment) 1 LS $572,070.00 $572,070.00 Supervision 1 LS $347,120.00 $347,120.00
Bonds, Insurance, Overhead and Profit 1 LS $650,850.00 $650,850.00 Site Survey / Construction Survey Crew 1 DAY $2,000.00 $2,000.00 Stand-By Allowance Due to Inclement Weather / Ocean Conditions 0 DAY $0.00 $0.00 General Requirements Subtotal $1,572,040
Construction Waste Management and Temporary Site BMP's
Waste Disposal & BMP's for Waterside Demolition 1 LS $60,000.00 $60,000.00 Ɣ&RQVWUXFWLRQ:DVWH0DQDJHPHQW 'LVSRVDO)HHV 1 LS $40,000.00 $40,000.00 Ɣ%03
V:DWHU3ROOXWLRQ&RQWURO(URVLRQ 6HGLPHQW&RQWURO 1 LS $5,000.00 $5,000.00 Ɣ7HPSRUDU\)HQFLQJ6LJQDJHDQG7UDIILF&RQWURO 1 LS $15,000.00 $15,000.00 Construction Waste Management Subtotal $60,000
Item No. Demolish Existing Structure
1 Remove and Demolish Existing Substructure and Superstructure 1 LS $605,000.00 $605,000.00 Ɣ'HPRWLPEHUSLOHVXEVWUXFWXUHDQGWLPEHUGHFNVXSHUVWUXFWXUH 24,200 SF $25.00 $605,000.00 Demolish Existing Structure Subtotal $605,000
Item No. Concrete Substructure
2 Furnish & Install Concrete Piles 1 LS $900,000.00 $900,000.00 Ɣ1HZ'LD&RQFUHWHSLOHV 4,500 LF $200.00 $900,000.00 3 Furnish & Install Concrete Caps and Struts 1 LS $1,500,000.00 $1,500,000.00 Ɣ1HZ&RQFUHWH&DSV
IW[IW
550 CY $1,500.00 $825,000.00
Ɣ1HZ&RQFUHWH6WUXWV
IW[IW
450 CY $1,500.00 $675,000.00
Concrete Substructure Subtotal $2,400,000
Item No. Timber Superstructure
4 Furnish & Install Timber Stringers 1 LS $605,000.00 $605,000.00 Ɣ,QVWDOOQHZ7LPEHU6WULQJHUV
['RXJ)LU
ZLWK6WHHO6SLNHV 24,200 SF $25.00 $605,000.00
5 Furnish & Install Timber Decking 1 LS $242,000.00 $242,000.00 Ɣ,QVWDOOQHZ7LPEHU'HFNLQJ
['RXJ)LU
ZLWK6WHHO6SLNHV 24,200 SF $10.00 $242,000.00
Timber Superstructure Subtotal $847,000
Item No. Appurtenances
6 Furnish & Install Steel Handrails 1 LS $0.00 $0.00
Ɣ,QVWDOOVWHHOKDQGUDLOIWKLJK0DWFKH[LVWLQJ 0 LF $300.00 $0.00 7 Furnish & Install Under Pier Catwalk System 1 LS $225,000.00 $225,000.00 Ɣ,QVWDOOWLPEHUFDWZDONEHORZGHFN
['RXJ)LU
750 LF $300.00 $225,000.00
8 Furnish & Install Pier Lighting 1 LS $0.00 $0.00
Ɣ,QVWDOOIWWDOOOLJKWSROHZLWKIL[WXUH 0 EA $5,000.00 $0.00 9 Furnish & Install Utilities 1 LS $200,000.00 $200,000.00 Ɣ,QVWDOOQHZXWLOLWLHV
DVVXPHUHSODFHLQNLQGRIH[LVWLQJ
1 LS $200,000.00 $200,000.00
Appurtenances Subtotal $425,000
Area 17: Upgrade to Concrete Substructure Subtotal $4,277,000 TOTAL CONSTRUCTION (BEFORE MARKUPS) $5,909,040
Project Contingencies
Construction Contingency 20.00% $1,181,808
Engineering, CA/CM & Permitting Fee (NOT INCLUDED) $0

20.00% subtotal $1,181,808
WATERSIDE IMPROVEMENTS TOTAL (WITH MARKUPS) $7,091,000
HIGH-END AND LOW-END OPC RANGE (CLASS 4 ESTIMATE)
Plus 30% 30.00% $2,127,000 $9,218,000
Minus 20% 20.00% $1,418,000 $5,673,000

PROJECT TITLE
Santa Monica Pier Infrastructure Assessment and Upgrades - Santa Monica, CA

QUANTITY TOTAL
Area 17: Upgrade to Concrete Substructure

OPINION OF PROBABLE COST (OPC) PREPARED BY PREPARED FOR PROJECT DESCRIPTION City of Santa Monica
Civil Engineering Division

5.E.b
Packet Pg. 633 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier Upgrades (Deck Area Upgrades)
Recommended Upgrades for (Area 1-Area18 and Aquarium Roof)

M&N JOB ORDER NUMBER DATE PREPARED
10225-00 15-Nov-18

ITEM DESCRIPTION NUMBER UNIT UNIT COST SUBTOTAL TOTAL
General Requirements
Mobilization / Demobilization (including specialty equipment) 1 LS $569,335.00 $569,335.00 Supervision 1 LS $350,360.00 $350,360.00
Bonds, Insurance, Overhead and Profit 1 LS $656,925.00 $656,925.00 Site Survey / Construction Survey Crew 2 DAY $2,000.00 $4,000.00 Stand-By Allowance Due to Inclement Weather / Ocean Conditions 0 DAY $0.00 $0.00 General Requirements Subtotal $1,580,620
Construction Waste Management and Temporary Site BMP's
Waste Disposal & BMP's for Waterside Demolition 1 LS $80,000.00 $80,000.00 Ɣ&RQVWUXFWLRQ:DVWH0DQDJHPHQW 'LVSRVDO)HHV 1 LS $60,000.00 $60,000.00 Ɣ%03
V:DWHU3ROOXWLRQ&RQWURO(URVLRQ 6HGLPHQW&RQWURO 1 LS $5,000.00 $5,000.00 Ɣ7HPSRUDU\)HQFLQJ6LJQDJHDQG7UDIILF&RQWURO 1 LS $15,000.00 $15,000.00 Construction Waste Management Subtotal $80,000
Item No. Demolish Existing Structure
1 Remove and Demolish Existing Superstructure 1 LS $85,000.00 $85,000.00 Ɣ'HPRWLPEHUGHFNLQJRQO\ 8,500 SF $10.00 $85,000.00
Demolish Existing Structure Subtotal $85,000
Item No. Timber Superstructure
2 Furnish & Install Timber Stringers 1 LS $212,500.00 $212,500.00 Ɣ,QVWDOOQHZ7LPEHU6WULQJHUV
['RXJ)LU
ZLWK6WHHO6SLNHV 8,500 SF $25.00 $212,500.00
3 Furnish & Install Timber Decking 1 LS $85,000.00 $85,000.00 Ɣ,QVWDOOQHZ7LPEHU'HFNLQJ
['RXJ)LU
ZLWK6WHHO6SLNHV 8,500 SF $10.00 $85,000.00
Timber Superstructure Subtotal $297,500
Area 1: Deck Upgrade Subtotal $382,500
Area 2: To Be Completed As Part of Current Upgrade Design Project $0 Item No. Demolish Existing Structure
4 Remove and Demolish Existing Superstructure 1 LS $120,000.00 $120,000.00 Ɣ'HPRWLPEHUGHFNLQJDQGWLPEHUVWULQJHUV 6,000 SF $20.00 $120,000.00 Demolish Existing Structure Subtotal $120,000
Item No. Timber Superstructure
5 Furnish & Install Timber Stringers 1 LS $150,000.00 $150,000.00 Ɣ,QVWDOOQHZ7LPEHU6WULQJHUV
['RXJ)LU
ZLWK6WHHO6SLNHV 6,000 SF $25.00 $150,000.00
6 Furnish & Install Timber Decking 1 LS $60,000.00 $60,000.00 Ɣ,QVWDOOQHZ7LPEHU'HFNLQJ
['RXJ)LU
ZLWK6WHHO6SLNHV 6,000 SF $10.00 $60,000.00
Timber Superstructure Subtotal $210,000
Area 3: Deck Upgrade Subtotal $330,000
Area 4: Upgrade Not Recommended At This Time $0
Area 5: Upgrade Not Recommended At This Time $0
Area 6: Upgrade Not Recommended At This Time $0
Item No. Demolish Existing Structure
10 Remove and Demolish Existing Superstructure 1 LS $14,000.00 $14,000.00 Ɣ'HPRWLPEHUGHFNLQJRQO\ 1,400 SF $10.00 $14,000.00
Demolish Existing Structure Subtotal $14,000
Item No. Timber Superstructure
11 Furnish & Install Timber Stringers 1 LS $35,000.00 $35,000.00 Ɣ,QVWDOOQHZ7LPEHU6WULQJHUV
['RXJ)LU
ZLWK6WHHO6SLNHV 1,400 SF $25.00 $35,000.00
12 Furnish & Install Timber Decking 1 LS $14,000.00 $14,000.00 Ɣ,QVWDOOQHZ7LPEHU'HFNLQJ
['RXJ)LU
ZLWK6WHHO6SLNHV 1,400 SF $10.00 $14,000.00
Timber Superstructure Subtotal $49,000
Area 7: Deck Upgrade Subtotal $63,000
Item No. Demolish Existing Structure
13 Remove and Demolish Existing Superstructure 1 LS $40,000.00 $40,000.00 Ɣ'HPRWLPEHUGHFNLQJRQO\ 4,000 SF $10.00 $40,000.00

OPINION OF PROBABLE COST (OPC) PREPARED BY PREPARED FOR PROJECT DESCRIPTION City of Santa Monica
Civil Engineering Division

PROJECT TITLE
Santa Monica Pier Infrastructure Assessment and Upgrades - Santa Monica, CA

QUANTITY TOTAL
Area 1: Deck Upgrade
Area 2: Deck Upgrade
Area 3: Deck Upgrade
Area 4: Deck Upgrade
Area 5: Deck Upgrade
Area 6: Deck Upgrade
Area 7: Deck Upgrade
Area 8: Deck Upgrade

5.E.b
Packet Pg. 634 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier Upgrades (Deck Area Upgrades)
Recommended Upgrades for (Area 1-Area18 and Aquarium Roof)

M&N JOB ORDER NUMBER DATE PREPARED
10225-00 15-Nov-18

ITEM DESCRIPTION NUMBER UNIT UNIT COST SUBTOTAL TOTAL

OPINION OF PROBABLE COST (OPC) PREPARED BY PREPARED FOR PROJECT DESCRIPTION City of Santa Monica
Civil Engineering Division

PROJECT TITLE
Santa Monica Pier Infrastructure Assessment and Upgrades - Santa Monica, CA

QUANTITY TOTAL
Demolish Existing Structure Subtotal $40,000
Item No. Timber Superstructure
14 Furnish & Install Timber Stringers 1 LS $100,000.00 $100,000.00 Ɣ,QVWDOOQHZ7LPEHU6WULQJHUV
['RXJ)LU
ZLWK6WHHO6SLNHV 4,000 SF $25.00 $100,000.00
15 Furnish & Install Timber Decking 1 LS $40,000.00 $40,000.00 Ɣ,QVWDOOQHZ7LPEHU'HFNLQJ
['RXJ)LU
ZLWK6WHHO6SLNHV 4,000 SF $10.00 $40,000.00
Timber Superstructure Subtotal $140,000
Area 8: Deck Upgrade Subtotal $180,000
Area 9: Upgrade Not Recommended At This Time $0
Item No. Demolish Existing Structure
16 Remove and Demolish Existing Superstructure 1 LS $361,000.00 $361,000.00 Ɣ'HPRWLPEHUGHFNLQJRQO\ 36,100 SF $10.00 $361,000.00 Demolish Existing Structure Subtotal $361,000
Item No. Timber Superstructure
17 Furnish & Install Timber Stringers 1 LS $902,500.00 $902,500.00 Ɣ,QVWDOOQHZ7LPEHU6WULQJHUV
['RXJ)LU
ZLWK6WHHO6SLNHV 36,100 SF $25.00 $902,500.00
18 Furnish & Install Timber Decking 1 LS $361,000.00 $361,000.00 Ɣ,QVWDOOQHZ7LPEHU'HFNLQJ
['RXJ)LU
ZLWK6WHHO6SLNHV 36,100 SF $10.00 $361,000.00
Timber Superstructure Subtotal $1,263,500
Area 10: Deck Upgrade Subtotal $1,624,500
Area 11: Upgrade Not Recommended At This Time $0
Item No. Demolish Existing Structure
19 Remove and Demolish Existing Superstructure 1 LS $270,000.00 $270,000.00 Ɣ'HPRWLPEHUGHFNLQJDQGWLPEHUVWULQJHUV 13,500 SF $20.00 $270,000.00 Demolish Existing Structure Subtotal $270,000
Item No. Timber Superstructure
20 Furnish & Install Timber Stringers 1 LS $337,500.00 $337,500.00 Ɣ,QVWDOOQHZ7LPEHU6WULQJHUV
['RXJ)LU
ZLWK6WHHO6SLNHV 13,500 SF $25.00 $337,500.00
21 Furnish & Install Timber Decking 1 LS $135,000.00 $135,000.00 Ɣ,QVWDOOQHZ7LPEHU'HFNLQJ
['RXJ)LU
ZLWK6WHHO6SLNHV 13,500 SF $10.00 $135,000.00
Timber Superstructure Subtotal $472,500
Area 12: Deck Upgrade Subtotal $742,500
Area 13: Upgrade Not Recommended At This Time $0
Area 14: Refer to Attached Area 14 Concrete Substructure Upgrade $0 Item No. Demolish Existing Structure
22 Remove and Demolish Existing Superstructure 1 LS $96,000.00 $96,000.00 Ɣ'HPRWLPEHUGHFNLQJDQGWLPEHUVWULQJHUV 4,800 SF $20.00 $96,000.00 Demolish Existing Structure Subtotal $96,000
Item No. Timber Superstructure
23 Furnish & Install Timber Stringers 1 LS $120,000.00 $120,000.00 Ɣ,QVWDOOQHZ7LPEHU6WULQJHUV
['RXJ)LU
ZLWK6WHHO6SLNHV 4,800 SF $25.00 $120,000.00
24 Furnish & Install Timber Decking 1 LS $48,000.00 $48,000.00 Ɣ,QVWDOOQHZ7LPEHU'HFNLQJ
['RXJ)LU
ZLWK6WHHO6SLNHV 4,800 SF $10.00 $48,000.00
Timber Superstructure Subtotal $168,000
Area 15: Deck Upgrade Subtotal $264,000
Item No. Demolish Existing Structure
25 Remove and Demolish Existing Superstructure 1 LS $107,000.00 $107,000.00 Ɣ'HPRWLPEHUGHFNLQJRQO\ 10,700 SF $10.00 $107,000.00 Demolish Existing Structure Subtotal $107,000
Item No. Timber Superstructure
26 Furnish & Install Timber Stringers 1 LS $267,500.00 $267,500.00 Ɣ,QVWDOOQHZ7LPEHU6WULQJHUV
['RXJ)LU
ZLWK6WHHO6SLNHV 10,700 SF $25.00 $267,500.00
27 Furnish & Install Timber Decking 1 LS $107,000.00 $107,000.00 Ɣ,QVWDOOQHZ7LPEHU'HFNLQJ
['RXJ)LU
ZLWK6WHHO6SLNHV 10,700 SF $10.00 $107,000.00
Timber Superstructure Subtotal $374,500
Area 16: Deck Upgrade Subtotal $481,500
Area 9: Deck Upgrade
Area 10: Deck Upgrade
Area 11: Deck Upgrade
Area 12: Deck Upgrade
Area 13: Deck Upgrade
Area 14: Deck Upgrade
Area 15: Deck Upgrade
Area 16: Deck Upgrade

5.E.b
Packet Pg. 635 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier Upgrades (Deck Area Upgrades)
Recommended Upgrades for (Area 1-Area18 and Aquarium Roof)

M&N JOB ORDER NUMBER DATE PREPARED
10225-00 15-Nov-18

ITEM DESCRIPTION NUMBER UNIT UNIT COST SUBTOTAL TOTAL

OPINION OF PROBABLE COST (OPC) PREPARED BY PREPARED FOR PROJECT DESCRIPTION City of Santa Monica
Civil Engineering Division

PROJECT TITLE
Santa Monica Pier Infrastructure Assessment and Upgrades - Santa Monica, CA

QUANTITY TOTAL
Area 17: Refer to Attached Area 17 Concrete Substructure Upgrade $0 Area 18: Upgrade Not Recommended At This Time $0
Item No. Demolish Existing Structure
28 Remove and Demolish Existing Superstructure 1 LS $70,000.00 $70,000.00 Ɣ'HPRWLPEHUGHFNLQJDQGZDWHUSURRILQJ 3,500 SF $20.00 $70,000.00 Demolish Existing Structure Subtotal $70,000
Item No. Timber Superstructure
29 Furnish & Install Timber Stringers 1 LS $87,500.00 $87,500.00 Ɣ,QVWDOOQHZ7LPEHU6WULQJHUV
['RXJ)LU
ZLWK6WHHO6SLNHV 3,500 SF $25.00 $87,500.00
30 Furnish & Install Sheathing and Waterproofing 1 LS $35,000.00 $35,000.00 Ɣ,QVWDOOQHZ7LPEHU6KHDWKLQJ

SO\ZRRG
ZLWKZDWHUSURRILQJ 3,500 SF $10.00 $35,000.00
31 Furnish & Install Timber Decking 1 LS $35,000.00 $35,000.00 Ɣ,QVWDOOQHZ7LPEHU'HFNLQJ
['RXJ)LU
ZLWK6WHHO6SLNHV 3,500 SF $10.00 $35,000.00
Timber Superstructure Subtotal $157,500
Aquarium Roof Area: Deck Upgrade Subtotal $227,500
Municipal Pier Phase 4 Area: Upgrade Not Recommended At This Time $0 Concrete Waffle Slab Area: To Be Completed As Part of Current Upgrade Design Project $0 TOTAL CONSTRUCTION (BEFORE MARKUPS) $5,956,120
Project Contingencies
Construction Contingency 20.00% $1,191,224
Engineering, CA/CM & Permitting Fee (NOT INCLUDED) $0

20.00% subtotal $1,191,224
WATERSIDE IMPROVEMENTS TOTAL (WITH MARKUPS) $7,147,000
HIGH-END AND LOW-END OPC RANGE (CLASS 4 ESTIMATE)
Plus 30% 30.00% $2,144,000 $9,291,000
Minus 20% 20.00% $1,429,000 $5,718,000
Aquarium Room Area: Deck Upgrade
Municipal Pier Phase 4 Area: Deck Upgrade
Concrete Waffle Slab Area: Deck Upgrade
Area 17: Deck Upgrade
Area 18: Deck Upgrade

5.E.b
Packet Pg. 636 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225
Appendix D:

Pier Load Rating Figures

5.E.b
Packet Pg. 637 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier $5($
$48$5Ζ80
522)
$5($
$5($
$5($ $5($
$5($ $5($
$5($
$5($
&21&5(7(:$))/(6/$% 081Ζ&Ζ3$/3Ζ(53+$6(
$5($
$5($
$5($ $5($
$5($
$5($

$5($

$5($
SVI
7RQ9HKLFOH

$5($
SVI
7RQ9HKLFOH

$5($
SVI
7RQ9HKLFOH
$5($
SVI
5HJXODUO\

7RQ9HKLFOH
2FFDVLRQDOO\

7RQ9HKLFOH
$5($
SVI
7RQ9HKLFOH
$5($
SVI
5HJXODUO\

7RQ9HKLFOH
2FFDVLRQDOO\

7RQ9HKLFOH

$5($
SVI
7RQ9HKLFOH

$5($
SVI
7RQ9HKLFOH

$5($
SVI
7RQ9HKLFOH
$5($
SVI

7RQ9HKLFOH

$5($
SVI
7RQ9HKLFOH

$5($
SVI

7RQ9HKLFOH
$5($

SVI
5HJXODUO\

7RQ9HKLFOH
2FFDVLRQDOO\

7RQ9HKLFOH

$5($
SVI
7RQ9HKLFOH
$5($
SVI
7RQ9HKLFOH

$5($
SVI
7RQ9HKLFOH

$5($
SVI
7RQ9HKLFOH
$5($
SVI
5HJXODUO\

7RQ9HKLFOH
2FFDVLRQDOO\

7RQ9HKLFOH

$48$5Ζ80522)

SVI
7RQ9HKLFOH
081Ζ&Ζ3$/3Ζ(53+$6(
SVI
5HJXODUO\
7RQ9HKLFOH
2FFDVLRQDOO\
7RQ9HKLFOH

&RQFUHWH:DIIOH6ODE

7%'SVI
7%'7RQ9HKLFOH
3Ζ(5Ζ1)5$6758&785(/2$'5$7Ζ1*
$5($
$5($

7KH&LW\RI6DQWD0RQLFDKDVFRQWUDFWHG0 1WRSHUIRUPHQJLQHHULQJVHUYLFHVWRSURYLGHGHVLJQVIRUXSJUDGHVWRWKLVDUHDWRDFFRPPRGDWH+9HKLFOH/RDGLQJUHJXODUO\DQG+9HKLFOHORDGLQJRFFDVLRQDOO\ 2QFHWKLVSURMHFWLVFRPSOHWHGWKLVWDEOHFDQEHXSGDWHG

ΖWLVUHFRPPHQGHGGHVLJQVIRUXSJUDGHVWRWKLVDUHDEHSHUIRUPHGWRDFFRPPRGDWH+9HKLFOHORDGLQJUHJXODUO\DQG+9HKLFOHORDGLQJRFFDVLRQDOO\2QFHWKHVHFDSLWDOLPSURYHPHQWSURMHFWVFDQEH FRPSOHWHGWKLVWDEOHFDQEHXSGDWHG

ΖWLVUHFRPPHQGHGGHVLJQVIRUXSJUDGHVWRWKLVDUHDEHSHUIRUPHGWRDFFRPPRGDWHPDLQWHQDQFHYHKLFOHVSHGHVWULDQDFFHVVDQGRUHTXLSPHQWVWRUDJH2QFHWKHVHFDSLWDOLPSURYHPHQWSURMHFWVFDQEH FRPSOHWHGWKLVWDEOHFDQEHXSGDWHG
5HSUHVHQWVDUHDWKDWFXUUHQWO\PHHWVYHKLFOH
DFFHVVORDGUDWLQJIRU+
UHJXODUO\
DQG
+
RFFDVLRQDOO\

/(*(1'
   (
)HHW

5.E.b
structure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225
Appendix E:

Pier Condition Element Ratings and Identified Defects

5.E.b
Packet Pg. 639 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

PILE ID COMMENTS
BENT NO. / ROW NO. ND MN MD MJ SV

11.5q X 100% section loss

12.5h X Missing top connection

22.5a.5 X Not connected

22.5c X Not connected
28c.3 X No connection
28d.5 X Not connected
28x X 25% section loss
29c.5 X Not connected
29d.5 X Not connected
29j.8 X Not connected
30c.5 X Not connected
31aa.8 X Section loss
31k X Not connected
33k X Connection
3k X 50% end bearing, 50-75% section loss
47i.7 NE X Section loss, Minor Fungal rot
7c X Dry rot and splitting
7h X Fungal rot greater than 50%
TOTAL = N/A N/A N/A N/A 18

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY

PILE CONDITION RATING
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 1 - Timber Piles (Severe)
Not IncludedNot IncludedNot IncludedNot Included

5.E.b
Packet Pg. 640 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

PILE ID COMMENTS
BENT NO. / ROW NO. ND MN MD MJ SV
12q X Dry rot, 25% section loss
13j X Fungal rot
14aa X Fungal rot
14f X >1/2" split full length
14o X Splitting
15aa X Out of plumb, fungal rot, 50%end bearing
15l X >1/2"split, 50% end bearing
15m X Fungal rot and splitting
15t X 50%end bearing, splitting
16aa X 1" split at top
16z X Dry rot
17aa X Dry rot
17h X Split
17i X Split
17s X Dry rot
17t X Fungal rot
17v X Fungal rot
17y X Splitting
18r X Dry rot
18t X Dry rot
18x X Dry rot
18z X Dry rot
19ab X Dry rot
19g X 50% end bearing, major split at top
19h X Splitting at top, 50% end bearing
19i X 50% end bearing, major splitting at top
19m X Major split at top, minor dry rot
19v X Dry rot, minor splitting
20k X Splitting
21j X Split middle
22g X Dry rot
23h X Splitting
23p X Dry rot
23u X Splitting
24ab X Splitting, fungal rot
24p X Splitting
24t X Splitting
24z X Splitting
25f X Splitting , dry rot
25L X Splitting
25p X Splitting, dry rot
26c X Splitting
26g X Splitting , dry rot
26y X Splitting, dry rot

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 1 - Timber Piles (Major)

PILE CONDITION RATING
Not IncludedNot IncludedNot IncludedNot Included

5.E.b
Packet Pg. 641 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

PILE ID COMMENTS
BENT NO. / ROW NO. ND MN MD MJ SV

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 1 - Timber Piles (Major)

PILE CONDITION RATING
27s X Dry rot
28a X Dry rot at top
28v X Dry rot
29aa X Splitting, minor dry rot
29d X Dry rot, splitting
29f X Splitting, minor Dry rot
29l X Splitting, epoxy coming off, minor dry rot

3.2q X 25% section loss
4d X 1 inch crack full length
30aa X Splitting, minor dry rot
32e X Fungal rot and splits
32g X Dry rot
32u X Fungal rot
33aa X Dry rot and splits
33o X Split
33q X Fungal rot
33y X Dry rot and splits
35t X Section loss
36m X Fungal rot and splits
37j X Dry rot / 25% section loss
38K X Splitting, dry rot
39b X Dry rot/ 1inch splits
39e X Dry rot
39f X Dry rot/ splits
40b X Dry rot
41K X Splitting, minor dry rot
46f X Jacket is gone, section loss
48i X Section loss and splintering
4y X Dry rot, 50% section loss
6m X 2/4"ƐƉůŝƚĨƵůůůĞŶŐƚŚ͕ϮϱйƐĞĐƚŝŽŶůŽƐƐ
6o X Dry rot
7p X >1/2"ƐƉůŝƚĨƵůůůĞŶŐƚŚ
7w X Fungal rot

11.5c X 1"ƐƉůŝƚƚŽƉĞŶĚ

7.5j X 3/4"ƐƉůŝƚĨƵůůůĞŶŐƚŚ

8.5f X Square, 3/4"ƐƉůŝƚĨƵůůůĞŶŐƚŚ

8.5e X 3/4"ƐƉůŝƚĨƵůůůĞŶŐƚŚ͕ƐƋƵĂƌĞ͕ϱϬй
ĞŶĚbearing

7.5d.5 X 25% section loss

8.1d X 3/4"ƐƉůŝƚĨƵůůůĞŶŐƚŚ͕ϱϬйĞŶĚďĞĂƌŝŶŐ͕
dry rot

7.5k X Dry rot and splitting

7.5l X Split in half, 50% end bearing

6.5f X Cut out section of pile at top, dry rot

22.8d X Splitting
TOTAL = N/A N/A N/A 87 N/A Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 642 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

PILE ID COMMENTS
BENT NO. / ROW NO. ND MN MD MJ SV
10n X 15% section loss
10o X 15% section loss
10p X 15% section loss
10q X Dry rot
10w X 1/2"ĐƌĂĐŬĨƵůůŚĞŝŐŚƚ
11a X Fungal decay
11d X Fungal decay
11g X Dry rot
11j X Fungal rot
11n X 15% section loss, dry rot
11p X 15% section loss
11q X 1/2"ĨƵůůůĞŶŐƚŚƐƉůŝƚ
11t X Dry rot
11x X 1"ƐƉŝůƚƚŽƉ
11y X 1/2"ĐƌĂĐŬƐĂƚƚŽƉ
11z X Dry rot
12ab X Dry rot
12e X Dry rot
12g X Dry rot
12j X Dry rot
12v X Dry rot, 1/2"ƐƉůŝƚƐ
13a X 1/2"ƐƉůŝƚĨƵůůůĞŶŐƚŚ
13aa X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
13ab X Dry rot, splitting
13i X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
13k X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
13l X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
13n X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
13p X 25% section loss
13q X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
13t X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ͕ŽƵƚŽĨƉůƵŵď
14a X Split
14b X Split, 50% end bearing
14g X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
14i X Section loss
14l X Split
14s X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
14v X Splitting
14w X Split, out of plumb
14x X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ͕ĚƌLJƌŽƚ
15ab X Dry rot and splitting
15c X Split at top
15d X Fungal rot
15K X
15m X 4 steel wraps, splits, epoxy to fill?
15q X 50% end bearing, splitting

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 1 - Timber Piles (Moderate)

PILE CONDITION RATING
Not IncludedNot IncludedNot IncludedNot Included

5.E.b
Packet Pg. 643 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

PILE ID COMMENTS
BENT NO. / ROW NO. ND MN MD MJ SV

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 1 - Timber Piles (Moderate)

PILE CONDITION RATING
15r X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
15s X Splitting
15z X Split
16b X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
16i X Dry rot
16K X Dry rot
16N X Dry rot
16p X Dry rot
16s X 1ΗƐƉůŝƚĂƚƚŽƉ
16u X Dry rot
16v X Dry rot
16x X Dry rot
17b X Section loss and splitting
17c X Splitting
17f X Split
17M X Split
17n X Splitting
17o X Dry rot, splitting
17p X Section loss
17q X Dry rot and splitting
17x X Dry rot
17z X Splitting
18c X Dry rot w/ 5% section loss
18f X Splits
18g X ϭͬϮΗƐƉůŝƚĂƚƚŽƉ
18j X Dry rot
18k X Dry rot
18l X Dry rot
18o X
18q X Dry rot
18u X 10% section loss
18w X Dry rot
18y X Dry rot
19a X Splitting
19aa X Splitting
19b X Splitting, minor dry rot
19d X Splitting and dry rot
19j X Splitting, 2 metal small wraps, 50% end
bearing
19k X Dry rot, minor splitting
19n X Dry rot
19o X Split
19O X Splitting
19q X Fungal rot, minor splitting
19r X Splitting, minor dry rot
19s X Dry rot Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 644 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

PILE ID COMMENTS
BENT NO. / ROW NO. ND MN MD MJ SV

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 1 - Timber Piles (Moderate)

PILE CONDITION RATING
19t X Dry rot
19u X Splitting
1m
X 1"ǀŽŝĚĂƉƉƌŽdžŝŵĂƚĞůLJϭĨƚĨƌŽŵďŽƚƚŽŵ
20aa X Dry rot, minor splitting
20c X Dry rot
20d X Dry rot
20g X Splitting
20h X Splitting
20j X Splitting
20l X Splitting, minor dry rot
20N X Splitting
20p X Splitting, fungal rot
20r X Dry rot, fungal rot
20t X Minor Splitting, moderate dry rot
20u X Splitting, dry rot
21a X Dry rot
21aa X Dry rot
21b X Split at top
21e X Dry rot
21h X Dry rot
22ab X Splitting
22o X
22p X Dry rot
22q X Dry rot
22v X Dry rot
22w X Dry rot
22x X
22z X Split
23d X Splitting
23i X Splitting
23K X Splitting, minor Dry rot
23l X Splitting
23m X Splitting
23o X Splitting
23s X Splitting, dry rot
23v X Splitting, dry rot
23w X Splitting
23x X Dry rot, minor splitting
23y X Dry rot, splitting
24d X Splitting, minor Fungal rot
24e X Splitting
24i X Section loss
24k X Splitting
24m X Splitting
24o X Dry rot, splitting Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 645 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

PILE ID COMMENTS
BENT NO. / ROW NO. ND MN MD MJ SV

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 1 - Timber Piles (Moderate)

PILE CONDITION RATING
24q X Splitting
24w X Splitting
24y X Minor Splitting, moderate dry rot
25a X Splitting
25aa X Splitting, dry rot
25b X Dry rot, splitting
25g X Splitting , minor dry rot
25i X Splitting, dry rot
25k X Splitting
25K X Fungal rot
25q X Splitting
25t X Splitting, fungal rot
25w X Dry rot, minor Splitting
26e X Splitting, 50% end bearing
26i X Splitting, dry rot
26j X Splitting, dry rot
26K X Splitting, minor dry rot
26l X Splitting
26n X Splitting
26o X Splitting, dry rot
26p X Splitting, dry rot
26q X Splitting
26s X Splitting
26t X Splitting, dry rot
26x X Splitting
26z X Splitting
27ab X Dry rot
27h X Split at top
27i X Fungal rot
27k X Dry rot
27M X 5% section loss
27n X Dry rot
27N X 5% section loss
27O X Dry rot
27x X Splitting
28aa X Splitting
28ab X Dry rot
28d X Full length split
28g X Thru holes
28i X Dry rot
28m X Splits
28M X 10% section loss
28N X
28p X Dry rot
28s X Dry rot
28y X Dry rot Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 646 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

PILE ID COMMENTS
BENT NO. / ROW NO. ND MN MD MJ SV

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 1 - Timber Piles (Moderate)

PILE CONDITION RATING
28z X Dry rot
29c X Splitting, Wet at top, dry rot
29g X Splitting, minor dry rot
29k X Splitting, dry rot
29N X Splitting, dry rot
29O X Splitting, dry rot
29a X Splitting, treated with some epoxy
29r X Splitting, minor Dry rot
29t X Splitting, minor dry rot
29u X Splitting, dry rot
29x X Splitting, warped, dry rot

3.2b X 1/2 inch crack full length

3.2h X 1/2 inch crack full length

3.2n X 1/2 inch crack full height, out of plumb 5-
10 degrees
4b X 1/2 inch crack full length
30ab X Splitting, minor Dry rot
30q X Out of plumb, splitting, minor dry rot
30v X Splitting, minor dry rot
30y X Jacketed, splitting, minor dry rot
31q X Splitting
32a X Split
32d X Splits
32l X Split
32L X Split
32q X Fungal rot and splits
32r X Split
32t X Splits
32z X Splits and dry rot
33ab X Splits
33c X Fungal rot and splits
33j X Split
33l X Fungal rot and splits
33N X Dry rot
33p X Dry rot and splits
34i X Splitting
34j X Splitting
34L X Section loss
34z X Dry rot, minor splitting

35.5b X Dry rot

35.5l X Splitting
35K X Splitting, minor dry rot, wet
35l X Fungal rot
35m X Fungal rot, minor Splitting
35n X Fungal rot, splitting
35q X Fungal rot Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 647 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

PILE ID COMMENTS
BENT NO. / ROW NO. ND MN MD MJ SV

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 1 - Timber Piles (Moderate)

PILE CONDITION RATING
35v X Splitting
36c X Fungal rot and splits
36j X Fungal rot and splits
36K X Splitting
36M X Split
36N X Dry rot
37a X Dry rot
37b X Dry rot
37c X Splits and corrosion
37e X Splits
37f X Dry rot
37g X Dry rot
37h X Dry rot
37i X Full length splits
37k X Splits
37l X Dry rot
37L X Full length splits
37m X Dry rot
37M X Full length splits / 10% section loss
37O X Dry rot
38b X Dry rot / splits
38c X Dry rot/ 5% section loss
38e X Dry rot / 5% section loss
38f X Dry rot
38i X Dry rot and splits
38k X Dry rot/ blocking at bracing
38l X Dry rot
38M X 10% section loss / connection corrosion
38n X Splits and dry rot
38N X 10% section loss / splits
38O X Full length splits
39a X Dry rot and splits
39c X Dry rot
39d X Dry rot
39g X Dry rot
39h X Dry rot
39i X Dry rot
39L X Dry rot
39m X Dry rot
39M X Splits and 10% section loss
39n X Dry rot
39N X Dry rot / 5% section loss
39O X Dry rot Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 648 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

PILE ID COMMENTS
BENT NO. / ROW NO. ND MN MD MJ SV

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 1 - Timber Piles (Moderate)

PILE CONDITION RATING
3i
X
50% end bearing, but may not be
supporting any load, 1/2 inch crack full
height
40c X Dry rot
40d X Dry rot / 10% section loss
40e X Dry rot
40f X Dry rot
40h X Dry rot / 15% section loss
40i X Dry rot
40j X Dry rot
40K X Splitting
40n X Dry rot/ splits
41g X Dry rot
41h X Dry rot
42c X Fungal rot
42e X Splits at bottom
42f X Dry rot
43e X Jacketed below sand, splitting
44b X Jacketed, section loss greater than 1/2"
minor splitting
47c
X Jacketed, section loss, fungal rot, splitting
46j X Fiberglass wrap on top of jacket, splitting,
minor fungal rot
46e X Jacketed high, fungal rot
47m X No jacket, section loss, fungal rot
48j X Splintering under jacket and fungal rot
49e X Wrap missing / 10% section loss
49k X Fungal rot / corrosion at hardware
4u X Dry rot 10% section loss
4w X Dry rot 5% section loss
50c X 1-2 inch scour / Fungal rot / corrosion at
hardware
50e X Previous repair/ corrosion at hardware /
fungal rot
50g X Section loss 10% / Fungal rot / corrosion
at hardware
50i X Fungal rot / corrosion at hardware / loose
wrap
50j X Fungal rot / corrosion at hardware major
50m X Fungal rot / corrosion at hardware, major
51b X Wrap tear/ Fungal rot / corrosion at
hardware
Not IncludedNot IncludedNot IncludedNot Included

5.E.b
Packet Pg. 649 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

PILE ID COMMENTS
BENT NO. / ROW NO. ND MN MD MJ SV

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 1 - Timber Piles (Moderate)

PILE CONDITION RATING
51e
X Fungal rot / corrosion at hardware, major
51g
X Fungal rot / corrosion at hardware, major
51h X Fungal rot / corrosion at hardware, major
51i X Fungal rot / corrosion at hardware,
moderate
52a X Fungal rot / corrosion at hardware, major
52b X Fungal rot / corrosion at hardware, major
52e X New hardware on wrap/ Fungal rot /
corrosion at hardware, major
52f X Fungal rot / corrosion at hardware,
severe
52h X Fungal rot / corrosion at hardware, major
52l X Fungal rot / corrosion at hardware, major
52m X Fungal rot / corrosion at hardware, major
52n X Fungal rot / corrosion at hardware, major
53b X Fungal rot / corrosion at hardware, major
53e X Fungal rot / corrosion at hardware, major
53g X Fungal rot / corrosion at hardware, major
53h
X Loose wrap, missing hardware / Fungal
rot / corrosion at hardware, major
53k X Missing hardware at wrap / Fungal rot /
corrosion at hardware
53l X Fungal rot / corrosion at hardware, major
53m X Fungal rot / corrosion at hardware, major
53n X Fungal rot / corrosion at hardware, major
6d X Minor dry rot, 1/4"ƐƉůŝƚ
6f X 50% end bearing, dry rot, 1/2"ƐƉůŝƚĨƵůů
length
6g X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
6n X Dry rot, 50% end bearing Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 650 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

PILE ID COMMENTS
BENT NO. / ROW NO. ND MN MD MJ SV

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 1 - Timber Piles (Moderate)

PILE CONDITION RATING
6r X
6s X 1/2"ƐƉůŝƚĂƚƚŽƉ͕ďĂŶĚĞĚ
6u X Dry rot
6y X 1/2"ƐƉůŝƚ͕ĚƌLJƌŽƚ
7b X 1/2"ƐƉůŝƚĨƵůůůĞŶŐƚŚ
7e X Dry rot, 59% end bearing
7r X Dry rot
7s X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
7t X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
7y X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
8ab X
8s X
8x X Fungal rot
9i X Dry rot
9K X
9r X Dry rot
9s X Dry rot
9u X Dry rot
9v X Dry rot
9z X Dry rot
37f.5 X Dry rot

7.5i X Square, 50% end bearing, >1/2"ƐƉůŝƚĨƵůů
length

7.5h X Square, 1/2"ƐƉůŝƚĨƵůůůĞŶŐƚŚ

7.5f X 1/2"ƐƉůŝƚĨƵůůůĞŶŐƚŚ͕ƐƋƵĂƌĞ

8.5g X Square, 1/2"ƐƉůŝƚϭͬϮůĞŶŐƚŚƚǁŽƐŝĚĞƐ
32l.9 X Dry rot and splits

51.7h X Fungal rot / corrosion at hardware, major
52d.5 X Fungal rot / corrosion at hardware,
moderate
28j.5 X
8aa.1 X Dry rot
30L.8 X Splitting, minor dry rot

11.5p X 1/2"ƐƉůŝƚƐĂƚƚŽƉ

11.5o X Fungal rot at top
8N.8 X Dry rot
8L.9 X Dry rot
8K.5 X Dry rot

8.1f X 1/2"ƐƉůŝƚĨƵůůůĞŶŐƚŚ

8.1j X 15% section loss

6.1e.1 X Dry rot

4.5u X 1/2 inch crack full length
7c.1
X 1/2"ƐƉůŝƚĨƵůůůĞŶŐƚŚ͕ϱϬйĞŶĚďĞĂƌŝŶŐ
Not IncludedNot IncludedNot IncludedNot Included

5.E.b
Packet Pg. 651 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

PILE ID COMMENTS
BENT NO. / ROW NO. ND MN MD MJ SV

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 1 - Timber Piles (Moderate)

PILE CONDITION RATING
8c.1 X Splitting all the way around

51.7i X Loose wrap / Fungal rot / corrosion at
hardware, major

51.9k X Fungal rot / corrosion at hardware, major

50.9j X Fungal rot / corrosion at hardware, major

50.9l X

50.9m X Fungal rot / corrosion at hardware, major
29u.2 X Splitting, dry rot

23.8b X Splitting
2j.3 X 1/2 inch crack full height

2.8j.3 X 1/2 inch crack full height

2.8k.3 X 1/2 inch crack full height

2.8m.3 X 3/4 inch crack full length

2.6n.7 X 1/2 inch crack full height
52c.8 X Fungal rot / corrosion at hardware, major
47g.7 SW X No jacket, section loss, fungal rot
3c X 1/2 inch crack full length
3d2 X 1/2 inch crack full length, 15% section
loss

3.5c X 50% end bearing

4.2e X Fungal rot, 1/2 inch crack full length
TOTAL = N/A N/A 387 N/A N/A Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 652 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV
41K 41O X Split in half
38K 38N X Split in half
37K 37O X Split in half
36K 36M X Split in half
31K 31O X Splitting
29K 29O X Splitting
30K 30O X Splitting
TOTAL = N/A N/A N/A N/A 7

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 2 - Timber Pile Caps (Severe)
COMPONENT ID COMPONENT CONDITION RATING Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 653 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV
46a 46b X Splitting
41a 41c X Full height splits
33K 33M X Splitting outside
26e 26f X Splitting
29t 29w X Splitting
28K 28M X Splits
25x 25z X Splitting
25n 25p X Splitting
25b 25c X Splitting
23w 23z X Splitting
23t 23w X Splitting
23j 23l X Splitting, dry rot
17J 17L X > 1/2"ƐƉůŝƚĨƵůůůĞŶŐƚŚ
17z 17ab X Splitting on bottom
17o 17q X Split
17m 17o X Splits
15K 15O X > 1/2"ƐƉůŝƚďŽƚƚŽŵ
14r 14s X 3/4"ƐƉůŝƚďŽƚƚŽŵ
14d 14e X Fungal rot
12e 12g X 50% in-bearing & leaning w/ fungal
rot

11.5o 11.5q X Not connected to stringers at top

8.1d 8.1f X 3/4"ƐƉůŝƚĨƵůůůĞŶŐƚŚ

8.1c.1 8.1d X Dry rot, 3/4"ƐƉůŝƚƵůůůĞŶŐƚŚ
7r 7u X 1/2"ƐƉůŝƚĨƵůůůĞŶŐƚŚƐŝĚĞĂŶĚďŽƚƚŽŵ
20m 20o X End split, splitting
N/A N/A N/A 25 N/A Not Included Not Included Not Included Not Included
Total=

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 2 - Timber Pile Caps (Major)

COMPONENT ID COMPONENT CONDITION RATING

5.E.b
Packet Pg. 654 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV
53j 53l X Fungal rot / corrosion at hardware,
major
53h 53j X Fungal rot / splits
53f 53h X Fungal rot / corrosion at hardware,
major
52b 52c.8X Fungal rot / corrosion at hardware,
major
47l 47n X Splitting
47h 47j X Splitting, minor fungal rot
41k 41n X Dry rot
40l 40n X Splits
40g 40i X Splits
39M 39O X 50% end bearing
39K 39M X Splitting
36M 36O X Split
36f 36i X Split
35n 35o X Splitting
35i 35l X Splitting
34u 34v X Splitting
34g 34l X Splitting
34K 34O X Splitting
32K 32MX Splitting outside and underneath
32u 32x X Split
32p 32r X Split
26K 26N X Splitting
26w 26z X Splitting
26p 26q X Splitting
16a 16b X 1/2"ƐƉůŝƚƐĨƵůůůĞŶŐƚŚ
9K 9O X 1/2ΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
9y 9ab X 1ͬϰΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
30t 30w X Splitting
30r 30t X Splitting
29p 29q X Splitting
29a 29c X Splitting
28l 28m X 10% section loss
28i 28j X Section loss 10%
27w 27z X Splitting
27q 27t X Full length splits
27g 27h X Fungal rot
25K 25N X Splitting
25z 25ab X Splitting
25k 25m X Splitting
25h 25j X Splitting
25d 25f X Splitting
25a 25b X Splitting
24w 24z X Splitting
24o 24q X Splitting
24k 24m X Splitting

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 2 - Timber Pile Caps (Moderate)
COMPONENT ID COMPONENT CONDITION RATING Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 655 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 2 - Timber Pile Caps (Moderate)

COMPONENT ID COMPONENT CONDITION RATING
24f 24g X Splitting
23q 23t X Splitting
23f 23g X Splitting
23d 23f X Splitting
22q 22t X Full length split
21q 21t X Full length split
21g 21k X Fungal rot
20K 20M X Splitting
20t 20w X Splitting
20m 20o X Splitting
20g 20i X Splitting
20f 20g X Bore holes
19t 19w X
19q 19t X Splitting
19n 19p X Splitting
18o 18q X Splitting at ends
17t 17w X Splitting
17a 17c X Splitting
15v 15w X Split
15n 15p X Split on bottom
15i 15k X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
15c 15e X Split at bottom
15a 15b X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
15J 15K X Split on bottom
14p 14r X Splitting
13K 13O X 1ͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
13a 13b X 1ͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
12s 12t X End connection splits
11g 11i X Fungal rot, 50% in-bearing
8t 8w X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
8r 8t X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ

8.1g 8.1i X 1ͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ

8.1f 8.1g X 1ͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
8a 8c.1 X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
7w 7y X 1ͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ͕ĨƵůůůĞŶŐƚŚ
7u 7w X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
7l 7m X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
7e 7g X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
7c.1 7d X 1ͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
7a 7c.1 X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
6v 6x X ϭͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ
5y 5z X 1/2 inch crack full length
36d 36f X Split

8.5d 8.5e X 1ͬϮΗƐƉůŝƚĨƵůůůĞŶŐƚŚ͕ŽŶďŽƚƚŽŵ

3.2o 3.2p X 1/2 inch crack full length
3s.2 3.3s.9 X 1/2 inch crack full length

2.8m.3 2.8n.3 X 1/2 inch crack full length

2.8l.3 2.8m.3 X 1/2 inch crack full length

2.8k.3 2.8l.3 X 1/2 inch crack full length Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 656 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 2 - Timber Pile Caps (Moderate)

COMPONENT ID COMPONENT CONDITION RATING

2.8i.3 2.8j.3 X 1/2 inch crack full length

2.8h.7 2.8i.3 X 1/2 inch crack full length
2l.3 2m.3 X 1/2 inch crack full length
2k.3 2l.3 X 1/2 inch crack full length
2j.3 2k.3 X 1/2 inch crack full length
2i.3 2j.3 X 1/2 inch crack full length
2h.7 2i.3 X 1/2 inch crack full length
1l.3 1m X 1"ĐƌĂĐŬ͕ĨƵůůůĞŶŐƚŚ

7.5e 7.5g X 1/2"ƐƉůŝƚĨƵůůůĞŶŐƚŚ
3d1 3d3 X 1/2 inch crack full length

11.5h 11h X Fungal rot
26L 26N X Splitting
36b 36d X Split
0i.3 1i.3 X Full length splits 0.5 in
4u.5 3.3v X Moderate dry rot
4v 3.3v X Moderate dry rot
N/A N/A 110 N/A N/A Not Included Not Included Not Included Not Included Total =

5.E.b
Packet Pg. 657 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV
11d 12d X 100% section loss
12d 13d X Broken off
12y 13y X Missing end connection
13k 14k X Missing connection
15ab 16ab X Split in half
21d 22d X Not connected
21q 22q X Not connected
21w 22w X Full height split
21y 22y X Full height split
25q 26q X Not connected
26x 27x X Broken end connection
31e 32e X
38a 39a X End connection failure/ missing
hardware
42c 43c X Fungal rot and splits
42d 43d X Fungal rot
42e 43e X Fungal rot
42f 43f X Fungal rot
42g 43g X Fungal rot
42n 43n X Fungal rot
4a 5a X Split in half
4j 5j X End bearing failure of k brace
52n 53n X Fungal rot / corrosion at hardware,
major
31c.5 32c.5 X Insufficient connection hardware,
minor splitting
11z 12z X Failed end connection
12z 13z X Failed end connection
Total = N/A N/A N/A N/A 25

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 3 - Lateral Timber Bracing (Severe)
COMPONENT ID COMPONENT CONDITION RATING Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 658 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV
16e 16g X Termite damage
24x 24z X Missing connections
26u 26v X No end connection
26z 26ab X Broken end connection
27m 27n X Split ends
33n 33o X Connection
34b 34c X Not connected
34c 34d X Not connected
38K 38O X End connection damage
41K 41M X Dry rot / splits at ends
51a 51d X Severe fracture in member at 51b
53k 53l X Fungal rot / corrosion at hardware,
major
36o 37o X Fungal rot and splits
Total = N/A N/A N/A N/A 13

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 3 - Transerse Timber Bracing (Severe)
COMPONENT ID COMPONENT CONDITION RATING Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 659 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV
12O 13O X End connection split
20i 21i X Dry rot, connection failure
21o 22o X Split ends
21r 22r X Split ends
22a 22.5a.5 X Split
24N 25N X End split
25n 26n X Splitting, connection damage
27w 28w X Split ends
27x 28x X Hardware deteriorated
28y 29y X
29x 30x X Connection damage and missing, dry
rot
30a 31a X Splitting at connections
31j 32j X Insufficient connection
33a 34a X Dry rot and splits
33N 33N X Splits
34r 35r X Splitting
35K 36K X Not connected
36a 37a X Connection dry rot
36K 37K X Missing bolt, people sitting on brace
37m 38m X Dry rot
37n 38n X Dry rot
38m 39m X Split at ends and corrosion
39c 40c X Dry rot and end splits
39d 40d X Dry rot
39O 40O X Dry rot
41b 42b X Dry rot
41c 42c X Dry rot
41h 42h X Dry rot
41n 42n X Fungal rot
42a 43a X Fungal rot
42h 43h X Fungal rot
42i 43i X Fungal rot
42j 43j X Fungal rot
43b 44b X Fungal rot, corrosion at connection
43c 44c X Fungal rot, corrosion at connections
43d 44d X Fungal rot
43e 44e X Fungal rot
43f 44f N and 44f S X Fungal rot
43g 44g X Fungal rot
43h 44h X Fungal rot, corrosion at connections
44c 45c X Fungal rot
44k 45k X Splitting
45d 46d X Fungal rot
45i 46i X Fungal rot Not Included Not Included Not Included Not Included

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 3 - Lateral Timber Bracing (Major)

COMPONENT ID COMPONENT CONDITION RATING

5.E.b
Packet Pg. 660 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 3 - Lateral Timber Bracing (Major)

COMPONENT ID COMPONENT CONDITION RATING
46e 47e X Fungal rot
4w 5w X End split into four
52f 53f X corrosion at hardware, major
52g 53g X Fungal rot / corrosion at hardware,
major
5m 6m X
44f S 45f X Fungal rot
33g 34h X Splitting,fungal rot
44f N 44f X Fungal rot, section loss
TOTAL = N/A N/A N/A 52 N/A Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 661 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV
11s 11t X Split at ends
11t 11v X Splits at ends
11z 11ab X Full length split
12k 12l X End connection split
14d 14f X Fungal rot, end split, connection
damage
14l 14n X >1/2"ƐƉůŝƚƵůůůĞŶŐƚŚ
14r 14t X End split
14z 14aa X End split
20K 20O X End split
22n 22p X Split ends
23u 23v X Splitting, connection damage
25a 25b X End split
27i 27k X Split ends
27L 27O X
27z 27ab X Split ends
28j 28k X
28z 28ab X
29a 29c X Splitting, missing connection
29e 29g X End split at connection
29g 29i X End split
29n 29p X Insufficient connections, minor
splitting
29r 29s.8 X Minor Splitting, missing hardware
30h 30j X Connection damage, insufficient
connection
30j 30l X Connection damage, insufficient
connection
30n 30p X Insufficient connections, connection
damage
31i 31l X Insufficient connection, minor
splitting
31x 31z X End split and connection damage
32a 32b X Section loss
34i 34k X Connection damage, splitting, fungal
rot
37b 37c X Corrosion at connection
39b 39d X Dry rot
39d 39f X Dry rot / splits at ends
39f 39g X Dry rot
39K 39O X Dry rot
41c 41e X Dry rot / splits at ends
41f 41h X Dry rot
41l 41m X Dry rot
42a 42b X Splits at ends
42c 42e X Fungal rot
42e 42g X Dry rot

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 3 - Transverse Timber Bracing (Major)
COMPONENT ID COMPONENT CONDITION RATING Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 662 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 3 - Transverse Timber Bracing (Major)

COMPONENT ID COMPONENT CONDITION RATING
42j 42l X Fungal rot
42l 42m X Fungal rot
42m 42n X Fungal rot
53l 53n X Fungal rot / corrosion at hardware,
major
6b 6c.1 X Dry rot
7b 7c.1 X Dry rot and splitting
7k 7m X Splitting
7p 7q X End split

50.1a 50.1b X Fungal rot / corrosion at hardware
3m 3l X 1 inch full section split at end
10v 10w X Connection rotted
10w 10x X Connection rotted
20a 20c X End split, missing connection
20k 20l X End split
20x 20z X Split in half
21k 21l X Split ends

24.8c 25b.5 X Splitting
33x 33z X Split
47a 47b X Corrosion
N/A N/A N/A 59 N/A
Not Included
Total =
Not Included Not Included Not Included

5.E.b
Packet Pg. 663 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV
11g 11i X Split at ends
11w 11x X Split at ends
11x 11y X Split at ends
12a 12c X Split at ends
12c 12e X Dry rot
12g 12i X End connection splits
12i 12k X Split at ends
12l 12m X End splits
12r 12t X Split ends
13a 13c X Split at connections
13l 13n X End splits, splitting
13n 13p X Damage around connections
13p 13r X Connection damage
13r 13t X End split
13x 13z X Splitting at connections
14a 14b X Split end connection
14b 14d X Connections and fungal rot
14f 14h X Missing connection
14h 14j X Connection damage
14K 14M X Dry rot, missing hardware
14M 14O X Dry rot and missing hardware
14n 14p X Connection damage
14p 14r X Connection damage
15g 15i X Connections and end split
15i 15k X Connection damage and end split
15k 15l X Connection damage and end splits
15l 15n X Connection damage end split
15n 15p X Nd splits and connection damage
15p 15r X End splits connections
15r 15t X End plots and connection damage
15z 15ab X Nd splits and connection damage
16a 16c X Split ends
16c 16e X Fungal rot, split at ends
16g 16i X Dry rot
16i 16k X Dry rot, split ends
16k 16l X Dry rot
16l 16n X Dry rot
16M 16N X Split at ends
16n 16o X Dry rot
16p 16r X Dry rot
16z 16ab X Split at ends
17K 17O X End split
19K 19N X Split and deteriorating conditions

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 3 - Transverse Timber Bracing (Moderate)
COMPONENT ID COMPONENT CONDITION RATING Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 664 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 3 - Transverse Timber Bracing (Moderate)

COMPONENT ID COMPONENT CONDITION RATING
19M 19N X Splitting
21M 21N X Split ends
22a 22b X Split ends
22e 22g X
22g 22i X
22i 22k X Split ends
22k 22l X
22K 22O X
22l 22m X
22M 22N X Splits
22p 22r X
22r 22t X
22t 22v X
22v 22w X
22x 22z X
22z 22ab X Split ends
23d 23f X Splitting
23l 23n X Splitting, connection damage
23n 23p X Splitting, connection damage
23x 23z X End split, connection damage
24f 24h X End split, connection damage
24h 24j X End split, connection damage
24j 24l X Connection damage
24r 24s X End split, connection damage
24t 24v X Splitting, connection damage
24v 24x X End split, connection damage
25n 25p X Splitting, connection damage
25p 25r X Connection damage
25r 25t X Splitting, connection damage
25t 25v X Splitting, connection damage
25v 25x X Splitting, connection damage
25x 25z X Splitting, connection damage
26m 26n X Splitting, connection damage
26r 26t X Splitting, connection damage
26x 26z X Splitting, connection damage
27a 27c X
27c 27e X Split ends
27g 27i X Split ends
27k 27m X Split ends
27n 27p X
27r 27t X Split ends
27v 27w X Dry rot
27x 27z X Dry rot
28a 28c X
28c 28e X
28k 28m X
28M 28N X
28q 28r X
28r 28t X Not Included Not Included
Not Included Not Included

5.E.b
Packet Pg. 665 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 3 - Transverse Timber Bracing (Moderate)

COMPONENT ID COMPONENT CONDITION RATING
28t 28v X
28v 28x X Split
28x 28z X
29c 29e X End split
29k 29l X Splitting, connection damage
29p 29r X Connection damage, splitting, dry rot
29t 29v X Splitting, connection damage
30x 30z X Connection damage
30y 30aa X Splitting, dry rot
31l 31m X Connection damage, minor Splitting
31m 31n X Connection damage
31n 31o X Connection damage, end split
31v 31x X Connection
32e 32f X Splits
32L 32N X Rot fungal
32s 32t X Connection and splits at end
32t 32u X Splits and connection
32v 32x X Splitting and connection
33g 33i X Fungal rot and connection damage
33i 33l X Fungal rot and connection damage
33l 33n X Fungal rot and connection damage
33t 33u X Split
33u 33v X Dry rot and splits
34K 34O X Splitting
34t 34v X Splitting
35a 35b X Fungal rot, minor Splitting
35n 35p X Fungal rot, minor splitting
35r 35t X Splitting, fungal rot
36b 36d X Split
36l 36m X Split
36m 36n.6 X Splits
37K 37O X Dry rot and splits at ends
37m 37n X End hardware
38k 38m X Dry rot
39a 39b X Splits at ends
39h 39j X Dry rot / splits at ends
39j 39l X Dry rot
40a 40b X Dry rot
40c 40e X Dry rot
40g 40l X Dry rot
41a 41b X Dry rot
41b 41c X Corrosion
41h 41j X Dry rot
42g 42i X Fungal rot Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 666 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 3 - Transverse Timber Bracing (Moderate)

COMPONENT ID COMPONENT CONDITION RATING
43i 43h X Fungal rot, corrosion at connections,
rot at connections
43k 43m X Fungal rot, corrosion at connections
43m 43n X Connection damage
45a 45c X Fungal rot.
46e 46f X Connection damage
48g 48h X Fungal rot
48g 48i X Fungal rot
48i 48j X Fungal rot
49d 49e X Fungal rot
49g 49i X Fungal rot / corrosion at hardware
49k 49l X Fungal rot / corrosion at hardware
50a 50c X Fungal rot / corrosion at hardware
50b 50c X Corrosion on steel
50c 50d X Fungal rot / corrosion at hardware
50g 50i X Fungal rot / corrosion at hardware
50i 50j X Fungal rot / corrosion at hardware
50j 50l X Fungal rot / corrosion at hardware,
major corrosion
50l 50m X Fungal rot / corrosion at hardware,
major
51d 51e X Fungal rot / corrosion at hardware,
major
51e 51f X Fungal rot / corrosion at hardware,
major
52c 52c.8 X Fungal rot / corrosion at hardware
52f 52g X Fungal rot / corrosion at hardware,
major
52g 52h X Fungal rot / corrosion at hardware,
major
52l 52n X Fungal rot / corrosion at hardware,
major
53a 53b X Fungal rot / corrosion at hardware,
moderate
53b 53c.8 X Fungal rot / corrosion at hardware,
major
53f 53g X Fungal rot / corrosion at hardware,
major
53g 53i X Fungal rot / corrosion at hardware,
major
5j 5k X Not Included Not Included
Not Included Not Included

5.E.b
Packet Pg. 667 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 3 - Transverse Timber Bracing (Moderate)

COMPONENT ID COMPONENT CONDITION RATING
5x 5y X 1/2 - 1 inch crack full length
6a 6b X Split end
6l 6m X End split on both ends
7i 7j X Missing nut
7w 7x X End splits
7x 7y X End split both ends
8K 8M X
8M 8N X
8N 8O X 1/2"ƐƉůŝƚƐ
52d.5 52f X Fungal rot / corrosion at hardware,
major
51i 51j X Fungal rot / corrosion at hardware,
major
27p.4 27r X Splits

51.7i 51.8j X Fungal rot / corrosion at hardware,
major

51.8j 51.9l X Fungal rot / corrosion at hardware,
major

50.9j 50.9k X Fungal rot / corrosion at hardware,
major

50.9k 50.9l X Fungal rot / corrosion at hardware,
major

50.9l 50.9m X Fungal rot / corrosion at hardware,
major
9y 9z X Split at ends
8q 8r X End split
12e 12g X Split at ends
20i 20k X Connection damage
20l 20n X End split, connection damage
20p 20r X End split, connection damage

22.5a.5 22.5c X End split
21a 21c X Split ends
21g 21h X Split ends
29L 29N X Connection damage, dry rot
30aa 30ab X Splitting at connection
34l 34m X Fungal rot
35l 35n X Fungal rot
36m 36n X Split
40i 40k X Splits
41j 41l X Splits
46b 46c X Connection damage
48g 48h X Fungal rot
52d 52d.5 X Fungal rot / corrosion at hardware,
major
Total = N/A N/A 201 N/A N/A Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 668 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV
10K 11K X Split ends
10L 11L X Split ends
10M 11M X Split ends
10N 11N X Split ends
10x 11x X Ends split
11f 12f X Dry rot
11g 12g X Fungal decay
11h 12h X Dry rot
11i 12i X Dry rot
11j 12j X Dry rot
11k 12k X Dry rot
11m 12m X Dry rot
11q 12q X Dry rot
11w 12w X Dry rot
12a 13a X Dry rot
12b 13b X Dry rot
12c 13c X Dry rot
12e 13e X Dry rot
12f 13f X Dry rot
12g 13g X Dry rot
12h 13h X Dry rot
12i 13i X Dry rot
12j 13j X Dry rot
12k 13k X Dry rot
12r 13r X Dry rot
12s 13s X Dry rot
12v 13v X Dry rot
12w 13w X Dry rot
13a 14a X End split
13c 14c X Moderate end splits and dry rot
13g 14g X End split
13K 14K X double braces, Dry rot, end splits
13L 14L X double braces, Dry rot, end splits
13N 14N X double braces, Dry rot, end splits
13O 14O X double braces, Dry rot, end splits
13r 14r X End split
13v 14v X End split
14ab 15ab X End split both ends
14m 15m X End split both sides
14q 15q X End split
14r 15r X End split
14w 15w X Connection damage
14z 15z X Connection damage
15N 16N X Splitting
19M 20M X Splitting
20a 21a X End split
20b 21b X End split
20d 21d X End split
20h 21h X End split Not Included Not Included Not Included Not Included

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 3 - Lateral Timber Bracing (Moderate)

COMPONENT ID COMPONENT CONDITION RATING

5.E.b
Packet Pg. 669 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 3 - Lateral Timber Bracing (Moderate)

COMPONENT ID COMPONENT CONDITION RATING
20k 21k X Connection damage
20L 21L X End split
20M 21M X End split
20n 21n X Dry rot, connection damage
20N 21N X End split
20q 21q X End split, connection damage
20w 21w X End split, connection damage
20y 21y X Connection damage
21c 22c X Split ends
21g 22g X Split ends
21h 22h X Split ends
21i 22i X Split ends
21j 22j X Split ends
21k 22k X Split ends
21l 22l X Split ends
21p 22p X Split
21s 22s X Split at ends
21v 22v X Split ends
21x 22x X Split
22aa 23aa X Dry rot
22c 22.5 c X
22d 23d X
22g 23g X Dry rot
22h 23h X Split ends
22K 23K X
22L 23L X
22m 23m X
22M 23M X
22N 23N X
22O 23O X
22p 23p X Splits
22u 23u X Dry rot
22v 23v X Termite
22w 23w X Split ends
22x 23x X
23O 24O X End split
23z 24z X End split, connection damage
24k 25k X End split, connection damage
24L 25L X End split, connection damage
24m 25m X End split, connection damage
24s 25s X Splitting, connection damage
25h 26h X Section loss
25j 26j X End split, connection damage
25u 26u X Splitting, connection damage
25w 26w X Splitting, connection damage
25x 26x X Splitting, connection damage
25z 26z X Splitting, connection damage
26aa 27aa X Splitting, connection damage
26b 27b X Splitting, connection damage Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 670 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 3 - Lateral Timber Bracing (Moderate)

COMPONENT ID COMPONENT CONDITION RATING
26f 27f X Splitting, connection damage
26h 27h X Splitting, connection damage
26j 27j X Splitting,connection damage
26l 27l X Splitting, connection damage
26M 27M X Splitting
26n 27n X Splitting, connection damage
26N 27N X Splitting
26o 27o X Splitting, connection damage
26p 27p X Splitting, connection damage
26q 27q X Splitting, connection damage
26s 27s X Splitting, connection damage
26y 27y X Splitting, connection damage
27a 28a X Split ends
27aa 28aa X
27f 28f X Split ends
27l 28l X
27m 28m X Split ends
27n 28n X Dry rot
27N 28N X Split ends
27y 28y X
28c 29c X
28h 29h X
28L 28L X
28m 29m X Split at end
28M 28M X
28N 28N X Missing hardware
28O 28O X
28p 29p X Dry rot
28x 29x X
30q 31q X End split
31c 32c X Splitting
31i 32i X Dry rot, section loss
31L 32L X Splitting
31M 32M X Section loss, connection damage ,
minor splitting
32v 33v X Splits and connection
33l 34l X Fungal rot
33M 33M X Splits
34a 35a X Section loss, minor splitting
34h 35h X Splitting, fungal rot
34i 35i X Splitting
34p 35p X Connection damage
34t 35t X Splitting
35i 36i X Splitting
36c 37c X Split
36m 37m X Fungal rot and splits
37i 38i X Corrosion at connection
37L 38L X Corrosion at connection
37M 38M X Corrosion at connection Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 671 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 3 - Lateral Timber Bracing (Moderate)

COMPONENT ID COMPONENT CONDITION RATING
37N 38N X Corrosion at ends
37O 38O X Corrosion at connection
38c 39c X Dry rot
38d 39d X Splits
38e 39e X Splits
38g 39g X Dry rot and splits ends
38i 39i X Dry rot
38l 39l X Dry rot
38L 39L X Corrosion at connection
38M 39M X Corrosion at connection
38n 39n X Dry rot
38N 39N X Corrosion at connection
38O 39O X Corrosion at ends
39a 40a X Dry rot and splits
39j 40j X Dry rot
39l 40l X Dry rot
39L 40L X Dry rot
40b 41b X Missing hardware
40c 41c X Dry rot
40f 41f X Missing hardware/ dry rot
40h 41h X Splits
40l 41l X Dry rot
40L 41L X Dry rot
40N 41N X End connection corrosion
40O 41O X End connection corrosion
41f 42f X Dry rot
41g 42g X Dry rot
41i 42i X Dry rot
41k 42k X Splits
42k 43k X Fungal rot
42l 43l X Fungal rot
42m 43m X End connection corrosion
43a 44a X Splitting, corrosion at connections
43n 44n X Connection damage, fungal rot
44d 45d X Splitting
44e 45e X Splitting, section loss, connection
corrosion, fungal rot
44h 45h X Fungal rot, corrosion at connections
44i 45i X Corrosion at connections, fungal rot
44j 45j X Fungal rot, corrosion at connections
44l 45l X Fungal rot, corrosion at connections
45a 46a X Fungal rot
45b 46b X Fungal rot
45c 46c X Fungal rot Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 672 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 3 - Lateral Timber Bracing (Moderate)

COMPONENT ID COMPONENT CONDITION RATING
45h 46h X Fungal rot
45l 46l X Fungal rot
47b 48b X Fungal rot
47c 48c X Fungal rot
47d 48d X Fungal rot
47e 48e X Fungal rot
47f 48f X Fungal rot, minor splitting
47g 48g X Fungal rot
46g 47g X Fungal rot, corrosion at connections
47h 48h X Fungal rot
48a 49a X Fungal rot
48c 49c X Fungal rot
48d 49d X Fungal rot
48f 49f X Fungal rot
48g 49g X Fungal rot
48h 49h X Fungal rot
48j 49j X Fungal rot
49g 50g X Fungal rot / corrosion at hardware
49h 50h X Fungal rot / corrosion at hardware
49k 50k X Fungal rot / corrosion at hardware
49l 50l X Fungal rot / corrosion at hardware
50g 51g X Fungal rot / corrosion at hardware
50h 51h X Fungal rot / corrosion at hardware
50i 51i X Fungal rot / corrosion at hardware
50j 51j X Fungal rot / corrosion at hardware
50k 51k X Fungal rot / corrosion at hardware
50l 51l X Fungal rot / corrosion at hardware,
major
50m 51m X Fungal rot / corrosion at hardware
50n 51n X Fungal rot / corrosion at hardware
51c 52c X Fungal rot / corrosion at hardware
51d 52d X Fungal rot / corrosion at hardware,
major
51e 52e X Fungal rot / corrosion at hardware,
major
Not IncludedNot IncludedNot IncludedNot Included

5.E.b
Packet Pg. 673 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 3 - Lateral Timber Bracing (Moderate)

COMPONENT ID COMPONENT CONDITION RATING
51f 52f X Fungal rot / corrosion at hardware,
moderate
51g 52g X Fungal rot / corrosion at hardware,
major
51h 52h X Fungal rot / corrosion at hardware,
major
51i 52i X Fungal rot / corrosion at hardware,
major
52a 53a X Fungal rot / corrosion at hardware,
major
52c 53c X Fungal rot / corrosion at hardware
52e 53e X Fungal rot / corrosion at hardware,
major
52h 53h X Fungal rot / corrosion at hardware,
major
52l 53l X Fungal rot / corrosion at hardware,
major
52m 53m X Fungal rot / corrosion at hardware,
major
7f 7.5f X End split
7h 7.5h X End split
9ab 10ab X Split ends
9x 10x X Both ends split
9y 10y X Split ends
9z 10z X Split at ends
36a.5 37a.5 X Split
52d.5 53d.5 X Fungal rot / corrosion at hardware,
major
34a.5 35a.5 X Splitting
31r.9 32r.9 X Splitting

51.7i 53i X Fungal rot / corrosion at hardware,
major

50.9j 52j X Fungal rot / corrosion at hardware

50.9l 52l X Fungal rot / corrosion at hardware,
major

50.9m 52m X Fungal rot / corrosion at hardware,
major
47h.7 NW 48i X Fungal rot, minor section loss

6.5N 8N X double braces, Dry rot, end splits

6.5M 8M X double braces, Dry rot, end splits

6.5L 8L X double braces, Dry rot, end splits

6.5K 8K X double braces, Dry rot, end splits
13M 14M X double braces, Dry rot, end splits
11b 12b X Flaking
11c 12c X Connection splits
21o 22o X Split ends
25s 26s X Splitting, connection damage Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 674 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 3 - Lateral Timber Bracing (Moderate)

COMPONENT ID COMPONENT CONDITION RATING
26l 27l.5 X Splitting, connection damage
29f 30e X End split
32l.9 33m X Splits and connection
33o 34o X Split
44m.5 45m.5 X Fungal rot, corrosion at connections
TOTAL = N/A N/A 260 N/A N/A Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 675 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV

40.5d 41d X Full height corrosion

40.5e 41e X Full height corrosion

40.5f 41f X Full height corrosion

40.5g 41g X Full height corrosion

40.5h 41h X Full height corrosion

40.5i 41.5i X Full height corrosion

40.5b.5 41b.5 X Corrosion full section
N/A N/A N/A N/A 7

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 3 - Lateral Steel Bracing (Severe)

COMPONENT ID COMPONENT CONDITION RATING
TOTAL =
Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 676 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV
51h 51i
Not Included Not Included Not Included Not Included
X Corrosion through section
N/A N/A N/A N/A 1

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 3 - Transverse Steel Bracing (Severe)
TOTAL =

COMPONENT ID COMPONENT CONDITION RATING

5.E.b
Packet Pg. 677 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV

40.5c 41c
Not IncludedNot IncludedNot Included
X
Not Included
Corrosion half section
TOTAL = N/A N/A N/A 1 N/A

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 3 - Lateral Steel Bracing (Major)

COMPONENT ID COMPONENT CONDITION RATING

5.E.b
Packet Pg. 678 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV
43b 43c X Corrosion
43c 43d X Corrosion
43j 43k X Corrosion
46l 46m X Corrosion at connections
36l 36m X Paint peeling
44b 44c X Corrosion
44e 44f N X Corrosion
44g 44h X Corrosion
44i 44j X Corrosion
46a 46b X Corrosion
47c 47d X Corrosion
Total = N/A N/A N/A 11 N/A

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 3 - Transverse Steel Bracing (Major)
COMPONENT ID COMPONENT CONDITION RATING Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 679 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV
39g 39h X Corrosion to coatings
46i 46j X Corrosion
47l 47m X Corrosion
51b 51c X Corrosion
43l 43m X Corrosion
43m 43n X Corrosion
44m.5 44n X Corrosion
44c 44d X Corrosion
44i 44j X Corrosion
44j 44k X Corrosion
44l 44m X Corrosion at connections
45A 45B X Corrosion
47e 47f X Corrosion
48a 48b X Corrosion
Total = N/A N/A 14 N/A N/A Not Included Not Included Not Included Not Included

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 3 - Transverse Steel Bracing (Moderate)

COMPONENT ID COMPONENT CONDITION RATING

5.E.b
Packet Pg. 680 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

AREA ID COMMENTS
BENT NO. / ROW NO. ND MN MD MJ SV
36l-36m-3lL-37m X Split
37k-37n-38k-37n X Full height splits and spike defects
TOTAL = N/A N/A N/A N/A 2

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY

PILE CONDITION RATING
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 4 - Stringer Defect Area (Severe)
Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 681 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

AREA ID COMMENTS
BENT NO. / ROW NO. ND MN MD MJ SV
6n-6p-7p-7o X Currently being temporarily supported
6q-6t-7t-7q X
Splitting, most without temporary
support
10k/11k - 10p/11p X 1/2"ƐƉůŝƚƐƚƌŝŶŐĞƌƐĨƵůůŚĞŝŐŚƚ
11n/12n - 11y/12y X Full length splits
21y 22y 21v 22v X Full height splits
27y 28y 27w 28w X Broken stringers
27p 28p 27t 28t X Broken stringer
28z 29z 28r 29r X Broken stringer
29y-30y-30z-29z X Splitting
29w-30w-30x-29x X Splitting
29s.8-30s.8-30u-29u X Stringers being supported, splitting TOTAL = N/A N/A N/A 11 N/A

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 4 - Stringer Defect Area (Major)

PILE CONDITION RATING
Not IncludedNot IncludedNot IncludedNot Included

5.E.b
Packet Pg. 682 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

AREA ID COMMENTS
BENT NO. / ROW NO. ND MN MD MJ SV
4q - 5q - 5w - 4w X

7.5k-7.5n-8n-8k X Dry rot and splitting
10v/11v - 10y/11y X Full height splits
9x/10x - 9o/10o X Full height splits
8w-9w-9r-8r X Splitting, glued together, temporary
supports

6.5O-6.5K X Splitting
13k-13o-15o-15k X Splitting
15O-15A-16a-16O X Split
11b/12b - 11i/12i X Fungal rot
16O/16a - 17O/17a X
15e-15g-16g-16e X Splitting
15m-15n-16n-16m X Splitting
19K-21K-21l-19l X Splitting from loading and nail spikes, 19l-20l-20m-19m X Splitting from loading and nail spikes, minor and moderate
23p-23r-24r-24p X Split stringers, some supported by
temporary
23x-23y-24y-24x X Split stringers, some supported by
temporary
24w-24x-25x-25w X Split stringers
22y 23y 22t 23t X Half height splits
25s-25u-26u-26s X Split stringers
26x-26y-27y-27x X Split stringers
26s-26u-27u-27s X Split stringers
26O-26b-27b-27O X Split stringers
34z-34aa-35aa-35z X Splitting
32K-32L-33K-33L X Splits
38c-38d-39c-39d X Shin under stringer s
Total = N/A N/A 25 N/A N/A

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 4 - Stringer Defect Area (Moderate)

PILE CONDITION RATING
Not IncludedNot IncludedNot IncludedNot Included

5.E.b
Packet Pg. 683 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

AREA ID COMMENTS
AREA NO. ND MN MD MJ SV
Defect Area 1 X Split deck boards
Defect Area 2 X Split deck boards at roadway
Defect Area 6 X Split deck boards at driveway
Defect Area 7 X Splitting deck boards at drive islo
Defect Area 9 X Split deck boards, moderate to major
TOTAL = N/A N/A N/A 5 N/A

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 5 - Deck Area (Major)

PILE CONDITION RATING
Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 684 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

AREA ID COMMENTS
AREA NO. ND MN MD MJ SV
Defect Area 3 X Split deck boards at roadway
Defect Area 4 X Split deck boards at roadway
Defect Area 5 X Split deck boards at roadway
Defect Area 8 X Split deck boards at parking lot
TOTAL = N/A N/A 4 N/A N/A Not Included Not Included

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 1 - Timber East-End Pier Segment (Bent 0 – Bent 53) Item 5 -Deck Area (Moderate)

PILE CONDITION RATING
Not
Included
Not
Included

5.E.b
Packet Pg. 685 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

PILE ID COMMENTS
BENT NO. / ROW NO. ND MN MD MJ SV
AS_24G
Not Included Not Included Not Included
X
Not Included
Rust bleeds and crack at cap
TOTAL = N/A N/A N/A 1 N/A

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 2 - Concrete Amusement Structure Pier Segment (Bent 35 – Bent 53) Item 6 - Amusement Structure Piles (Major)

PILE CONDITION RATING

5.E.b
Packet Pg. 686 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

PILE ID COMMENTS
BENT NO. / ROW NO. ND MN MD MJ SV
AS_24K X Rust bleeds at cap connection
AS_29A X Spalling and minor rust bleeds
AS_22B X Rust bleeds and spalling
AS_21C X Concrete pop out.

AS_11C X Jet tube exposed
AS_11D X Jet tube exposed
AS_10B X Jet tube port exposed
AS_15B X Jet tube exposed
AS_17B X Corrosion and spalling at top of pile
AS_20B X Jet tube exposed
AS_20A X Jet tube exposed
AS_30G X Rust bleeds at cap, minor spalling
AS_30J X Rust bleeds and minor spalling
AS_32C X Rust bleeds at cap
AS_32B X Rust bleeds and spalling
AS_32A X Splitting and minor rust bleeds and minor
abrasions
AS_35C X Rust bleeds and spalling
AS_35B X Rust bleeds and spalling
AS_37A X Rust bleeds and spalling
AS_37C X Rust bleeds and spalling
AS_37B X Rust bleeds and spalling
AS_33A X Rust bleeds and minor spalling
AS_33B X Rust bleeds and minor spalling
Total = N/A N/A 23 N/A N/A Not Included Not Included Not Included

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 2 - Concrete Amusement Structure Pier Segment (Bent 35 – Bent 53) Item 6 - Amusement Structure Piles (Moderate)

PILE CONDITION RATING
Not Included

5.E.b
Packet Pg. 687 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

PILE ID COMMENTS
BENT NO. / ROW NO. ND MN MD MJ SV
37s X
38o X Spalling at top of pile
40s X Spalling
44aa X
45s X Spalling and PVC pipe
51s X Exposed jet tube
53q E X Crack
38q W X Spalling at top of pile
53q W X Crack
Total= N/A N/A 9 N/A N/A

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 2 - Concrete Amusement Structure Pier Segment (Bent 35 – Bent 53) Item 6 - Concrete Piles (Moderate)

PILE CONDITION RATING
Not IncludedNot IncludedNot IncludedNot Included

5.E.b
Packet Pg. 688 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

PILE ID COMMENTS
BENT NO. / ROW NO. ND MN MD MJ SV
42s X Spalling at bottom of capital
41s X Spalling 1"ĚĞĞƉ͕ϯΗǁŝĚĞ͕ϰΗůŽŶŐ͕
ĞdžƉŽƐĞĚƌĞďĂƌ
ϰϯŽ X Spalling at bottom of cap
52u X Spalling
Total = N/A N/A 4 N/A N/A

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 2 - Concrete Amusement Structure Pier Segment (Bent 35 – Bent 53) Item 7 - Capitals (Moderate)

PILE CONDITION RATING
EŽƚ/ŶĐůƵĚĞĚEŽƚ/ŶĐůƵĚĞĚEŽƚ/ŶĐůƵĚĞĚEŽƚ/ŶĐůƵĚĞĚ

5.E.b
Packet Pg. 689 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMPONENT ID COMMENTS
COMPONENT NO. ND MN MD MJ SV
AS_19 X Spalling,section loss, corrosion, and
exposed rebar.

AS_23 X Cracking at corner or cap
TOTAL = N/A N/A N/A N/A 2

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 2 - Concrete Amusement Structure Pier Segment (Bent 35 – Bent 53) Item 8 - Amusement Structure Caps (Severe)

COMPONENT CONDITION RATING
Not
Included
Not
Included
Not
Included
Not
Included

5.E.b
Packet Pg. 690 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMPONENT ID COMMENTS
COMPONENT NO. ND MN MD MJ SV
AS_21 X Cracking around cap.

AS_25 X Cracking
AS_28 X Crack NW corner
TOTAL = N/A N/A N/A 3 N/ANot Included

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 2 - Concrete Amusement Structure Pier Segment (Bent 35 – Bent 53) Item 8 - Amusement Structure Caps (Major)

COMPONENT CONDITION RATING
Not
Included
Not
Included
Not
Included

5.E.b
Packet Pg. 691 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMPONENT ID COMMENTS
COMPONENT NO. ND MN MD MJ SV
AS_12 X Spalling on bottom of cap
AS_27 X Crack at SW corner
TOTAL = N/A N/A 2 N/A N/A Not Included

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 2 - Concrete Amusement Structure Pier Segment (Bent 35 – Bent 53) Item 8 - Amusement Structure Caps (Moderate)

COMPONENT CONDITION RATING
Not
Included
Not
Included
Not
Included

5.E.b
Packet Pg. 692 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV
51u 51w
X Concrete is No Damage, but steel
connector from amusement
structure has moderate rust
52w 51w
X Concrete is No Damage, but steel
connector from amusement
structure has moderate rust
50q 50s X Rust bleeds
47q 46q X Rust bleeds
42aa 41aa
X Spalling at bottom of cap and
potential full height crack
42y 41y
X Spall at top of cap due to rust from
steel plates above
41w 41y X Spalling on bottom of cap
TOTAL = N/A N/A 7 N/A N/A

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 2 - Concrete Amusement Structure Pier Segment (Bent 35 – Bent 53) Item 8 - Concrete Caps (Moderate)
COMPONENT ID COMPONENT CONDITION RATING Not Included Not Included Not Included Not Included

5.E.b
Packet Pg. 693 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

COMMENTS
START BENT NO. END BENT NO. ND MN MD MJ SV
51K 51L
Not
Included
Not
Included
X
Not
Included
Not
Included
Rust bleeds
TOTAL = N/A N/A 1 N/A N/A

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 3 - Concrete West-End Approach Pier Segment (Bent 42 – Bent 59.8) Item 12 - Concrete Caps (Moderate)

COMPONENT ID COMPONENT CONDITION RATING

5.E.b
Packet Pg. 694 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

PILE ID COMMENTS
BENT NO. / ROW NO. ND MN MD MJ SV
95C X Steel embed corrosion
93E E X Rust bleeds
Total= N/A N/A 2 N/A N/A

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 4 - West-End Platform Pier Segment (Bent 60 – Bent 103) Item 15 - Concrete Piles (Moderate)

PILE CONDITION RATING
Not
Included
Not
Included
Not
Included
Not
Included

5.E.b
Packet Pg. 695 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

AREA ID COMMENTS
AREA NO. ND MN MD MJ SV
Defect Area 13
Not Included Not Included
X
Not Included Not Included
Crack
TOTAL = N/A N/A 1 N/A N/A

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 4 - West-End Platform Pier Segment (Bent 60 – Bent 103) Item 16 - Waffle Slab (Moderate)

PILE CONDITION RATING

5.E.b
Packet Pg. 696 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

AREA ID COMMENTS
AREA NO. ND MN MD MJ SV
Defect Area 14 X Sunken deck board
Defect Area 15 X Crack in deck board all the way through TOTAL = N/A N/A 2 N/A N/A Not Included Not Included

SANTA MONICA MUNICIPAL PIER INSPECTION SUMMARY
ZONE 4 - West-End Platform Pier Segment (Bent 60 – Bent 103) Item 18 -Deck Area (Moderate)

PILE CONDITION RATING
Not
Included
Not
Included

5.E.b
Packet Pg. 697 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier–Infrastructure Inspection and Assessment Study February 11, 2020 The City of Santa Monica, CA M&N Project No. 10225
Appendix F:

Reference Documents

5.E.b
Packet Pg. 698 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
astructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
astructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
astructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
astructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
astructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
astructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
astructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
astructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
astructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
astructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier AECOM
310 Golden Shore, Suite 100
Long Beach, CA 90802
Tel: 562.308.2300
July 11, 2016
Joshua Jilk
John S. Meek Company, Inc.

Project Manager
14732 S Maple Ave,
Gardena, CA 90248
Subject: Construction Observations of Pacific Park Concrete Pile Repairs Santa Monica Pier, Santa Monica, California
AECOM Job # 60493919
Dear Mr. Jilk:

AECOM performed construction observations for the repairs of the Pacific Park support piles 53C, 46F (A) and 46F (B) located at the Newcomb Pier, at the Santa Monica Pier, in Santa Monica, CA. The observations were performed between June 8 and June 30, 2016.

The construction observation consisted of assessing pile deterioration, provide repair details and conform piles have been repaired in accordance with industry standard repair methods and procedures.

Site Layout
The piles to be repaired are located on the southern side of the Santa Monica Pier under the Pacific Park amusement park, as is shown in Figure 1. This portion of the pier is constructed using timber decking and stringers, which are supported by concrete beams and pile caps, which in turn are supported by concrete piles.

Figure 1: Aerial View of Santa Monica Pier

Pile Repair Area

5.E.b
Packet Pg. 709 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Construction Observations of
Pacific Park Concrete Pier Repairs
Santa Monica Pier, Santa Monica, California
2 Three exhibits are attached which show the layout of the columns, beams and piles. Exhibit 1 shows an overall plan of the Newcomb Pier Pile Plan. Exhibits 2 and 3 provide an enlarged plan which identifies the labeling of the individual piles.

Inspection and Repair Methods
The repair observations were performed under the supervision of a California Registered Engineer. The piles that were in the water were accessed using built-in catwalks and contractor supplied scaffolding underneath the pier.

John S Meek Company Inc. (JSM) removed loose and spalled concrete to expose the existing reinforcement. AECOM performed a visual inspection of the exposed reinforcement and concrete. Our observations indicated that the visible corrosion was mainly on the spiral ties, dowel tubes and prestressing strands. There was little corrosion on longitudinal reinforcement.

Based on the observation, AECOM provided JSM with the repair detail shown on Exhibit 4 along with the following recommended repair sequence:

1. Remove spalled and unsound concrete.

2. Clean area to be repaired of all foreign materials.

3. Where existing spiral ties are missing, severely corroded or as directed, add new W11 spiral ties @ 3 inches on center.

4. At locations where the remaining perimeter distance of sound concrete is greater than 24 inches, a partial circle W11 spiral tie shall be used and lapped with existing ties a minimumA of 10 inches.

5. At locations where remaining perimeter distance of sound concrete cover is less than 24 inches, the entire concrete cover shall be removed and full circle spiral ties shall be used.

6. The concrete cover to all new reinforcing shall be 3" minimum.

7. Existing reinforcing bars and exposed steel shall be cleaned of all rust and contaminants and then coated with a minimum of two coats of Sika Armatec 110 EpoCem and applied per manufacturer’s recommendation.

8. Encase the pile with Simpson FX-70 fiberglass jacket for a height of concrete removed plus 24 inch lap with sound concrete.

9. Top of jacket shall be dropped approximately 1/2 inch below bottom of pile cap.

10. First seal about bottom 6” with Simpson FX-70-6MP epoxy grout under gravity through fill ports in the jacket.

11. After the bottom is sealed, pump Simpson FX-70-6MP epoxy grout through fill ports in the jacket until it exits from top of jacket.

12. After grout has set and any settlement of grout has occurred, the voids in between the top of the fiberglass jacket and the bottom of the pile cap shall be completely filled with Simpson FX-763 epoxy.

5.E.b
Packet Pg. 710 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Construction Observations of
Pacific Park Concrete Pier Repairs
Santa Monica Pier, Santa Monica, California
3 Observation Findings
Pile 53C Field Observation

1. Loose and deteriorated concrete was removed over a height of approximately 3’-2”.

2. Concrete cover was removed all around the pile for about the half the length of concrete removed, and partial concrete cover was removed for the remaining length of concrete removed. See Photo No. 2.

3. Tie reinforcement, grout tube and two strands were corroded. Tie reinforcements and two strands were totally corroded. Only some parts of the grout tube were corroded and dowels could be seen.

The dowels were not corroded. No additional or supplemental reinforcing was required to account for the two deteriorated strands.

4. No observed corrosion to longitudinal reinforcing.

5. New full circle W11 Ties at 3” on center were added where entire concrete cover was removed.

6. New partial circle W11 Ties were added where concrete cover was not completely removed all around.

7. Concrete cleaned and rebar coated with Sika Armatec 110

8. Fiberglass jacket, 5’ long

9. Approx. 5 gallons of FX-70-6MP epoxy poured for bottom seal.

10. Approx. 50 gallons of FX-70-6MP epoxy pumped into the fiberglass jacket.

Pile 46F (A) Field Observation

1. Loose and deteriorated concrete was removed over a height of approximately 7’-9”.

2. Concrete removed all around the pile.

3. Tie reinforcement, grout tube and one strand were corroded. Tie reinforcements and one strand totally corroded. Only some parts of the grout tube were corroded. No additional or supplemental reinforcing was required to account for the deteriorated strand.

4. No observed corrosion to longitudinal reinforcement.

5. New full circle W11 Ties at 3” on center were added.

6. Concrete cleaned and rebar coated with Sika Armatec 110

7. Fiberglass jacket, 10’-3” long

8. Approx. 5 gallons of FX-70-6MP epoxy poured for bottom seal.

9. Approx. 36 gallons of FX-70-6MP epoxy pumped into the fiberglass jacket.

Pile 46F (B) Field Observation

1. Loose and deteriorated concrete was removed over a height of approximately 6’-0”.

2. Concrete removed all around the pile.

3. Tie reinforcement, grout tube and one strand were corroded. Tie reinforcements and one strand totally corroded. Only some parts of the grout tube were corroded. No additional or supplemental reinforcing was required to account for the deteriorated strand.

4. No observed corrosion to longitudinal reinforcement.

5. New full circle W11 Ties at 3” on center were added.

6. Concrete cleaned and rebar coated with Sika Armatec 110

7. Fiberglass jacket, 8’-2” long

8. Approx. 5 gallons of FX-70-6MP epoxy poured for bottom seal.

5.E.b
Packet Pg. 711 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 712 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

Pacific Park Concrete Pier Repair Observation - Photo Report 1 1. PILE 53C – CONCRETE REMOVED TO EXPOSE CORRODED REBAR AND STRANDS

2. PILE 53C – NEW SPIRAL REINFORCEMENT.

REINFORCEMENT CLEANED AND COATED WITH SIKA ARMATEC 110

5.E.b
Packet Pg. 713 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

Pacific Park Concrete Pier Repair Observation - Photo Report 2 3. PILE 53C – FIBERGLASS JACKET AND POUR FX70 EPOXY BASE SEALER

4. PILE 53C –FX70 EPOXY PUMPED TO TOP OF JACKET

5.E.b
Packet Pg. 714 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

Pacific Park Concrete Pier Repair Observation - Photo Report 3 5. PILE 46F (A) – CONCRETE REMOVED TO EXPOSE CORRODED REBAR AND

STRANDS

6. PILE 46F (A) – NEW SPIRAL REINFORCEMENT.

REINFORCEMENT CLEANED AND COATED WITH SIKA ARMATEC 110

5.E.b
Packet Pg. 715 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

Pacific Park Concrete Pier Repair Observation - Photo Report 4 7. PILE 46F (A) – FIBERGLASS JACKET AND POUR FX70 EPOXY BASE SEALER

8. PILE 46F (A) –FX70 EPOXY PUMPED TO TOP OF JACKET

5.E.b
Packet Pg. 716 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

Pacific Park Concrete Pier Repair Observation - Photo Report 5 9. PILE 46F (B) – CONCRETE REMOVED TO EXPOSE CORRODED REBAR AND

STRANDS

10. PILE 46F (B) – NEW SPIRAL REINFORCEMENT.

REINFORCEMENT CLEANED AND COATED WITH SIKA ARMATEC 110

5.E.b
Packet Pg. 717 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

Pacific Park Concrete Pier Repair Observation - Photo Report 6 11. PILE 46F (B) – FIBERGLASS JACKET AND POUR FX70 EPOXY BASE SEALER

12. PILE 46F (B) –FX70 EPOXY PUMPED TO TOP OF JACKET

5.E.b
Packet Pg. 718 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

Pacific Park Concrete Pier Repair Observation - Photo Report 7 13. FX 70 EPOXY – PUMP SETUP

5.E.b
Packet Pg. 719 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

Pacific Park Concrete Pier Repair Observation - Photo Report 8 14. FX 70 EPOXY – PART A AND B

15. FX 70 EPOXY – PART C

5.E.b
Packet Pg. 720 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

Pacific Park Concrete Pier Repair Observation - Photo Report 9 16. FIBER GLASS JACKET

5.E.b
Packet Pg. 721 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 722 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 723 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 724 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 725 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier 10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12
10/24 12

ATTACHMENT 1 - PIAS

5.E.b
Packet Pg. 763 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 764 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 765 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 766 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 767 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 768 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 769 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 770 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 771 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 772 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 773 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier
Architectural Conditions Assessment
submitted by
Wallace Roberts & Todd, LLC
February 8, 2008
8 5.E.b
Packet Pg. 774 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier URBAN FURNISHINGS –

TABLE OF CONTENTS
Subsection       Page Number
Assessment and Methodology………………………………………………………………………………….10 Railings………………………………………………………………………………………………………………………11 Benches…………………………………………………………………………………………………………………….14
Tables………………………………………………………………………………………………………………………..16 Trash Receptacles……………………………………………………………………………………………………..18 Curbs…………………………………………………………………………………………………………………………21
Decking………………………………………………………………………………………………………………….….22 Lighting……………………………………………………………………………………………………………………..24 Features……………………………………………………………………………………………………………………27
Quantitative Assessment Chart………………………………………………………………………………..34 Pier Sector Graphic……………………………………………………………………………………………………35 Existing Site Features…………………………………………………………………………………………………36 9 5.E.b
Packet Pg. 775 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Assessment and Methodology
The Santa Monica Pier has been an iconic element of the city since the early 1900’s. It was and still is today a space where tourists and locals congregate to enjoy sunsets, entertainment, and activities featured on the pier.

Despite the step grade, narrow sidewalks and high curb, thousands of people visit the Pier, by either walking, bicycling or driving on the Pier Bridge. They are welcomed by iconic signage that displays the Santa Monica name and logo and by informational Kiosks explaining elements on the pier to enjoy; such as the historic carousel, fi shing piers, entertaining performers and Pacifi c Park.

The idea of the pier and the history that surrounds it sets a whimsical background for those who visit it. However, over many years of harsh coastal weather, unforeseen vandalism problems, a mish mash of replacement furniture, and a lost sense of style standards, the elements on the pier no longer present a cohesive atmosphere that tie all of the pier’s characteristic icons together.

Pier Assessment and Methodology
Development on the Pier has been guided by Santa Monica Pier Design Guidelines, adopted in 1987. These Guidelines address many features found on the Pier, but give only general guidance.

WRT referred to these Guidelines during its assessment of current conditions, and noted where future recommendations about specifi c features would be warranted. It is WRT’s intent in the Architectural Conditions Assessment Report to assess the public amenities for their functionality, appearance, durability, comfort, sustainability and maintenance condition. Information and observations about these amenities will be the basis for more detailed recommendations to be formulated in coordination with the City and with input from the Santa Monica Pier Restoration Corporation and the public. The issues raised in this Report and the results of community input, will be further expanded upon and incorporated into the Sustainability Plan, the Maintenance Plan, the Lighting Plan and the Urban Design Plan.

This section looks not only at urban furnishings, but opportunities to improve specifi c areas of the Pier to enhance the public’s enjoyment of this nationally recognized community, environmental and cultural resource.

This assessment report provides the team’s analysis of the various site elements as they appeared during these site visits.

The following elements were addressed:

1. Railings

2. Benches

3. Picnic Tables

4. Trash Receptacles

5. Curbs

6. Decking

7. Lighting Fixtures

8. Special Features
The letter designations in the text refer to the Pier Sector Graphic.

4. 10

5.E.b
Packet Pg. 776 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Railings
Rail Type 1: Blue Metal Rail
Location: Primary railing, used on pier perimeter
Sector Graphic: (A, B, D, E, F, G)
Number: Approximately 4,500 Linear Feet
Quality assessment:

Materials: The railing is constructed of 3 (sometimes
4) horizontal 2” diameter steel pipe rails, with 2” diameter steel tube posts and fi ttings. All metal tubing is painted blue and appears to have been painted multiple times. Stainless steel cables have been added in the horizontal direction, centered between metal rails to create the 4” minimum clearance required by code. However, code has been updated and vertical barriers at minimum 4” O.C. have not been added.

Joints vary in diff erent sections of the railing; some are welded, while others are assembled with metal tees.

Maintenance: Paint has been chipped and repainted
multiple times. Rust appears where paint is missing, most typically in areas of concentrated fi shing activity. Metal rails require constant repainting to prevent rust, as rust can form wherever metal is exposed.* Functionality/Placement: The railing provides a safety
barrier at the edge of the pier. However, the railing no longer meets current safety requirements as there are more than 4” square openings in the rail.

Durability: Painted metal is a durable option for railing if rust is prevented.

Sustainability: There is no evidence that this railing uses low VOC paint or a renewable material. Recycled content material should be considered for this application in the event of replacement.

Comfort: While the rail provides a fairly transparent
barrier to the ocean, the steel rail is not very comfortable to lean against.
* Bill Bollinger: Pier Maintenance Supervisor. Per email dated

11.28.2007
Rail Type 1: Socket
Rail Type: Steel cables
The entire pedestrian area of the Pier is surrounded by a barrier rail with a minimum height of 42 inches. The predominant railing type is a painted blue metal post and railing. There is a section of this railing that is similar but with a wooden top rail. At the west end of the Pier there is also a painted wood and metal railing that separates the upper and lower decks and forms the stair railing. These varied railings do not create a cohesive design for the Pier. The 1987 Pier Design Guidelines recommends that the railings should be compatible with overall building design and are corrosion, graffi ti and vandal resistant. No specifi c type of rail is prescribed.

5. 11

5.E.b
Packet Pg. 777 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Rail Type 2: Blue Metal with Wooden Top Rail
Location: Southeast corner of pier
Sector Graphic: (G)
Number: approximately 1,200 Linear Feet
Quality assessment:

Materials: The railing is similar to Type 1 with the
addition of a 2x8 wooden top rail. The railing is made of 3 (sometimes 4) 2” diameter horizontal metal tubes, with 2” diameter tubular metal posts. The top rail is a stained and coated wooden 2x8 plank, heavily worn, and supported by a bracket underneath. All metal tubing is painted blue and appears to have been painted multiple times.

Stainless steel cables run horizontally only, centered between metal tubes to reduce the opening size to 4” in one direction. Joints vary in diff erent sections of railing; some are welded while others are assembled with tees and sockets.

Maintenance: In general, the paint covers the metal
railing consistently. Paint is worn and chipped in limited areas of high use especially along ramps, with rust observed where metal has been exposed. Metal tubing must be painted to prevent rust as wear requires. Wood is teak and requires pressure washing and re oiling annually in the spring. *

Functionality/Placement: The railing provides a safety
barrier at the edge of the ramp and at the deck above the volleyball court. The railing does not meet current safety requirements as there are more than 4” square openings between members.

Durability: Metal and wood are solid, durable, and
appropriate materials for this railing if the metal remains painted to prevent rust and the wood is regularly refi nished.

Sustainability: There is no evidence that this railing
uses low VOC paint or a renewable material. Recycled content material should be considered for this application as well as a recycled composite in the event of replacement.

Comfort: The rail is more comfortable to lean against
because of the wide, wooden top rail.
* Bill Bollinger: Pier Maintenance Supervisor. Per email dated

11.28.2007
Rail Type 2: Wooden Railing

6. 12

5.E.b
Packet Pg. 778 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Rail Type 3: White Rail with Green Top Rail
Location: West end of pier, on deck and staircases
Sector Graphic: (E)
Number: approximately 400 Linear Feet
Quality assessment:

Materials: This metal rail is quite diff erent than the other two rails and occurs only in a limited area at the Observation Deck at the west end of pier. The rail is made of 2” diameter painted steel posts and bottom rail, with a painted green wooden top rail. Horizontal stainless steel cables and turnbuckles have been added in the horizontal direction to limit size of openings.

Maintenance: In general, the paint covers the metal railing consistently. The paint is worn and chipped in limited areas of high use but rust was not observed. The painted wood top rail is worn and raw wood is exposed in some areas.

Functionality/Placement: The railing does not meet current safety requirements as there are more than 4” openings between members.

Durability: Metal and wood are solid, durable, and
appropriate materials for this railing if the metal remains painted to prevent rust and the wood is regularly refi nished.

Sustainability: There is no evidence that this railing uses low VOC paint or any renewable materials. Recycled composite should be considered for wood substitute as well as recycled content metal.

Comfort: The rail is more comfortable to lean against because of the wide, wooden top rail.

Rail Type 3: Green Top Rail

7. General Observations about Railings: It was observed and confi rmed by maintenance that these railings are not holding up to the standards of the pier and require too much maintenance.*
There are missing pieces,
rust and failing sections that need constant upkeep and are unappealing to pier users. A material/railing that does not rust and requires no painting will be considered and researched further by WRT. * Bill Bollinger: Pier Maintenance Supervisor. Per email dated

11.28.2007 13

5.E.b
Packet Pg. 779 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Bench Type 1: Blue Seat with White Logo Base
Location: Along promenade
Sector Graphic: (A, B, D)
Number: 29
Quality assessment:

Materials: This bench is the “standard” Santa Monica
park bench found throughout the City. The base and supports for this bench are white painted pre-cast concrete with the words “Santa Monica” stamped into the base. Seat and seatbacks are 2x4 wood slats which are been painted blue. Benches are approximately 7 feet long and accommodate 4 people. There appears to be two slightly diff erent bench types, assumed to be of diff erent eras.

Maintenance: Concrete supports require painting to
maintain a clean fi nish, wood slats require regular painting and sanding or replacement if damaged.

Functionality/Placement: Benches are located in such a
way that adjacent railings block ocean view when seated. All benches face the ocean. An option should be considered that allows benches to be oriented in other directions to take advantage of sun and people watching. These benches do not have any arm rests which makes them targets for bench sleepers.

Durability: The base is heavy, not easily moved, and very durable. The wood components may be easily defaced.

Sustainability: Recycled content material should be considered in the event of replacement.

Comfort: This bench has a straight, tall back making it more comfortable for taller users. The seat and seatback surfaces are made of wood which is more comfortable than the metal benches on the pier. However, this bench could have been more comfortable if it had more lumbar support and curve on the seating surface. The wood surface dries quickly in the marine environment.

Benches
Bench Type 1
Bench Type 2
There are currently three diff erent styles of benches on the Pier.

The blue Seat/white base benches are custom made and most predominant bench on the Pier. The other benches are prefabricated and appear to have been added at diff erent dates than the original.

The 1987 Pier Design Guidelines recommends that the benches should be compatible with overall building design and are corrosion, graffi ti and vandal resistant. No particular type of bench is prescribed. 8 .

Bench Type 2: Blue Metal Hatch
Location: West side of entrance to Pacifi c Park Sector Graphic: (C) Number: 1
Quality assessment:

Materials: This bench is a modern design and approximately 6 feet long and seats 3 adults. It is fabricated of blue painted or powder coated open grid metal, with one piece seat and back. Metal tubes on sides act as legs and armrests. It is bolted to the deck. 14

5.E.b
Packet Pg. 780 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Bench Type 2: Blue Metal Hatch Continued.

Maintenance: Routine repainting is required to prevent
rust; removal from site is required if powder coating needs to be reapplied, per manufacturer’s directions. The open metal seat prevents water from ponding on the surface.

Functionality/Placement: This bench is less likely to attract bench sleepers as it is shorter and has arm rests. This bench was observed to be very well used at all times, with high demand for seating in this area.

Durability: Rust was observed at base and near welds
where the metal has been exposed.

Sustainability: Consider recycled content and sustainable materials in the event of replacement.

Comfort: Curved seat and seatback provides lumbar support, however the grid open metal pattern is uncomfortable to sit on, especially in shorts. The curved shape of the seat and seatback is not conducive to sitting at any angle other than straight-ahead.

Bench Type 3: Victorian Bench
Location: West end of pier; Sector Graphic: (E)
Number: 2
Quality assessment:

Materials: Victorian style six foot bench that seats four adults. Bench is made of 3 ornate cast iron supports/arm rests with a composite slat board. Bench is bolted to wood deck.

Maintenance: The benches are inside the Observation
Deck and are in excellent shape. Composite boards are easily replaced if they were to become damaged.

Functionality/Placement: This bench design captures the “Victorian” character of the carousel, but does not blend well with the more rustic pier aesthetics at the western end. No other benches or site furnishings found on the Pier match this style. The bench appears lighter and less solid than the exterior benches.

Durability: Composite boards may be subject to scratching and carving. The lightweight construction of this bench appears to be much less durable than other site furnishings.

Sustainability: Composite slats could have been made of recycled content but are not identifi ed as such.

Comfort: Shape, materials, and armrests make this the
most comfortable bench on the pier.

Bench Type 3
9 .

General Observations about Benches: It was found that not only was seating insuffi cient on the pier but those which were provided did not meet aesthetic, functionality or comfort expectations. Maintenance expressed a need for at least a dozen more.*
In the Urban Design Plan, WRT, in consultation with the City and SMPRC, will identify additional locations for public seating and will give guidance about how seating should be arranged. * Bill Bollinger: Pier Maintenance Supervisor. Per email dated

11.28.2007 15

5.E.b
Packet Pg. 781 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Tables
Table Type 1: 4-foot Square Orange Powder Coated Table (seats 8) Location: Entrance to the Pacifi c Park
Sector Graphic: (C)
Number: 10
Note: Privately owned
Quality assessment:

Materials: Prefabricated outdoor picnic table, with top and seats made of vinyl coated metal mesh. The seats are attached to table top with painted tubular metal legs. An umbrella opening is provided, but none of the tables have umbrellas.

Maintenance: The vinyl coating on the tables allows the table to be easily wiped or hosed off for cleaning. However, it looked as if daily maintenance had not been performed; many tables were coated with a layer of dust and/or dirt.

Functionality/Placement: The vinyl coating defl ects
sunlight, keeping this table cooler when placed in the direct sunlight.

All of the outdoor tables are located at the entrance to the amusement park. Although this arrangement is convenient for patrons who purchase food at adjacent stands, there are no quiet places to sit at a table.

Handicap accessible tables should be made available; tables provided have permanent benches on all four sides, leaving no roll up access for persons in wheelchairs. A table with one open side or alternative table design with easy accessibility is strongly suggested.

Durability: The tables all seemed to be withstanding the ocean/salty conditions. There was no observed rust and the tables appeared to be fairly new.

Sustainability: There are no apparent sustainable aspects to these furnishings. In the event of replacement, low VOC paint, recycled content, and local materials should be utilized wherever possible.

Comfort: This is a relatively comfortable outdoor cafeteria table. The seats are wide enough to comfortably seat two adults on each bench. The edges are rounded and have a plastic coating which provides a level of safety and comfort. They generally experience rapid customer turnover.

The Pier currently has one main outdoor eating area adjacent to the main food vendors and Pacifi c Park. There are two styles of tables and they are intermingled on either side of the amusement park entrance walkway.

Table Type 1
10 . 16

5.E.b
Packet Pg. 782 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Table Type 2: Round Metal Table
Location: Entrance to Pacifi c Park
Sector Graphic: (C)
Number: 9
Note: Privately owned
Quality assessment:

Materials: Three-Foot diameter metal table with three
attached bench seats. Tables seat six adults very tightly and are more appropriate for three persons. They are colorful, with bright pink and yellow seats with white tables. Fabric umbrellas are provided at each table.

Maintenance: The metal fi nish is chipped and limited rust was observed.

Functionality/Placement: These tables are heavily utilized because they serve all the food vendors at the Pacifi c Park entrance.

It would be desirable to have more tables in this area, and designate another area on the pier where people could eat as well.

Durability: The round metal tables have some rust.

Sustainability: There are no apparent sustainable aspects to this piece of furniture. In the event of replacement, low VOC paint, recycled content, and local materials should be used where possible.

Comfort: The seat and table top are made of painted
metal. The leg room under this table is small to accommodate a group of adult users.

Table Type 2
11 .

General Observations about Tables: The existing tables provide insuffi cient seating and lack basic ADA standards. Table 1 is maintenance friendly and easy to clean, however table 2 has signifi cant imperfections mainly rust, due to inappropriate material choices. Any additional tables to be maintained by Pier Maintenance would have to be easy to clean, ADA accessible, adaptable for diff erent types of users, and aesthetically cohesive throughout the pier. New tables could possibly be an opportunity to get private owners to update their tables. Setting a standard for furniture should be enforced.
17 5.E.b
Packet Pg. 783 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Receptacle Type 1: “Barrel” Receptacle
Location: Around Pacifi c Park
Sector Graphic: (C, F)
Number: 4
Note: Privately owned
Quality assessment:

Materials: Barrel with wood staves wrapped with metal
bands and a plastic funnel lid. Wood is unfi nished. Receptacles look old.

Maintenance: The wood is unfi nished and would require
sealant to increase longevity. The plastic funnel lid (white) shows dirt easily.

Functionality/Placement: The plastic funnel lid helps to keep trash in the barrel and hidden from view; however, it is not very aesthetically pleasing. Visually, this receptacle does not match any other site furnishings found on the pier.

Durability: The metal straps around the outside of the barrel have small amounts of rust, and the screws holding these straps are rusted.

Sustainability: No sustainable elements are obvious in this furniture. Use of renewable wood could be implemented in the event of replacement.

Trash Receptacles
Trash Receptacle 1: Barrel
Trash Receptacle 2: Santa Monica logo
Trash receptacles are a necessary and important site furnishing. They should be viewed as another opportunity to strengthen the design concept and cohesion.

More recycling receptacles should be provided throughout the pier to encourage recycling. The 1987 Pier Design Guidelines recommends that the trash receptacles are compatible with overall building design and are corrosion, graffi ti and vandal resistant. No particular type of receptacle is prescribed. The Design Guidelines do require that dumpsters for the various concessions are screened. 12 .

Receptacle Type 2: Concrete Cylinder with Santa Monica Logo Location: Present in all zones on the pier.

Sector Graphic: (A-G)
Number: 45, most predominant trash receptacle on the pier Quality assessment:

Materials: Custom pre-cast light colored concrete cylinder with metal collar around center hole, as well as bronze City of Santa Monica Logo. These pre-cast receptacles are new.

Maintenance: Requires little maintenance, weight makes it diffi cult to move or take, which is why Maintenance expressed their preference for this receptacle.* There is no rust and weathering, but on-going
cleaning is necessary.

Functionality/Placement: The pre-cast concrete is a good choice for marine environments since they contain no metal and painting is not necessary.
* Bill Bollinger: Pier Maintenance Supervisor. Per email dated

11.28.2007 18

5.E.b
Packet Pg. 784 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Receptacle Type 2: Concrete Cylinder with Santa Monica Logo Continued.

Durability: The receptacle appears to be very durable concrete construction, with few signs of wear or need of for replacement.

Sustainability: No sustainable factors appear to be considered for development of this product in regard to materials. However, the long life span of the receptacle reduces need for replacement and thus reduces waste.

Receptacle Type 3: Blue Metal Trash Receptacle
Location: West end of pier (E), South edge
Sector Graphic: (F, G)
Number: 21, second most predominant trash receptacle on pier.

Quality assessment:

Materials: Fabricated blue powder coated painted metal
with vertical slats and horizontal bands. A metal liner holds the trash.

Maintenance: The receptacle is very rusted, faded and
appears dirty.

Functionality/Placement: This trash receptacle has no
lid, exposing trash to seagulls and wind.

Durability: Rust is forming where the paint has failed.

Metal looks unsubstantial for the use and marine environment.

Sustainability: No sustainable elements are associated
with this product. A recycled metal alternative should be considered in the event of replacing such furnishings.

Trash Receptacle 3: Blue Metal
13 .

Receptacle Type 4: Blue Metal Recycling Receptacle
Location: West end of pier; Sector Graphic: (E),
South edge (G)
Number: 4
Quality assessment:

Materials: Fabricated blue powder coated painted metal
with vertical slats and horizontal bands with a standard tapered formed lid, similar in style to trash can. A liner holds the recycled material. A blue and white “recycle” sign designates this bin for recycling.

Maintenance: The container was worn and not clean.

Regular repainting is required.

Functionality/Placement: Site recycle bins do not separate any recyclable materials and are not clearly labeled as to which recyclables they accept. The Pier should include more recycling stations and they should be placed along side trash receptacles. Containers that accommodate multiple recyclable materials should also be implemented. Recycled materials include, but are not limited to, newspaper, plastics, glass, food, compost, etc.

Durability: Rust is forming where the paint has failed, but with routine repainting this is a durable option.

Sustainability: No sustainable elements are associated
with this product. A recycled metal alternative should be considered in the event of a replacement.

Trash Receptacle 3: Blue Metal Recycling
19 5.E.b
Packet Pg. 785 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier 14 .

General Observations of Trash Receptacles: The most functional receptacle was the Santa Monica custom concrete designed bin. The rest are made of corrosive materials that don’t match, are hard to maintain and are easily vandalized or stolen. WRT will look into receptacles similar to the Santa Monica concrete variety and suggest additional opportunities for placement. Additional recyclable bins are also suggested that match the current receptacles. Providing adequate and appropriate receptacles will help to keep the pier clean.

Receptacle Type 5: Recycled Content Receptacle
Location: In enclosed observation deck (E)
Number: 1
Quality assessment:

Materials: Made of 100% recycled content plastic
boards that match the adjacent bench with cast iron details.

Maintenance: The receptacle is inside the enclosed observation deck and is in excellent shape. Composite boards can easily be replaced if they were to become damaged.

Functionality/Placement: This receptacle design captures the “Victorian” character of the carousel, but does not blend well with the more rustic pier aesthetics at the western end. The receptacle appears lighter and less solid than the exterior receptacles.

Durability: Composite boards may be subject to
scratching and carving. The lightweight construction of this receptacle appears to be much less durable than other site furnishings located outside.

Sustainability: Receptacle is made of 100% recycled
content plastic boards.

Trash Receptacle 5: Recycled Content Receptacle
20 5.E.b
Packet Pg. 786 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Curb Type 1: 6x6 Wood Timber Curb – Painted Yellow
Location: Central Walkway; Sector Graphic: (A, B); South Parking area (G) and used for wheel stops in parking area.

Number: approximate 200 Linear Feet
Quality assessment:

Materials: Painted wood timber.

Maintenance: Repainting required on a regular basis.

Functionality/Placement: This curb defi nes the maintenance/fi re lane. This curb off ers no aesthetic benefi t to the pier experience and could pose a tripping hazard.

Durability: The timber appears durable enough to satisfy function though edges of wood are becoming worn and repainting is necessary to maintain color.

Sustainability: Any wood used should comply with sustainable forestry practices. Alternative renewable materials should be considered, such as a high recycled content composite.

Curb Type 2: 8x10 Wood Timber Curb – Painted Red
Location: Central Walkway; Sector Graphic: (A, B)
Number: approximate 200 Linear Feet
Quality assessment:

Comfort: N/A
Materials: Painted Wood timber.

Maintenance: Repainting required on a regular basis
Functionality/Placement: Curb required for traffi c management and directs vehicular traffi c into parking lot. These curbs off er no aesthetic interest to pier experience and pose a tripping hazard for pedestrians.

Durability: The timber appears durable enough to satisfy function though edges of wood are becoming worn and repainting is necessary in places.

Sustainability: Any wood used should comply with sustainable forestry practices. Otherwise alternative renewable materials should be considered, such as a high recycled content composite.

Curbs
The curbs found on The Pier are made of heavy timbers which have been bolted to the decking. These timbers serve to guide traffi c and defi ne the fi re lane. Curbs are not defi ned in the 1987 Design Guidelines but the Guidelines do require timber wheel stops.

Curb Type 1: Yellow
Curb Type 2: Red
15 .

General Observations about Curbs: It was concluded that the curbs’ biggest weakness was its upkeep of repainting and replacement.* They function properly, however WRT will look into opportunities to cut down on maintenance on this element of the pier.**
* Bill Bollinger: Pier Maintenance Supervisor. Per email dated

11.28.2007
21 5.E.b
Packet Pg. 787 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Decking
The pier’s top decking material is made up primarily of 2x12 pieces of lumber. In most places the decking runs perpendicular to the edge of the pier, however, there are areas where the planks are mounted diagonally at a 45 degree angle to the sides of the pier. The 1987 Design Guidelines require exposed wood decking for all pier walkways, access and service drives and parking areas.

Decking Type 1: Pedestrian Areas
Location: All wood areas for pedestrian use; Sector Graphic: (A-G) Area: approximately 180,000 Square Feet
Quality assessment:

Materials: Exposed 12” wide pressure-treated wooden
decking planks, unfi nished.

Maintenance: The wood planks were generally in good
condition. There were no signifi cant gaps identifi ed, and it appears that where gaps had occurred, they had been corrected. Wood decking requires routine washing, sealing (except for pressure treated wood), and replacement as necessary due to wear and exposure.

Functionality/Placement: When well cared for wood
decking makes for an enjoyable and marine oriented walking surface.

Durability: The decking shows limited wear in the pedestrian areas. Challenges for wood decking include the variability of wood products, twisting, warping, splitting, etc. Also, wear of deck can leave hazardous exposed nails. Deck boards should be replaced when nails are exposed.

Sustainability: Any wood used should comply with sustainable forestry practices. Otherwise alternative renewable materials should be considered, such as a high recycled content composite.

Comfort: The wood decking is comfortable to walk on
provided it has been adequately maintained.

Decking Type 1: Pedestrian
Decking Type 2: Asphalt 16 .

Decking Type 2: Asphalt covered decking
Location: Central Walkway; Sector Graphic: (B)
Area: approximately 5,400 Square Feet
Quality assessment:

Materials: Asphalt coated wood deck with corrugated
metal panels
Maintenance: Occasional cleaning is required, along with routine repainting of the stripes.

Functionality/Placement: The metal sheets appear to
cover a mechanical chase. An alternative to this design is desired as this option is inconsistent with the requirement of the Design Guidelines. 22 5.E.b
Packet Pg. 788 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Decking Type 2: Asphalt covered decking continued.

Durability: The asphalt was cracking and showing signs of wear.

Sustainability: Materials more sustainable than asphalt and steel should be used where available.

Comfort: The asphalt rises above the level of the wooden deck and creates an uneven surface. The corrugated metal sheets are uncomfortable to walk on due to their uneven surface. Pedestrians did not appear to prefer to walk on this surface unless necessary.

Note: Asphalt covered decking and corrugated metal panels are scheduled to be removed and replaced with wood decking.* General Observations about Decking: We have identifi ed that there are/were signifi cant gaps in the decking. Large areas of repair have been corrected by maintenance by replacing said areas with “patches” of decking. However, overall decking was in good shape on the main walk. And it was noted that there are plans to replace decking with 3” thick boards, instead the 2” boards that are currently used. ** Therefore, gaps and general repairs will be reduced. Sealing of decking is not necessary due to the fact that the boards are pressure washed.*** The painted parking lines wear and fl ake and need to be repainted several times each year. WRT will make recommendations to be included in the Maintenance Plan about alternative approaches to striping parking lots with more durable materials
* Bill Bollinger: Pier Maintenance Supervisor. Per email dated 11.28.2007 ** Bill Bollinger: Pier Maintenance Supervisor. Per email dated 11.28.2007 *** Todd: Gemni Forest Products
Decking Type 3: Parking lot and vehicular traveled decking Location: Parking Deck; Sector Graphic: (G)
Area: approximately 83,000 Square Feet
Quality assessment:

Materials: Pressure treated wooden decking planks, 12” wide, painted with parking lot striping.

Maintenance: These areas appear to have been replaced at diff erent times. Decking should be replaced where cracks and gaps pose a hazard.

Re-striping should also occur on a regular basis to ensure a cohesive fl ow within the lot.

Functionality/Placement: The parking deck planks appear uneven and worn when compared to “pedestrian only” areas. The boards are spaced further apart and in many cases greatly exceed ¼” between fl oor boards.

Durability: The vehicular decking is signifi cantly more worn than pedestrian decking due to heavy and constant use. Raised knots and nails were observed. Typical challenges of wood decking include dealing with variability of wood products, twisting, warping, splitting, etc. .

Sustainability: Any wood used should comply with sustainable forestry practices. Otherwise alternative renewable materials should be considered, such as a high recycled content composite.

Comfort: The uneven surface is bumpy while driving in a car.

Decking Type 3: Parking Lot
17 . 23

5.E.b
Packet Pg. 789 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Lighting
There are fi ve diff erent lighting fi xtures existing on the Pier. They are of assorted designs and styles and various heights. Lighting is predominant on the perimeter of the pier, and less prevalent in the parking lot or central areas. The majority of the lighting fi xtures appear to be of diff erent vintages and some are in questionable or non-working condition. (Observed at nighttime, about 20% of the lights were not lit). The Pier lacks a coherent theme in lighting and a consistency in fi xtures. The Design Guidelines dictate that there is a minimum of 4 footcandles and a maximum of 8 footcandles in lighting levels. Style and fi xture type is not prescribed but recommends that the fi xtures are compatible with overall building design and are corrosion, graffi ti and vandal resistant.

Lighting Type 1: Cobra Head Light Fixture
Location: First 100 feet of Central Walkway
Sector Graphic: (A)
Number: 12
Quality assessment:

Materials: Standard cobra head fi xture made of metal
with glass lamp cover on a painted white metal pole, 18 feet high.

Maintenance: Routine replacement is required for expired bulbs. Painted white metal poles need annual painting and occasional cleaning, and maintenance has confi rmed that painting the tall lights is not a problem with the use of a crane.*
According to Bill
Bollinger, the Pier Maintenance supervisor, there was a previous desire to replace the 26” Cobra Head” lights with the other ornamental lights along the rest of the deck.

Functionality/Placement: Tall overhead lighting serves to illuminate the main path; however they provide no pedestrian ambiance on the pier at night. Lights of this style are generally associated with vehicular traffi c and parking. This lighting arrangement is not appealing for a pedestrian oriented walking space.

Durability: Many of the Cobra head light poles are severely rusted and the bases are weakened by the corrosive environment.

Sustainability: Fixture should use an effi cient, low wattage lamp where possible. Also poles should be made of renewable, high recycled content materials.
* Bill Bollinger: Pier Maintenance Supervisor. Per email dated

11.28.2007
Lighting Type 1: Cobra Head
18 . 24

5.E.b
Packet Pg. 790 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Lighting Type 2: Grey Arched Light Fixture
Location: Succeeds the cobra head fi xture down the second half of the pier, wraps around the observation deck,
and continues down the east side of the deck. Sector Graphic: (A, B, D, E, F) Number: 40
Quality assessment:

Materials: Ornate metal light pole, 15 feet, is painted grey with a tear drop shaped glass lamp cover, in a “historic” style. Hanging banner or pot hooks are provided, however there were no banners or fl ower pots observed.

Maintenance: The fi xtures appear relatively new and in good condition. They require routine replacement for expired bulbs. Grey poles may need occasional cleaning and repainting.

Functionality/Placement: The poles are spaced at
approximately 40 feet on center. Light levels felt safe and comfortable for the pedestrian, when operating. The shorter fi xture has a more human scale and seems to fi t in with the character of the Pier better. This pole is more ornate than the other fi xtures on the Pier, with curvilinear appendages and unique globes. The dark color hides dirt and blemishes better than the white poles.

Durability: These light poles are durable and showed few signs of rust. Provided adequate attention is given to regular painting these poles should remain durable.

Sustainability: The fi xture should use an effi cient, low wattage lamp where possible. Also poles should be made of renewable, high recycled content materials.

Lighting Type 3: Wooden Light Fixture
Location: Observation/fi shing decks. Located around the observation deck and the lower fi shing decks; Sector
Graphic: (E)
Number: 7
Quality assessment:

Materials: 8x8 wooden pole, 15 foot tall, with wood cross arms supporting two metal light fi xtures. Fixtures appear to be sodium vapor (orange glow) at night.

Maintenance: The wood is weathered and pressure treated.

Maintenance is necessary to prevent the wood from becoming weathered looking.

Functionality/Placement: The design of this fi xture has horizontal arms which provide bird roosts. Bird repellent measures (“bird spikes”) appear to be an after market addition. The fi xture is a box “spotlight” style that provides little aesthetic character.

Durability: The wooden pole is very weathered looking.

It also has a shorter lifespan than its metal counterparts and more susceptible to vandalism; concrete or fi berglass may be more desirable for durability.

Sustainability: The fi xture should use an effi cient, low wattage lamp wherever possible. Also poles should be made of renewable and high recycled content materials.

Lighting Type 2: Arched Fixture
Lighting Type 3: Wooden Fixture
19 . 25

5.E.b
Packet Pg. 791 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Lighting Type 4: Box Light Fixture
Location: Illuminates the perimeter of the southern parking deck; Sector Graphic: (G) Number: 7
Quality assessment:

Materials: 8x8 painted wooden pole (teal green), 20-25 feet tall with a dual, box light fi xtures mounted at top. An additional light fi xture is provided shining onto beach.

Conduit runs outside the pole with exposed junction boxes. Bird spikes are provided to prevent roosting.

Maintenance: The wooden pole is in need of new paint, as it is noticeably peeling. Because it is wood, regular maintenance and upkeep will require the light to function at its best.

Functionality/Placement: The lights illuminate the perimeter of the parking lot, but there is a lack of lighting in the middle of the deck.

Durability: The wood is worn and requires regular painting to maintain fi nish.

Sustainability: The fi xture should use an effi cient, low wattage lamp where possible. Also poles should be made of renewable and high recycled content materials.

Lighting Type 5: Bell Shaped Light Fixture
Location: Eastern edge of pier near Carousel; Sector Graphic: (G) Number: 8
Quality assessment:

Materials: Gray/green painted round metal pole with 2 bell-shaped fi xtures on arched posts mounted at top of pole. Poles are approximately 15 feet high.

Maintenance: The painted poles are well worn and scratched. The inside of fi xture is very rusted.

Functionality/Placement: When observed at night, these lights provided a comfortable level of light for pedestrians. There did not appear to be “hot” bright areas or deep dark areas in this area by the carousel. The light poles are appropriately scaled to function in a human scale/promenade experience. However, these lighting fi xtures are not consistent in style with any other fi xture on Pier. They are located in only one corner of the deck instead of being integrated into the rest of the design.

Durability: The metal seems to be very durable for this situation if painted surface is maintained to prevent rust.

Sustainability: The fi xture should use an effi cient, low wattage lamp where possible. Also poles should be made of renewable and high recycled content materials.

Lighting Type 4:

Box Light Fixture
Lighting Type 5:

Bell Fixture
20 .

General Observations of Lighting: Some of the lighting featured on the pier have the festive character the pier desires, where others are more utilitarian in nature. Because of the many diff erent lighting styles, no overall lighting feature contributes substantially to the pier’s character. The Type 2 Arched Fixture is the most in keeping with the desired historical compatibility and pier character but its limited use does not promote a consistent image. Currently the varied fi xtures create a variety of maintenance concerns, including corrosion in the ocean environment, bird perches, and the need for repainting. WRT has noted that a comprehensive and cohesive lighting fi xture will substantially contribute to the urban design character of the pier as well as create uniform maintenance requirements and uniform light levels. 26 5.E.b
Packet Pg. 792 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier While these items were not identifi ed in the scope of the Urban Design assessment and therefore not investigated to the same level as the previous items, they were observed as critical to the pier’s character and environment. These items are included here to further address the additional features that make up the urban context.

Features
Feature Type 1: Telescopes
Location: Along the northern edge of the Central Walkway; Sector Graphic: (B, D)
Number: 11
Quality assessment:

Materials: Grey painted prefabricated metal pedestals
mounted to pier decking, with a step for child’s use.

Maintenance: Moderate rust was observed. Routine
cleaning and occasional repainting is required for upkeep.

Functionality/Placement: We noticed many of the
telescopes were in use every time we visited the pier. Telescopes look out towards the beach, water, City of Santa Monica, and Santa Monica Mountains in the distance.

Durability: The telescopes appear to be high grade and
appropriate for this application.

Sustainability: No particular sustainable elements
apparent in this feature.

Feature Type 2: Designated Smoking Areas
Location: Four locations throughout the pier, two on the observation deck, one on the western edge and
southern edge of amusement park adjacent to railing.

Sector Graphic: (D, E, F, G)
Number: 8
Quality assessment:

Comfort: The platforms allow for a designated place to
smoke. Smoking is prohibited on other parts of the pier.

Materials: The grey painted plywood sheet with smoking
urn sits directly on pier decking.

Maintenance: The platform requires regular painting and clean up of garbage around smoking area.

Functionality/Placement: Smoking will be banned from
beach in the future which would eliminate the need for this element.

Durability: Smoking stations appear to address a
designated need but are not integrally designed as part of the pier.

They appear to be a temporary solution.

Sustainability: No sustainable elements in existing
feature.

General Observations of Smoking Areas: Recommendations for more compatible smoking receptacles and smoking areas will be identifi ed in the Urban Design Recommendations.

Feature 1: Telescope
Feature 2: Smoking Areas

21. 27

5.E.b
Packet Pg. 793 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Feature Type 3: Fishing Utilities
Location: Lower level fi shing decks at east end of pier Sector Graphic: (E, D)
Number: 3 Sinks
Quality assessment:

The Design Guidelines identifi es that cutting boards,
cleaning sinks and railings shall be consistent and compatible with the rest of the pier. It also suggests that “new construction at fi shing pier shall also evoke whimsy and fantasy.” There is no whimsy or fantasy in these utilitarian services.

Materials: Wooden 12x24 fi sh cutting boards are located at various random intervals along the metal rail. The wood is untreated and heavily carved. Three free-standing pre-fabricated stainless steel sinks with fi sh cleaning stations.

Maintenance: The wooden cutting boards are easy to
detach and replace when necessary. The metal sink design is simple and easily cleaned using a hose.

Functionality/Placement: Sinks and water source are
easily accessible at all lower fi shing decks. Currently sinks are provided as well as wooden cutting boards attached to existing railings. There are also movable aluminum garbage bins for use by fi shermen.

Durability: Perhaps more permanent trash receptacles
could be designed for use by fi shermen specifi cally. Stainless steel sinks seem to be very high quality and used heavily. Amenities need to be durable due to heavy use of the pier by fi shermen.

Sustainability: No sustainable elements noted in existing features.

Feature Type 4: Planters (belong to restaurant-private property) Location: Near entrance to Pacifi c Park (C) and near restaurant at end of pier (E); Sector Graphic:

Number: 4
Quality assessment:

Design Guidelines: The Design Guidelines include a
statement that landscape features shall be minimized and not compete with the architecture. Species shall be compatible with the beach environment.

Materials: One wood and three plastic pots
Maintenance: Maintained adequately by concession.

Functionality/Placement: Planters can be a very pleasing site amenity; however this has not been executed successfully due to a lack of coherency.

Durability: Wood or heavy plastic planters are
appropriate and durable materials for this application. Existing planters were not in need of replacement or refurbishing.

Sustainability: Wood, especially harvested using
responsible forestry techniques, is a preferred alternative over plastic unless it is a recycled plastic product.

Feature 3: Fishing Utilities
Feature 4: Planters
22 . 28

5.E.b
Packet Pg. 794 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Feature Type 5: Bike Racks
Location: Four locations with three diff erent styles of bike racks:

A row of two standard metal racks on the west side of
Pacifi c Park, one metal “low profi le” rack next to the restaurant at end of pier, one “wave” rack just east of the Carousel, and one “wave” rack at beginning of the
pedestrian walk; Sector Graphic: (D, E, F, G)
Number: 5 racks total
Quality assessment:

Materials: Metal, Blue Paint
Maintenance: Some rust on bike racks where not
painted.

Functionality/Placement: The bike rack at the entrance
of the pedestrian walk has room for eight bikes and was full upon one observation; consideration should be given to adding more parking spaces at this location. The rack at the west end of the Pier has room for eight bikes; two bikes were parked at this rack. “Low profi le” racks are less desirable because they do not support the bike on its frame; bikes to fall over more easily in this style of rack. There were no bikes parked at the other three rack sites. Effi cient rack system would help encourage fi sherman and pier visitors to use bicycle transportation.

Durability: With proper paint, bike racks should be able to survive the pier climate with little rust damage. Painted bike racks are easily scraped by bikes and locks. Stainless steel is more durable and will not rust but is more expensive.

Sustainability: Bike racks encourage non-motorized
transportation. Recycled content metals should be used wherever possible.

General Observations: Bike valet stations were introduced to the Pier in 2007 during the Twilight Dance Series and were very popular. The Urban Design Study will address possible locations for bicycle valet stations.

Feature 5: Bike Racks
23 .

Feature Type 6: Security Barriers
Location: The City installed approximately 3’x3’x3.5 boxes around the Pier.

Quality assessment:

Materials: Wood, and fi lled with sand
Maintenance: Originally, Pier Maintenance planted plants in the boxes, but the water damaged the deck boards, so the plants were removed and plywood was placed on the tops.

Functionality/Placement: Sited to create a traffi c barrier.

General Observations: These security barriers are large, and block pedestrian fl ow. Bollards that require little maintenance could serve the pier better and are recommended in the pier guidelines. If planters are to be used, we suggest that they follow the design guidelines.

Feature Type 6: Security Barriers
29 5.E.b
Packet Pg. 795 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Feature Type 7: Parking Kiosk and Pedestrian Access
Location: The kiosk to the parking lot is located at the entrance to the Newcomb Deck. A pedestrian walkway, designated by chain link and raised curbs, leads pedestrians to and from the Newcomb Deck to the Municipal Pier.

Quality assessment:

Functionality/Placement: The pedestrian path,
designated by a chain link fence, is not in character with the pier and appears temporary, but the function is appropriate for protection from vehicular activity. Options such as bollards and diff erential fl ooring material can serve the same purpose and create a safe walking space for pedestrians. The Design Guidelines state that the pier is to develop a unique, pedestrian oriented environment with ease of access and user friendliness as a prime design consideration. Improvements to the pedestrian circulation will create a better pedestrian environment.

General Observations: The pedestrian walkway presents an opportunity to improve the ambiance of the Pier and create a walkway that adheres to the goals of the Design Guidelines. These goals encourage improvements that relate to the Pier and create a safe, functional and appealing circulation path and entrance to the Pier for both vehicles and pedestrians.

Feature Type 7: Parking Kiosk
Feature Type 8: Observation Deck
Location: At the west end of the Pier
Number: l
General Observations: The Observation Deck at the west end of the Pier is a rarely used resource. It is an enclosed area and access is from a staircase or by an elevator. The Observation Deck is furnished with benches and a trash can and is painted red and green, which is complementary to the adjacent Mexican Restaurant, but not to the public nature of the Pier. The Santa Monica Pier Restoration Corporation Staff has indicated that they will install historic displays in this area as part of the Pier’s 100th Anniversary. Selection of paint colors, repair of windows, replacement of light fi xtures, and installation of seating and tables would add to the ambiance. Guidance about how to treat this area will be included in the Urban Design Study.

Feature Type 8: Observation Deck
24 . 30

5.E.b
Packet Pg. 796 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Feature Type 9: Display Cases
Location: Display cases are located near the Police Sub-station and the elevators at the west end.

Quality assessment:

Maintenance: Unless display cases are cleaned regularly and the material updated, they give an appearance of neglect.

Functionality/Placement: Their current location is not
an ideal spot for visitors to congregate and read. The displays are right outside of the bathrooms, they are up a level of stairs and not easily accessible to everyone, and they are tucked away out of view.

General Observations: Display cases create an opportunity to share important information about the Pier, businesses and current activities.

When part of a regular program, they create interest and educate Pier visitors.

Feature Type 9: Historic Display Cases
Feature Type 10: Pier Skirting
Location: Around the pilings of the pier where pedestrian accessibility is an issue
Quality assessment:

Materials: wood fencing

General Observations: The skirting was constructed to prevent unauthorized access under the pier and security, while the existing Design Guidelines suggest whimsical treatment. Our observation is that the skirting/fencing should not compete with the festive activity on the pier and should remain ‘background’.

Feature type 10: Pier Skirting
25 . 31

5.E.b
Packet Pg. 797 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Feature Type11: Outdoor Dining Barriers
Location: Outside Pacifi c Park dining areas and restaurant located on the west end of the pier. These structures are privately maintained.

Quality assessment:

Functionality/Placement: Serve their purpose of
sectioning off and privatizing the eating spaces.

General Observations: Each restaurant on the Pier provides barriers for its outdoor dining. The Design Guidelines state that development of exterior dining, lounge and vending areas is strongly encouraged.

However to match the architectural standards of the guidelines they should still retain the whimsical character that matches the rest of the architecture, which the current barriers do not. Although these are privately constructed barriers around the tenants’ leasehold areas, they are highly visible feature of the Pier. The Urban Design Study will provide guidance about alternative designs for barriers that enhance the ambiance of the Pier.

Feature Type 11: Restaurant barrier
Feature Type 12: Gazebos
Location: Newcomb Deck, at the southeast corner of the Pier.

Number: 2
Quality assessment:

Materials: Steel, same as railing system
Maintenance: Same maintenance and material as the
railings. Yearly painting and touch-ups.

Functionality/Placement: Main seating for the volleyball courts is provided by the bleachers to the south of the parking lot. While the gazebos fi t in with the character of the pier, they are architectural “follies”.

General Observations: The Gazebos were intended to be rest areas for visitors, but lack seating, cover and functionality. In consultation with the City the Urban Design Study, will make recommendations as to how these amenities can be enhanced.

Feature Type 12: Gazebo
26 . 32

5.E.b
Packet Pg. 798 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Feature Type 13: Signage
Location: Along deck. More concentrated at west end.

Quality assessment:

Functionality/Placement: WRT noticed a lack of signage
for bathroom locations and overall directional signs. Regulation signs were noticeable and suffi cient. The main Kiosk is large but placed off the main path. It provides visitors with useful information but seems to go unnoticed by many visitors.

General Observations: Signs advising the public about acceptable rules of conduct on the Pier (e.g. no diving, no alcohol, etc.) are placed throughout the Pier. These signs are of metal, about and were installed in 2007. Consolidation of information on these signs has reduced clutter. A diff erent location for the pier’s informations kiosk should be considered as well as a more inviting display around it to attract visitors. The Urban Design Study will recommend an expansion of the signage program and kiosk display.

Feature Type 13: Pier Visitor
Conduct Signs
Feature Type 13:

Visitor Kiosk
27 . 33

5.E.b
Packet Pg. 799 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier SANTA MONICA PIER ASSESSMENT- Quantitative Assessment Chart SECTOR OF PIER ASSESSED (Based on Graphic)
SITE FEATURE A B C D E F G Total NOTES
Railing
Blue Metal 5 14 6 4 29 Metal tubing, painted blue, stainless steel cable, metal socket joints Blue Metal with Wooden Top Rail 5 14 6 4 29 Metal tubing, painted blue, stainless steel cable, wooden 2x6 railing White with Green Top Rail 5 14 6 4 29 Painted wood seat boards, painted white concrete base Benches
Blue seat/White base 5 14 6 4 29 Painted wood seat boards, painted white concrete base Blue metal 1 1 Prefabricated, powdercoated, blue metal
Wooden/black metal 2 2 Composite board seat, painted black metal frame total 32
Tables
Orange/metal 10 10 Plastic coated metal mesh
Round/Colored seats 9 9 Prefabricated, painted metal
total 19
Trash Receptacles
Imitation "Barrel" 31 4 Wood staves, metal bands
Concrete Cylinder with SM Logo 5 14 13 6 5 2 45 Custom made, bare cast concrete, metal logo, "Santa Monica" lettering Blue Metal Recycling 11 1 1 4 Metal vertical slats, horizontal metal bands, painted blue,"Recycle" sign Blue Metal 4 6 11 21 Metal vertical slats, horizontal metal bands, painted blue total 74
Curb
Wood Timber Curb - Painted Yellow Bolted down timber 4x4's, painted yellow Wood Timber Curb - Painted Red Bolted down timber 4x4's, painted red total
Decking
Pedestrain Areas Untreated wooden decking boards
Asphalt Covered Decking Asphalt and corrugated metal panels Parking Lot and Vehicular Decking Wooden decking boards, painted parking lot striping total
Lighting
White/Cobra Head 27 2 11 Standard cobra, metal pole, painted white, glass lamp, 18' high Grey/Single Curved 9 17 14 40 Metal pole, gray, tear drop glass lamp cover, 15' high Wood/Double Head 3 3 Wooden pole, metal fixture
Shoe Box/deck parking 52 7 Wooden pole, box light
Green/Curved/ Bell 8 8 Metal pole, gray/green paint
total 69
Features
Telescopes 11 Grey painted prefabricated metal pedestals Smoking Areas 2222 8 Grey painted plywood sheet with smoking urn Fishing Amenities (sinks) 21 3 Wooden fish cleaning platforms, stainless steel sinks Planters 21 3 An assortment of wood and plastic pots
Bike racks 121 4 Metal, blue paint
34 SANTA MONICA PIER ASSESSMENT *A-Pier Entrance
-Extends from Bridge entrance to parking lot entrance
*B-Pier (First Half)
-Section of Asphalt topped pier
*C-Amusement Park Entrance
*D-Pier(Second Half)
-End of fi rst half of pier to the observation deck
*E-Observation Deck
-Bo
*F-West and South deck
-Deck behind and to the west of the amusement park
*G-Parking Deck
Legend
Pier Sectors
35 Trash Receptacle
Blue Metal-recyclable
Located full length
of Pier
-4 Total
Railings
Railing top
Located full length
of Pier Lighting
Wooden pole fi xture
Located around
perimeter of deck at end
of pier only
-3 Total
Bench
Wooden Bench (trex)
Located inside site deck
-2 Total
Trash Receptacle
Santa Monica Pier Custom
Located full length of Pier
-45 Total
Lighting
White overhead fi xture
Located along fi rst half of pier
-12 Total
CurbWooden Curb (painted red)
along Pier and Deck. By
Amusement park.

Curb
Wooden Curb
(painted yellow)
along Pier
and Deck. By
amusement
park.

Bench
Wooden Bench- Santa
Monica Custom
Located along
entire
stretch of
pier
-29 Total
Table
Round table with Umbrella
Located by amusement
park only
-9 Total
Table
Coated Metal Table
Located by amusement
park only
-10 Total
Lighting
Grey arched
fi xture
Located
along
second half
of pier and
west deck
-40 Total

SANTA MONICA PIER ASSESSMENT
Curb
Wooden Curb (painted yellow)
along parking deck only
Lighting
Grey Deck Fixture
Located on east deck only
-8 Total
Railings
Wooden Railing top
Located on east deck
only
Railings
Wooden Railing top for
ramp
Located on east deck
only
Decking
Decking at transition
across bridge
*A-Pier Entrance
-Extends from Bridge entrance to parking lot entrance
*B-Pier (First Half)
-Section of Asphalt topped pier
*C-Amusement Park Entrance
*D-Pier(Second Half)
-End of fi rst half of pier to the observation deck
*E-Observation Deck
*F-West and South deck
-Deck behind and to the west of the amusement park
*G-Parking Deck
Fact and Figures
(Approx... Quantities)
Trash Receptacles
Wooden Barrel-4 Total
Located all within
the amusement park
entrance
-4 Total
Bench
Metal coated bench
Located along the
west side of the
deck
1 Total
Trash Receptacle
Blue Metal
Located south deck
and parking lot
-21 Total
Smoking Pad Designated
smoking areas
throughout pier
and deck
-4 Total
Lighting
Grey Parking Deck Fixture
Located in deck parking lot only
-7 Total
G
F
B
Amusement Railings Park
Boards
designate
fi shing locations.

Railings
Stair railings
Located at end
of pier only
D
E
Decking
Worn and separated boards
on the parking deck.

Signage
Fishing is
allowed only
at designated
areas on the
pier.

A
C
Metal Pier
Access to underside of pier.

Extends length of pier.

Parking Lot
Entrance
Observation
Tower
Benches
Tables

DESCRIPTION QUANTITY STYLES
Trash Receptacles
Lighting
32 19
74 69
3 2
4 5
Legend
Planters
Assorted pots
-3 Total
Sinks
Sinks and cleaning
stations are
provided in fi shing
designated areas
- 3 Total
Bike Racks
Two styles, many
unused
-4 Total
Existing Site Features
36 5.E.b
Packet Pg. 806 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 807 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 808 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 809 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 810 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 811 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 812 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 813 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 814 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 815 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 816 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 817 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 818 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 819 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 820 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 821 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 822 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 823 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 824 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 825 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 826 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 827 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 828 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 829 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 830 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 831 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 832 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 833 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 834 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 835 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 836 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 837 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 838 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 839 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 840 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 841 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 842 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 843 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 844 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 845 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 846 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 847 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 848 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 849 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 850 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 851 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 852 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 853 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 854 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Santa Monica Pier Infrasturcture Assessment
Phase 2 – Upgrade Studies
Table of Contents
Subject Page
EXECUTIVE SUMMARY………………………………………………………………… ii
NEWCOMB PIER STRUCTURAL UPGRADE………………………………………….. ..1
AQUARIUM ROOF ASSESSMENT……………………………………………………... 12
MUNICIPAL PIER PHASE 4 UPGRADE………………………………………………... 14
MUNICIPAL PIER CONCRETE UPGRADE (Seaward of Bent 59) ……………………. 16 EMERGENCY GANGWAY……………………………………………………………… 18
CAROUSEL CUPOLA ONION DOME………………………………………………….. 25
FIRE PROTECTION SYSTEM…………………………………………………………… 29
UTILITY SYSTEMS……………………………………………………………………… 45
LIGHTING STUDY……………………………………………………………………….. 49
TEN-YEAR PLAN………………………………………………………………………… 66
URBAN DESIGN STUDY (WRT)…………………………………………...APPENDIX A
i

5.E.b
Packet Pg. 855 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 856 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 857 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 858 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 859 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 860 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 861 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 862 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 863 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 864 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 865 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
er Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
er Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
er Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 869 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 870 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 871 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 872 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 873 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
er Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 875 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 876 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 877 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 878 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 879 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 880 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 881 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 882 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 883 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 884 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 885 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 886 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 887 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 888 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 889 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 890 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 891 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 892 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 893 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 894 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 895 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 896 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 897 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 898 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 899 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 900 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 901 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 902 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 903 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 904 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 905 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 906 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 907 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 908 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 909 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 910 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 911 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 912 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 913 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 914 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 915 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 916 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 917 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 918 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 919 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 920 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 921 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 922 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 923 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier 67 5.E.b
er Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

APPENDIX A

URBAN DESIGN STUDY (WRT)

5.E.b
Packet Pg. 925 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier This document is a part of the Santa
Monica Pier Infrastructure Assessment Study to assist in the development of the City of Santa Monica’s multi-year Capital Improvement and
Maintenance Program, led by Moffat
& Nichol.

Wallace Roberts & Todd, LLC
Planning and Design
1133 Columbia St., #205
San Diego, CA 92101
November 17, 2008
Santa Monica Pier Assessment
Recommendations Report
for Urban Design Elements

5.E.b
Packet Pg. 926 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 927 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier 1 Introduction 2 Methodology 3 Reccomendations 4 Site Furnishings contents
21 Carousel Building Roof

5.E.b
Packet Pg. 928 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Elizabeth R. Sedat Collection

5.E.b
Packet Pg. 929 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier 1 The Santa Monica Pier has been an iconic element of the City and region since the early 1900’s. Unique among California piers, the Santa Monica Pier, its
history and activities, are a classic yet – whimsical stage welcoming tourists and locals alike. However, over many years of harsh coastal weather, active urban use and the addition of an eclectic mix of site furnishings (benches, lighting, trash receptacles, etc) the Pier no longer presents a cohesive atmosphere worthy of Santa Monica. This set of recommendations, based on an assessment of current conditions, is intended to guide the choices for the selection of new and replacement furnishings.

Introduction

5.E.b
Packet Pg. 930 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier 2 The fi rst step in the process was to
review the Santa Monica Pier Design
Guidelines (Guidelines), adopted
in 1987. The Guidelines provide a
general vision for the character of the
buildings and furnishings and allow
fl exibility in accomplishing its goals.
methodology
WRT then interviewed City staff
from maintenance, public safety and
operations. The Assessment of Existing Conditions was conducted in late 2007 and presented to the Santa
Monica Pier Restoration Corporation (SMPRC) March 5, 2008, and is included as Attachment No. 1. WRT
was then directed to prepare recommendations for improving the character and function of the public spaces of the Pier.

Design alternatives were presented to
the SMPRC Operations Committee
on May 28, 2008. The alternatives included three ‘families’ of site furnishings representing a range from those of Palisades Park and South Beach to
contemporary styles and materials.

Based on this input, WRT is making
the following recommendations.

5.E.b
Packet Pg. 931 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier 3 The Santa Monica Pier was built for the pleasure of the public in 1909. Ever since, citizens and visitors have enjoyed the amusements and relaxation of the Pier. The very nature of a pier – apart from the land, above the sea and into the sky – is a place for enjoying a remarkable set of experiences. Santa Monica’s traditions of spinning around the carousel, soaring in the Ferris wheel, gathering for picnics, entertainment, fishing, strolling, and enjoying the view remain strongly held. The nationally recognized historic structure of the Hippodrome Building and contributing elements on the Pier, combined with the purpose – for fun, sets the foundational character and style of the public realm of the Pier deck. This character has been best described as ‘whimsical.’

Two fundamental opportunities were
identifi ed in the Assessment of Existing Conditions:

1. Visual clarity, user comfort and
maintenance could be improved with
the selection of a complementary
‘family’ of site furnishings.

2. The placement of site furnishings
could assist in directing circulation
and defi ning spaces for specifi c use,
i.e. performance.
recommendations
The following recommendations are organized to guide the selection of specifi c items, i.e. benches, lights, etc., – Site Furnishings; and how to arrange them on the Pier.

5.E.b
Packet Pg. 932 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier 4 The historic Byzantine-Moorish
styled Hippodrome at the base of the
bridge graciously marks the entrance
to the Pier. More recently constructed
buildings line the eastern portion
of Pier and are characterized by
the bold signage for the dining and
amusement attractions within. The
architecture of the distant west end
might be characterized as an eclectic
craftsman style. The site furnishings
are a mix of styles and materials and
the wood decking is compromised by
numerous anomalies of asphalt and
metal plates.

The style and character of the Pier’s
site furnishings need to be simplifi ed
to become an integrated family of
elements that is complementary of
the architecture styles and contributes
to a sophisticated sense of whimsy.

This will reduce the visual clutter
that distracts from the quality of the
Pier experience and reduce efforts in
maintenance and operation.
site furnishings
Each of the items meets basic criteria
for high quality materials that will
reasonably withstand the corrosive
coastal environment and require
minimal maintenance which contribute to a level of ‘sustainability.’ The manufacturers and model information illustrate the design intent.

Equivalent elements may be identifi ed through the City’s public bid process. Quantities are approximate,
provided for planning purposes. Figure 1 diagrammatically locates each of the site furnishing elements.

5.E.b
Packet Pg. 933 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier 5 Figure 1, Location Diagram for Site Furnishings
6 2
7 The 6,100 linear feet of rail on the
Pier is constructed of three to four
horizontal two inch steel pipe rails,
with two inch diameter steel tube
posts and fi ttings, fi gure 2. Some
sections have a wood top rail. Stainless steel cables have been added in the horizontal direction, centered
between metal rails to create a four
inch minimum clearance. However,
current code requires vertical barriers
at minimum four inches on center.

In addition, joints vary in different
sections of the railing.

There are various materials that
could replace the railing that would
require less maintenance and present
a different aesthetic image. However,
the cost to replace the railings is
estimated at $2.75 million. A more
economical alternative is to retrofi t
the railing to meet current code for
opening size. To achieve the requirement, stainless steel cable at four inch on-center spacing should be added in
a vertical pattern.

The color of the railing should be
painted Mediterranean Blue, RAL
color system 5002 to match new
benches, tables and lighting.
railings
Figure 2 Railing

5.E.b
Packet Pg. 936 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier 8 Figure 4 Benches by artists
Figure 3 Bench

5.E.b
Packet Pg. 937 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier 9 The Assessment of Existing Conditions concluded that there were not enough seating and resting opportunities on the Pier. In addition, there are three types of benches on the Pier,
some of which are more comfortable
than others. The Condition Assessment Report noted that the benches on the Pier have backs and are in a
fi xed position, most facing the ocean.

These types of benches limit the visitors view. A backless bench provides more fl exibility for the visitor.

WRT recommends a new bench
standard to replace variety of existing
benches. The new benches should be
of a style that provides options for
backless benches and benches with
backs, inviting the visitor to look out
to the ocean or onto the spectacle of
performances and people on the Pier.

This report recommends the removal
of all thirty two existing benches and
the addition of forty one new backed
benches and twenty seven backless.

They should be surface mounted to
the deck and carefully located in the
locations shown in fi gure 1 to provide
a range of seating opportunities.

The recommended style of bench,
fi gure 3, is 48” Scarborough – horizontal metal strap as manufactured by Landscapeforms, fi gure 3. These
benches should all be powdercoated
by the manufacturer in ‘Ocean Blue’
to match the railing, tables and lights.

The estimated cost for each bench
is $990 for backless and $1,080 for
backed.
benches
The bench is also an opportunity to
engage public art on the Pier. Introducing public art into the seating is encouraged to build on the legacy of
‘whimsy’ of the Pier. Santa Monica,
renowned for its programs for public
art, may consider numerous options,
such as:
a. replace all existing benches
with a ‘off-the-shelf’ benches
and add a few artist-designed/
custom made benches each year,
fi gure 4;
b. locate artist-designed/custom
made benches in specifi c locations,
such as on the deck east of the
Hippodrome; or
c. engage an artist to enhance a
new set of ‘off-the-shelf’ benches.

WRT recommends establishing a
public art program to invite qualifi ed
artists to create one-of-a-kind seating
for specifi c sites along the pier.

Figure 1 illustrates the eight locations
where the off-the-shelf bench might
be replaced, over time, with an artist bench. The estimated budget for the artist benches is $12,000 each,
including artist fee, materials and
fabrication, installation, one year’s
maintenance.

5.E.b
Packet Pg. 938 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier 10 The Assessment of Existing Conditions found that all the nineteen tables are owned and maintained by
merchants and shop owners. Their
locations serve the tenant’s use. However, there is a need for public picnic tables.

Ten of the nineteen existing tables
are the square, as shown in fi gure 5,
with red seating and table surface.

The other ten are small round tables.

The style and character of the square
metal tables, now used by tenants,
with attached bench seating is recommended above other options considered, fi gure 5.

The existing nineteen should be
replaced by merchants to match the
recommended blue color and nineteen new tables should be added (to be owned and maintained by the
City) in the locations, fi gure 1.
picnic tables
Figure 5 Picnic table
Six to ten of the new tables should
have two or three benches to invite
wheel chair users to the table.

The color of the perforated metal
table tops should be powder coated
‘Slate Blue’, as manufactured by
Wabash Valley, for movable tables:

Models SG140P - 46” Sq. Table -
Perforated and SG155P - 46” 3 - Seat
ADA Accessible Table; and for surface
mounted tables: SG229P - 46” Sq.

Table - 4 Seats - Surf. Mt - Basic
Frame - Perforated, and SG234P
- 46” Sq. Table - 3 Seats - Surf. Mt
- Basic Frame – Perforated.

5.E.b
Packet Pg. 939 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier 11 Five types of trash receptacles were
identifi ed by the Assessment of Existing Conditions. Of the seventy four existing receptacles forty fi ve are the
recommended concrete unit, fi gure 6.

They were found to require minimal
maintenance and most durable of
the options available. Approximately
thirty new trash receptacles and
twenty new receptacles for recycled
materials should be placed as shown,
fi gure 1, for ease of use and collection. The trash receptacle model QR-CAL2832W, anodized aluminum
lid A-24 as manufactured by Quickcrete or approved equal, with the city name embossed and bronze logo inset
to match the existing units. Material to be Ecocast, made from 70% post consumer and industrial waste,
color – Erosion. The top eight inches,
including the rim, should be sealed to
minimize staining.

Receptacles for recyclable materials
need to be added to the Pier (twenty
total). They should be set next to the
trash receptacles. It is recommended
that the twenty new receptacles for
recyclable materials match the trash
receptacles with the addition of signage. Signage or other designations on the trash receptacle, is recommended to designate the specifi c use of the receptacle and educate the
public on the importance of recycling. The signage program is to be coordinated with other City agencies.
trash receptacles
Figure 6 Receptacle
The City of Santa Monica uses the
following receptacle for recyclable
materials: Recycled Recycler Excel
Series Model 900-X50-F 50 gal.
front access 25”x 22”x 49’” 115 lbs.,
‘Designer’ series, as manufactured
by Midpoint International. For the
Pier, brown recycled plastic lumber, is
recommended.

It includes a rubber baffl e to discourage inappropriate removal of materials. Figure 7 Recyclable Materials Receptacle

5.E.b
Packet Pg. 940 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier 12 decking
The tradition of the wood deck is
important to the distinct character of
the Pier. The top decking is primarily two inch by twelve inch by twenty foot long lumber. Portions of the pier
are covered with asphalt and metal
plates. The Design Guidelines require
wood decking for the whole pier. The
ongoing program for repairing the
wood deck is encouraged to continue so that all the metal plates and asphalted areas will be removed and
replaced with wood decking.

5.E.b
Packet Pg. 941 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier 13 Seat walls should be introduced along
the curb line, at the change in surface
elevation between the two decks. The
seat wall should be sixteen inches
tall by sixteen inches wide in various
lengths with two foot wide gaps at
approximately twenty foot intervals
to allow pedestrians to walk between,
see fi gure 1. The curb seating should
be constructed in recycled plastic
lumber/wood composite, in a medium dark brown color, fi gure 8. curbs
The Assessment of Existing Conditions noted the use of heavy timbers bolted to the pier deck to guide traffi c, defi ne the fi re lane and cover the transition between the different elevations between the Municipal Pier from the pedestrian walkway. While
the curbs could be a tripping hazard
for pedestrians and visually unappealing they also are used for seating. The fi re lane and pedestrian areas should
be defi ned by other means, i.e. bollards – see section B. Spatial Composition and Circulation. A wooden ramp should replace the asphalt infi ll
along the seam between the two piers
at the amusement facility entrances.

Figure 8, Seat wall

5.E.b
Packet Pg. 942 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier 14 Figure 9, Decorative arched pole
Figure 10, Task lights to be added to the decorative poles

5.E.b
Packet Pg. 943 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier 15 The Assessment of Existing Conditions revealed that there were six styles of lights on Santa Monica Pier.

The existing decorative arched poles
with the acorn light fi xtures are not
identifi ed as historic elements, but
contribute to the classic character of
the Pier. To create a cohesive image, remove clutter and improve this important visual element of the
Pier, three types of lights are recommended. All lights must provide the Pier staff the ability to control each
independently.
a. Decorative arched poles
with an acorn light fi xture, fi gure
9, are the primary character defi ning light element of the Pier. Figure 1 illustrates the locations for ninety
seven new lights on the twelve foot
tall poles at thirty eight foot spacing
around the entire pier perimeter.

This light serves pedestrians and the
light fi xtures, see the Infrastructure
Upgrades volume of the Santa Monica
Pier Assessment. The original manufacturer of the existing lights has not been determined. Replacement of a
matching pole and fi xture is feasible
and should be conducted carefully to
achieve the desired character. The recommended manufacturer is Sitelink by Holophane.
b. Task lights, fi gure 10, should
be placed on the decorative arched
poles with three to fi ve spot lights
adjustable to illuminate specifi c features, i.e. fi shing areas, boat launch, performance areas, etc. Figure 1
recommends twenty nine locations.
c. Parking lot lights should be
replaced on the Newcomb Pier. The
lighting study of the Infrastructure
Upgrades recommends a twenty fi ve
foot tall pole, spaced eighty feet
on center along the pier perimeter
to provide maximum fl exibility to
program events on the Newcomb
deck. It is estimated that fi fteen poles
, located on fi gure 1, will provide suffi cient illumination. d. Necklace Lights currently
trim the edge of the pier. It was
recommended that the existing lights
be replaced with 750 energy effi cient
LED fi xtures, at fi ve feet on center,
vandal resistant marine grade with
cast housing, high impact lens and
gasketed cast lens guard as manufactured by Cole Lighting. The estimated cost exceeded the budget. See the “Lighting Study” for alternatives
considered.
lights

5.E.b
Packet Pg. 944 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier 16 a. Bicycle racks are currently on
the Pier, but underutilized because of
their inconvenient locations. While
bicycle riding is not encouraged on
the Pier due to potential confl icts
with pedestrians, bikes are recognized
as a popular and sustainable mode of
transportation for locals. To encourage bicycle access to the Pier new racks are recommended to replace the
existing fi ve with additional locations
for new bike racks are illustrated on
fi gure 1. The galvanized steel ‘Wave’
rack is recommended, fi gure 11, each
securing up to eight bikes, as manufactured by Bike Security Racks Co. b. Security barriers, currently
sited, are large three foot by thee foot
wooden boxes now serve as bollards
to designate pedestrian areas and
vehicle areas. It is recommended
that the wooden boxes be removed
and replaced with 127 fi xed and 14
removable bollards. Model “San Francisco”, as manufactured by Urban Accessories, fi gure 12, spaced eight
feet on-center and located as shown
on fi gure 1. These cast aluminum
furnishings should be powder coated
by the manufacturer in RAL color
system 5002 to match other furnishings.
special features
Figure 11, Bicycle rack
Figure 12, Bollard

5.E.b
Packet Pg. 945 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier 17 c. Gazebos have been part of
the Pier for over 15 years. The two
decorative gazebos are located on the
south rail of the Pier. They were designed as performance areas, but are currently underutilized. To encourage use, it is recommended a picnic table is installed in each with a trash
receptacle nearby, and a system of
colorful fabric to animate the space
and discourage bird resting/dropping.
d. Smoking areas are currently
designated and maintained on the
Pier, fi gure 1.

The existing eight ash urns should be
replaced with eight surface mounted,
powdercoated (RAL color system
5002) aluminum ash urns, model
Grenadier as manufactured by Landscapeforms, fi gure 13.

The deck of the smoking areas should
be a solid surface to keep burning
items away from the wood Pier. Instead of the existing painted plywood, it is recommended that a four foot by
eight foot deck of tightly set recycled
plastic lumber, one inch thick (or
less) by six inches wide, tongue and
groove, a medium dark brown color,
is installed directly on the wood Pier.

It is recommended that the environmental graphics program direct smokers to the designated areas.

Figure 13, Ash Urn

5.E.b
Packet Pg. 946 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier 18 e. Signage is an important
interface between the public and the
facilities of the Pier, as well as key to
the identity of the public places, the
merchants and shop owners. Signage
for individual tenants and merchants
are required to follow the Architectural Design Guidelines. These recommendations are for the public
signs.

The Assessment of Existing Conditions found recently installed signs that provide consolidated information about rules and regulations that apply to the Pier. However other
signage on the Pier is inconsistent
in its character, quality, message and
placement.

A comprehensive environmental
graphics program should be developed to direct the replacement and addition of signage on the Santa
Monica Pier. The graphics program
should be based on what and how
information is delivered. It should
include an interpretive program addressing cultural resources, natural history, and functions of the pier. The
graphics program should coordinate
the character of interpretive signage
with that needed for directional and
regulatory information. The solution
should serve the Pier for fi fteen to
twenty years allowing an amount of fl exibility with high quality materials located to minimize clutter and focus
the message to the public.

Figure 14, Interpretive Panel, by Mortar & Ink

5.E.b
Packet Pg. 947 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier 19 The historic information displayed
near the police sub-station at the
west end of the Pier may be more
effectively displayed in a series of
panels along the railing, see fi gure 14.

Porcelain enamel is recommended for
interpretive signs. This technique and
use of materials is proven to hold up
well in the ocean climate and deliver
hi-quality graphic detail. The size
could vary within the system. Figure
1 identifi es up to eight potential locations for interpretive information.

Regulatory and directional components may be aluminum to fi t within the city’s signage program.

The existing information kiosk is a
helpful and attractive element, fi gure

15. Two additional kiosks are recommended as located on fi gure 1.

Figure 15, Kiosk
Centennial anniversary signage
should be considered temporary, unless it can be included in the comprehensive environmental graphics program. To assist in the effi cient and
effectiveness of a temporary program
the PRC should consider:
• Defi ning the identity of the
year long event;
• Building on the City’s environmental signage program and production capabilities;
• Utilizing materials that can be
recycled appropriately; and
• Engaging local sponsors.

5.E.b
Packet Pg. 948 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier 20 f. Performance areas are managed by the SMPRC, fi gure 1. These open spaces along the edge of the
Pier, between the emergency vehicle
access path and the railing. These
sites should be marked with a painted
white star on the wood deck as de- fi ned by the environmental graphics program.
g. Vendor carts are managed by
the City of Santa Monica in locations
shown on fi gure 1. They are marked
on the deck with a painted white
“T”.

5.E.b
Packet Pg. 949 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier 21 The Santa Monica Looff Hippodrome building is listed National Historic Landmark, National Register Number: 87000766.

Statement of SigniÄ cance (as of designation - February 27, 1987):

The principal historic element of the formerly extensive collection of amusement facilities at the Santa Monica (Looff) Amusement Pier, this is a rare, intact example of an early shelter structure built (1916) to house a carousel in an amusement park and the better preserved of the two such structures that remain on the West Coast.
http://tps.cr.nps.gov/nhl/detail.cfm?ResourceId=1979&ResourceType=Building carousel building roof
Historic photos of the Santa Monica
Looff Hippodrome (Carousel Building) show the elegant curved funnel shaped roof rising to the central ‘onion
dome’ on a cupola. The perimeter
of the building has octagonal shaped
turrets at the corners of the building.

The northeast corner is wider and
taller than the other three. Each of the
turrets may have had a viewing deck
on the fl at roofs with a railing. Three
dome shaped features were equally
spaced along the roofl ine of each
façade.

5.E.b
Packet Pg. 950 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier 22 Currently the metal funnel roof rises
out of a fl at roof with the wood cupola
sitting on top. Missing is the ‘onion
dome’ cupola roof, the railing around
the perimeter of the turret roofs and
the twelve dome shaped features.

The 1987 Design guidelines note that
the Carousel Building was “already
restored”, page 56. The graphics of
the design guidelines to not indicate
the reconstruction of the ‘onion dome’
or the dome shaped features around
the building perimeter.

Construction plans and specifi cations
for Roofi ng and Cupola Replacement
were prepared in 1997 by Pugh Scarpa
Kodama. They call for the removal of
the existing fl at roof portion to the
underlying curved sheathing. They do
not address the dome shaped features
around the building perimeter.

The City of Santa Monica’s Landmarks Commission adheres to the National Park Service—Secretary of
the Interior’s Standards for the Treatment of Historic Properties. Decisions and agreement concerning the Carousel Building roof should be confi rmed prior to further action.

Recommendations:

1. Confi rm specifi c elements to
be reconstructed to meet the Santa
Monica Landmark Commission’s
requirements and agreements to
maintain the National Historic
Landmark status of the building.

2. Update the Roofi ng and
Cupola Replacement Plans to
meet current building and safety
codes and the Secretary of the
Interior’s Standards (including, but
not limited to, the restoration of
the turrets, addition of perimeter
dome shaped features if necessary).

5.E.b
Packet Pg. 951 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 952 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 953 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 954 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 955 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 956 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 957 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 958 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 959 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 960 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 961 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 962 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 963 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 964 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 965 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
er Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 967 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 968 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 969 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 970 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 971 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 972 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 973 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 974 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 975 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 976 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 977 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 978 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 979 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 980 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 981 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 982 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 983 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 984 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 985 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 986 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 987 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 988 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 989 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 990 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 991 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 992 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 993 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 994 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 995 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 996 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 997 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 998 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 999 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1000 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1001 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1002 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1003 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1004 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1005 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1006 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1007 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1008 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1009 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1010 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1011 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1012 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1013 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1014 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1015 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1016 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1017 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1018 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1019 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1020 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1021 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1022 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1023 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1024 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1025 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1026 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1027 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1028 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1029 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1030 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1031 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1032 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

5.E.b
Packet Pg. 1033 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier 4225 E. Conant Street
Long Beach, CA 90808
T (562) 590-6500
www.moffattnichol.com

5.E.b
Packet Pg. 1034 Attachment: 2018 Pier Infrastructure Inspection & Assessment Study [Revision 4] (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier

CITY OF SANTA MONICA

OAKS INITIATIVE NOTICE

NOTICE TO APPLICANTS, BIDDERS, PROPOSERS

AND OTHERS SEEKING DISCRETIONARY PERMITS, CONTRACTS,

OR OTHER BENEFITS FROM THE CITY OF SANTA MONICA
Santa Monica’s voters adopted a City Charter amendment commonly known as the Oaks Initiative. The Oaks Initiative requires the City to provide this notice and information about the Initiative’s requirements. You may obtain a full copy of the Initiative’s text from the City Clerk.

This information is required by City Charter Article XXII—Taxpayer Protection. It prohibits a public official from receiving, and a person or entity from conferring, specified personal benefits or campaign advantages from a person or entity after the official votes, or otherwise takes official action, to award a “public benefit” to that person or entity. The prohibition applies within and outside of the geographical boundaries of Santa Monica.

All persons or entities applying or receiving public benefits from the City of Santa Monica shall provide the names of trustees, directors, partners, and officers, and names of persons with more than a 10% equity, participation or revenue interest. An exception exists for persons serving in those capacities as volunteers, without compensation, for organizations exempt from income taxes under Section 501(c)(3), (4), or (6), of the Internal Revenue Code. However, this exception does not apply if the organization is a political committee or controls political committees. Examples of a “public benefit” include public contracts to provide goods or services worth more than $25,000 or a land use approval worth more than $25,000 over a 12-month period.

In order to facilitate compliance with the requirements of the Oaks Initiative, the City compiles and maintains certain information. That information includes the name of any person or persons who is seeking a “public benefit.” If the “public benefit” is sought by an entity, rather than an individual person, the information includes the name of every person who is: (a) trustee, (b) director, (c) partner, (d) officer, or has (e) more than a ten percent interest in the entity. Therefore, if you are seeking a “public benefit” covered by the Oaks Initiative, you must supply that information on the Oaks Initiative Disclosure Form. This information must be updated and supplied every 12 months.

5.E.d
Packet Pg. 1035 Attachment: Oaks Initiative Form - Moffatt & Nichol (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Capital Plan)

CITY OF SANTA MONICA

OAKS INITIATIVE DISCLOSURE FORM
In order to facilitate compliance with the requirements of the Oaks Initiative, the City compiles and maintains certain information. That information includes the name of any person or persons who is seeking a “public benefit.” If the “public benefit” is sought by an entity, rather than an individual person, the information includes the name of every person who is: (a) trustee, (b) director, (c) partner, (d) officer, or has (e) more than a ten percent interest in the entity.

Public benefits include:

1. Personal services contracts in excess of $25,000 over any 12-month period;

2. Sale of material, equipment or supplies to the City in excess of $25,000 over a 12- month period;

3. Purchase, sale or lease of real property to or from the City in excess of $25,000 over a 12- month period;

4. Non-competitive franchise awards with gross revenue of $50,000 or more in any 12-month period;

5. Land use variance, special use permit, or other exception to an established land use plan, where the decision has a value in excess of $25,000;

6. Tax “abatement, exception, or benefit” of a value in excess of $5,000 in any 12- month period; or

7. Payment of “cash or specie” of a net value to the recipient of $10,000 in any 12- month period.

Name(s) of persons or entities receiving public benefit:

Name(s) of trustees, directors, partners, and officers:

Name(s) of persons with more than a 10% equity, participation, or revenue interest:

Prepared by: ____________________________Title: __________________________ Signature: ______________________________________ Date: ________________ Email: ____________________________________ Phone: ____________________ FOR CITY USE ONLY:

Bid/PO/Contract # ____________________________ Permit # ___________________________ See the attached list of Key Officers and Directors.
1) Eric A. Nichol, and 2) Douglas Nichol Moffatt & Nichol Shares Trust dated November 28, 2006.

5.E.d
Packet Pg. 1036 Attachment: Oaks Initiative Form - Moffatt & Nichol (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Capital Plan)

ATTACHMENT
Officers and Directors list
Title Name Address
President / Chief Executive Officer Eric A. Nichol, PE 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Senior Vice President / Chief Olie Abbamonto 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Financial Officer
Senior Vice President / Chief David W. Huchel 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Legal Officer / Secretary
Senior Vice President / Chief Douglas J. Plasencia, PE 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Operations Officer
Senior Vice President Richard M. Rhoads, PE 2185 N. California Blvd., Suite 500, Walnut Creek, CA 94596 Senior Vice President Jeffrey L. Sparrow, PE 21308 Small Branch Place, Ashburn, VA 20148 Vice President / Assistant Secretary Sarah M. Sabunas 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Director / Chairman Eric A. Nichol, PE 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Director Michelle Anghera, PhD 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Director Randell Iwasaki, PE 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Director Ralph Larison 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Director Jim Nevada 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Director Michael N. Rieger 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Director Lynn L. Schrier-Behler 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Director Richard D. Steinke 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Moffatt & Nichol

5.E.d
Packet Pg. 1037 Attachment: Oaks Initiative Form - Moffatt & Nichol (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Capital Plan)

CITY OF SANTA MONICA

OAKS INITIATIVE NOTICE

NOTICE TO APPLICANTS, BIDDERS, PROPOSERS

AND OTHERS SEEKING DISCRETIONARY PERMITS, CONTRACTS,

OR OTHER BENEFITS FROM THE CITY OF SANTA MONICA
Santa Monica’s voters adopted a City Charter amendment commonly known as the Oaks Initiative. The Oaks Initiative requires the City to provide this notice and information about the Initiative’s requirements. You may obtain a full copy of the Initiative’s text from the City Clerk.

This information is required by City Charter Article XXII—Taxpayer Protection. It prohibits a public official from receiving, and a person or entity from conferring, specified personal benefits or campaign advantages from a person or entity after the official votes, or otherwise takes official action, to award a “public benefit” to that person or entity. The prohibition applies within and outside of the geographical boundaries of Santa Monica.

All persons or entities applying or receiving public benefits from the City of Santa Monica shall provide the names of trustees, directors, partners, and officers, and names of persons with more than a 10% equity, participation or revenue interest. An exception exists for persons serving in those capacities as volunteers, without compensation, for organizations exempt from income taxes under Section 501(c)(3), (4), or (6), of the Internal Revenue Code. However, this exception does not apply if the organization is a political committee or controls political committees. Examples of a “public benefit” include public contracts to provide goods or services worth more than $25,000 or a land use approval worth more than $25,000 over a 12-month period.

In order to facilitate compliance with the requirements of the Oaks Initiative, the City compiles and maintains certain information. That information includes the name of any person or persons who is seeking a “public benefit.” If the “public benefit” is sought by an entity, rather than an individual person, the information includes the name of every person who is: (a) trustee, (b) director, (c) partner, (d) officer, or has (e) more than a ten percent interest in the entity. Therefore, if you are seeking a “public benefit” covered by the Oaks Initiative, you must supply that information on the Oaks Initiative Disclosure Form. This information must be updated and supplied every 12 months.

5.E.e
Packet Pg. 1038 Attachment: OaksInitiative-wEx-Completed-081723 (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Capital Plan)

CITY OF SANTA MONICA

OAKS INITIATIVE DISCLOSURE FORM
In order to facilitate compliance with the requirements of the Oaks Initiative, the City compiles and maintains certain information. That information includes the name of any person or persons who is seeking a “public benefit.” If the “public benefit” is sought by an entity, rather than an individual person, the information includes the name of every person who is: (a) trustee, (b) director, (c) partner, (d) officer, or has (e) more than a ten percent interest in the entity.

Public benefits include:

1. Personal services contracts in excess of $25,000 over any 12-month period;

2. Sale of material, equipment or supplies to the City in excess of $25,000 over a 12- month period;

3. Purchase, sale or lease of real property to or from the City in excess of $25,000 over a 12- month period;

4. Non-competitive franchise awards with gross revenue of $50,000 or more in any 12-month period;

5. Land use variance, special use permit, or other exception to an established land use plan, where the decision has a value in excess of $25,000;

6. Tax “abatement, exception, or benefit” of a value in excess of $5,000 in any 12- month period; or

7. Payment of “cash or specie” of a net value to the recipient of $10,000 in any 12- month period.

Name(s) of persons or entities receiving public benefit:

Name(s) of trustees, directors, partners, and officers:

Name(s) of persons with more than a 10% equity, participation, or revenue interest:

Prepared by: ____________________________Title: __________________________ Signature: ______________________________________ Date: ________________ Email: ____________________________________ Phone: ____________________ FOR CITY USE ONLY:

Bid/PO/Contract # ____________________________ Permit # ___________________________ See the attached list of Key Officers and Directors.
1) Eric A. Nichol, and 2) Douglas Nichol Moffatt & Nichol Shares Trust dated November 28, 2006.

5.E.e
Packet Pg. 1039 Attachment: OaksInitiative-wEx-Completed-081723 (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Capital Plan)

ATTACHMENT
Officers and Directors list
Title Name Address
President / Chief Executive Officer Eric A. Nichol, PE 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Senior Vice President / Chief Olie Abbamonto 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Financial Officer
Senior Vice President / Chief David W. Huchel 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Legal Officer / Secretary
Senior Vice President / Chief Douglas J. Plasencia, PE 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Operations Officer
Senior Vice President Richard M. Rhoads, PE 2185 N. California Blvd., Suite 500, Walnut Creek, CA 94596 Senior Vice President Jeffrey L. Sparrow, PE 21308 Small Branch Place, Ashburn, VA 20148 Vice President / Assistant Secretary Sarah M. Sabunas 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Director / Chairman Eric A. Nichol, PE 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Director Michelle Anghera, PhD 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Director Randell Iwasaki, PE 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Director Ralph Larison 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Director Jim Nevada 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Director Michael N. Rieger 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Director Lynn L. Schrier-Behler 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Director Richard D. Steinke 4225 E. Conant Street, Suite 101, Long Beach, CA 90808 Moffatt & Nichol

5.E.e
Packet Pg. 1040 Attachment: OaksInitiative-wEx-Completed-081723 (5853 : Award RFP# SP2689 to Moffatt & Nichol for Pier Capital Plan) City Council
Report
City Council Meeting: September 26, 2023
Agenda Item: 5.F
1 of 5
To: Mayor and City Council
From: Christopher Smith, Acting Chief Information Officer, Information Services Department
Subject: Approval of Agreements with Zones and Hewlett Packard for City Computer Equipment
Recommended Action
Staff recommends that the City Council:

1. Adopt a finding of Categorical Exemption pursuant to Section 15061(d)(3) (Common Sense Exemption) of the California Environmental Quality Act (CEQA) Guidelines.

2. Authorize the Procurement Manager to issue a change order to purchase order #22400546 in the amount of $100,588 with the Hewlett Packard Corporation for computer equipment for the Information Services Department. This would result in a revised purchase order total not to exceed $350,588.

3. Authorize the City Manager to negotiate and execute an agreement with Zones Corporation for computer equipment and installation services for the Information Services Department. This recommended award is made as an exception to the competitive bidding process pursuant to Section 2.24.250 (c) and is for a fiveyear total amount not to exceed $7,864,000 with future year funding contingent on Council budget approval.

4. Authorize budget changes as outlined in the Financial Impacts & Budget Actions section of this report.

Summary
The City maintains a fleet of approximately 2,000 laptops and desktops for staff and at public kiosks. The City suspended its Computer Equipment Replacement Program (CERP) in 2020 as part of the City’s fiscal rightsizing following the COVID-19 pandemic.

This means that more than half of today’s computer fleet is over four years old, resulting in increased computer failures and repairs and security vulnerability as technology ages. Staff now proposes to restart CERP in FY 2023-24, replacing 25% of the City’s

5.F
Packet Pg. 1041
2 of 5
computer fleet annually. Staff also seeks to replace approximately 100 mobile data computers (MDCs) used by the Santa Monica Police Department in their vehicles. To do this, staff requests authorization to enter into a five-year agreement with Zones to purchase computer equipment and associated services supporting the deployment and decommissioning of equipment as well as authorization to modify the City’s existing purchase order with Hewlett Packard to ensure the City can continue to purchase computer equipment on an emergency basis until the program can be restarted early next year.

Discussion
The City operates a modern, secure technology infrastructure supporting the City’s departments and staff to conduct their work and provide services to the community. A key part of this technology infrastructure is desktop and laptop computers for staff and at public kiosks.

The City has historically replaced its computers every four years to ensure that they are secure, work reliably, and up to date. However, the City suspended CERP in 2020 due the financial impacts of the COVID-19 pandemic. This means, over 1,000 of the City’s computers are now over four years old and staff are relying on fragile and outdated computers while there have been enormous demands added to the City’s technology environment to support online meetings and collaboration, new software systems, enhanced cyber and information security protection, and other factors. Since 2022, the City has piggy backed off the State of California’s National Association of State Procurement Officials (NASPO) participating addendum to procure computer equipment from Hewlett Packard on an as-needed, emergency basis. The proposed modification to the current purchase order with Hewlett Packard Corporation would exceed the City Manager’s threshold and requires Council approval.

Staff now propose to restart CERP to ensure staff and public kiosks have reliable computer equipment that supports the modern ways of working while meeting the City’s technical and information security requirements. Additionally, the MDCs installed in the

5.F
Packet Pg. 1042
3 of 5
Santa Monica Police Department’s vehicles are now over eight years old and staff seek to replace this equipment at this time.

In assessing the marketplace, staff evaluated computer equipment from the top manufacturers and determined that Dell laptops and desktop computers best meet the City’s technical requirements for computing. Staff also examined recent competitive bids completed by local agencies and identified a bid conducted by the Port of Los Angeles that was awarded to Zones. Zones currently provides the City’s 24/7 first tier computer support and some disaster recovery services and therefore knows the City’s computing environment. Zones has offered the City a 60% minimum discount on Dell equipment as part of this proposed agreement.

Vendor Selection
Agreement with Zones for Computer Equipment Replacement Program Exception to Competitive Bidding
Staff recommends Zones to furnish and provide computer equipment and installation services as an exception to competitive bidding per Santa Monica Municipal Code Section 2.24.250 (c). This request is leveraging competitive pricing piggy backing off the City of Los Angeles Harbor Department Bid Number F-1137, formal request for cooperative agreement for IT Equipment, Supplies and Related Services. Zones is offering Dell laptop, desktop and MDC computers at a 60% to 66% discount from the manufacturer’s suggested retail price.

They are also providing configuration, deployment, and decommissioning services of the computer equipment. Additionally, Zones currently provides the City’s 24/7 first tier computer support and some disaster recovery services and therefore knows the City’s computing environment.
c. competitive procedures were followed by a governmental agency, federal, state, county, city, joint powers agency, special district, or cooperative purchasing agency and the goods or services are supplied to the City at the same or better price Change order to Purchase Order with Hewlett Packard
Exception to Competitive Bidding
Staff recommends Hewlett Packard to furnish and provide computers on an as needed basis as an exception to competitive bidding per Santa Monica Municipal Code Section 2.24.250 (c).

This request continues to leverage competitive pricing piggy backing off the State of California’s Participating Addendum under the NASPO ValuePoint Computer Equipment, Peripherals & Related Services contract (Master Agreement – State of Minnesota, extended through October 31, 2023). The discounts offered through this agreement range between 18% and 28% off baseline list, with additional discounts on bulk orders. c. competitive procedures were followed by a governmental agency, federal, state, county,

5.F
Packet Pg. 1043
4 of 5
city, joint powers agency, special district, or cooperative purchasing agency and the goods or services are supplied to the City at the same or better price Environmental Review
The award agreement and purchase order modification to provide computer equipment and related services and purchase order modification to provide computer equipment is exempt from the California Environmental Quality Act (CEQA) pursuant to Section 15061(b)(3) of the CEQA Guidelines. The award agreement is covered by the common sense exemption which states that CEQA does not apply, where it can be seen with certainty that there is no possibility that the activity in question may have a significant effect on the environment.

The agreement and purchase order will allow the City to continue to procure computer equipment and related services. Therefore, it can be seen with certainty that the agreement would not result in adverse physical impacts on the environment, and as such, is categorically exempt from CEQA.

Financial Impacts
Staff seeks authority to approve funding from the Information Services & Technology Replacement Fund and the General Fund to award an agreement with Zones for the purchase of computer equipment and associated deployment services and to issue a change order to the purchase order with Hewlett Packard for the purchase of computer equipment on an as-needed basis.

Award of the agreement to Zones and modifying the purchase order with Hewlett Packard requires the following budget change:

FY 2023-24 Budget Change
Appropriate Funds
Fund Account Number Amount
Information Services &
Technology Replacement
C7100030.689000
CERP 658,000

5.F
Packet Pg. 1044
5 of 5
The appropriation from the Information Services and Technology Fund, as previously contributed by the City’s other funds, is required to ensure funds are available in the CERP capital account to fund projected replacements.

Agreement Request: Zones
FY 2023-24
Request Amount
Future Years
Amount CIP Account # Total Contract Amount
685,000 6,744,000 C7100030.689000
CERP 7,429,000
410,000 C0105830.689000
Mobile Data Computer Replacement 410,000
25,000
C0107810.689000
Bulk Process Improvement,
Modernization, & Digitization
25,000
1,120,000 6,744,000  Total 7,864,000
Purchase Order Modification Request: Hewlett Packard
Purchase
Order #
Current Authorized
Amount
FY 2023-24
Request Amount CIP Account # Total Revised Amount
22400546 250,000 100,588 C7100030.689000
CERP 350,588
Future year funding is contingent on Council budget approval.

Prepared By: Christopher Smith, Acting Chief Information Officer Approved Forwarded to Council
Attachments:

A. HP OAKS INITIATIVE FORM
B. ZonesLLC_Santa Monica_OAKS INITIATIVE FORM

5.F
Packet Pg. 1045

CITY OF SANTA MONICA

OAKS INITIATIVE NOTICE

NOTICE TO APPLICANTS, BIDDERS, PROPOSERS

AND OTHERS SEEKING DISCRETIONARY PERMITS, CONTRACTS,

OR OTHER BENEFITS FROM THE CITY OF SANTA MONICA
Santa Monica’s voters adopted a City Charter amendment commonly known as the Oaks Initiative. The Oaks Initiative requires the City to provide this notice and information about the Initiative’s requirements. You may obtain a full copy of the Initiative’s text from the City Clerk.

This information is required by City Charter Article XXII—Taxpayer Protection.

It prohibits a public official from receiving, and a person or entity from conferring, specified personal benefits or campaign advantages from a person or entity after theofficial votes, or otherwise takes official action, to award a “public benefit” to that person or entity. The prohibition applies within and outside of the geographical boundaries of SantaMonica.

All persons or entities applying or receiving public benefits from the City of Santa Monica shall provide the names of trustees, directors, partners, and officers, and names of persons with more than a 10% equity, participation or revenue interest. An exception exists for persons serving in those capacities as volunteers, without compensation, for organizations exempt from income taxes under Section 501(c)(3), (4), or (6), of the Internal Revenue Code. However, this exception does not apply if the organization is a political committee or controls political committees.

Examples of a “public benefit” include public contracts to provide goods or services worth more than $25,000 or a land use approval worth more than $25,000 over a 12- month period.

In order to facilitate compliance with the requirements of the Oaks Initiative, theCity compiles and maintains certain information. That information includes the name of any personorpersons whois seeking a “publicbenefit.” If the“public benefit” is sought by an entity, ratherthan an individual person, the information includes the nameof everyperson who is: (a) trustee, (b) director, (c) partner, (d) officer, or has (e) more than a ten percent interest in the entity. Therefore, if you are seeking a “public benefit” covered by the Oaks Initiative, you must supply that information on the Oaks Initiative Disclosure Form. This information must be updated and supplied every 12 months.

5.F.a
Packet Pg. 1046 Attachment: HP OAKS INITIATIVE FORM (5856 : Computer Equipment Replacement Program)

CITY OF SANTA MONICA

OAKS INITIATIVE DISCLOSURE FORM
In order to facilitate compliance with the requirements of the Oaks Initiative, the City compiles and maintains certain information. That information includes the name of any person or persons who is seeking a “public benefit.” If the “public benefit” is sought by an entity, rather than an individual person, the information includes the name of every person who is: (a) trustee, (b) director, (c) partner, (d) officer, or has (e) more than a ten percent interest in the entity.

Public benefits include:

1. Personal services contracts in excess of $25,000 over any 12-monthperiod;

2. Sale of material, equipment or supplies to the City in excess of $25,000 over a 12- month period;

3. Purchase, sale or lease of real property to or from the City in excess of $25,000 over a 12- month period;

4. Non-competitive franchise awards with gross revenue of $50,000 or more inany 12-month period;

5. Land use variance, special use permit, or other exception to an established land use plan, where the decision has a value in excess of $25,000;

6. Tax “abatement, exception, or benefit” of a value in excess of $5,000 in any 12- month period; or

7. Payment of “cash or specie” of a net value to the recipient of $10,000 in any 12- month period.

Name(s) of persons or entities receiving public benefit:

Name(s) of trustees, directors, partners, and officers:

Name(s) of persons with more than a 10% equity, participation, or revenue interest:

Prepared by: Title:

Signature: Date:

Email: Phone:

Permit #
FOR CITY USE ONLY:

Bid/PO/Contract #

5.F.a
Packet Pg. 1047 Attachment: HP OAKS INITIATIVE FORM (5856 : Computer Equipment Replacement Program)

CITY OF SANTA MONICA

OAKS INITIATIVE NOTICE

NOTICE TO APPLICANTS, BIDDERS, PROPOSERS

AND OTHERS SEEKING DISCRETIONARY PERMITS, CONTRACTS,

OR OTHER BENEFITS FROM THE CITY OF SANTA MONICA
Santa Monica s voters adopted a City Charter amendment commonly known as the Oaks Initiative. The Oaks Initiative requires the City to provide this notice and information about the Initiative s requirements. You may obtain a full copy of the Initiative s text from the City Clerk.

This information is required by City Charter Article XXII Taxpayer Protection. It prohibits a public official from receiving, and a person or entity from conferring, specified personal benefits or campaign advantages from a person or entity after the official votes, or otherwise takes official action, to award a public benefit to that person or entity. The prohibition applies within and outside of the geographical boundaries of Santa Monica.

All persons or entities applying or receiving public benefits from the City of Santa Monica shall provide the names of trustees, directors, partners, and officers, and names of persons with more than a 10% equity, participation or revenue interest. An exception exists for persons serving in those capacities as volunteers, without compensation, for organizations exempt from income taxes under Section 501(c)(3), (4), or (6), of the Internal Revenue Code. However, this exception does not apply if the organization is a political committee or controls political committees. Examples of a public benefit include public contracts to provide goods or services worth more than $25,000 or a land use approval worth more than $25,000 over a 12-month period.

In order to facilitate compliance with the requirements of the Oaks Initiative, the City compiles and maintains certain information. That information includes the name of any person or persons who is seeking a public benefit. If the public benefit is sought by an entity, rather than an individual person, the information includes the name of every person who is: (a) trustee, (b) director, (c) partner, (d) officer, or has (e) more than a ten percent interest in the entity. Therefore, if you are seeking a public benefit covered by the Oaks Initiative, you must supply that information on the Oaks Initiative Disclosure Form. This information must be updated and supplied every 12 months.

5.F.b
Packet Pg. 1048 Attachment: ZonesLLC_Santa Monica_OAKS INITIATIVE FORM (5856 : Computer Equipment Replacement Program)

CITY OF SANTA MONICA

OAKS INITIATIVE DISCLOSURE FORM
In order to facilitate compliance with the requirements of the Oaks Initiative, the City compiles and maintains certain information. That information includes the name of any person or persons who is seeking a public benefit. If the public benefit is sought by an entity, rather than an individual person, the information includes the name of every person who is: (a) trustee, (b) director, (c) partner, (d) officer, or has (e) more than a ten percent interest in the entity.

Public benefits include:

1. Personal services contracts in excess of $25,000 over any 12-month period;

2. Sale of material, equipment or supplies to the City in excess of $25,000 over a 12- month period;

3. Purchase, sale or lease of real property to or from the City in excess of $25,000 over a 12- month period;

4. Non-competitive franchise awards with gross revenue of $50,000 or more in any 12-month period;

5. Land use variance, special use permit, or other exception to an established land use plan, where the decision has a value in excess of $25,000;

6. Tax abatement, exception, or benefit of a value in excess of $5,000 in any 12- month period; or

7. Payment of cash or speci of a net value to the recipient of $10,000 in any 12- month period.

Name(s) of persons or entities receiving public benefit:

Name(s) of trustees, directors, partners, and officers:

Name(s) of persons with more than a 10% equity, participation, or revenue interest:

Prepared by: ____________________________Title: __________________________ Signature: ______________________________________ Date: ________________ Email: ____________________________________ Phone: ____________________ FOR CITY USE ONLY:

Bid/PO/Contract # ____________________________ Permit # ___________________________ Jon Bailey VP, Business & Legal Affairs
10/07/2022
[email protected] 253-205-3571
Zones, LLC
Zones, LLC Board of Directors are: Firoz Lalji (Chairman), and independent BODs; John Bauer, James Jiambalvo, Ken Kirkpatrick, John M. Steel, Yehia Maaty Omar Firoz Lalji - President/CEO

5.F.b
Packet Pg. 1049 Attachment: ZonesLLC_Santa Monica_OAKS INITIATIVE FORM (5856 : Computer Equipment Replacement Program) City Council
Report
City Council Meeting: September 26, 2023
Agenda Item: 5.G
1 of 10
To: Mayor and City Council
From: David Martin, Director, Administration
Subject: Approval of Contract with SHI International Corp. for purchase of software from Granicus, LLC. for short term rental address verification, compliance monitoring, permitting, and tax collection services for the City of Santa Monica Recommended Action
Staff recommends that the City Council:

1. Adopt a finding of Categorical Exemption pursuant to Section 15061(b)(3) (Common Sense Exemption) of the California Environmental Quality Act (CEQA) Guidelines; and

2. Authorize the City Manager to negotiate and execute a professional services agreement with SHI International for purchase of software services from Granicus, LLC for short term rental address verification, compliance monitoring, permitting and tax collection services for the Community Development and Finance Departments. This recommended award is made as an exception to the competitive bidding process pursuant to Section 2.24.250(c) and is for a total amount not to exceed $455,560 over a five-year period with future year funding contingent on Council budget approval.

Summary
As the City of Santa Monica continues to recover from the economic impacts of the COVID-19 pandemic, the City is seeking ways to streamline its operations to improve its efficiency and effectiveness. There is an opportunity to improve the efficiency of administering the home-sharing program and improve outcomes for the community by reducing the illegal use of housing units by short-term users.

Currently, the permitting and enforcement aspects of the home-sharing program are performed manually, which slows the issuance of the licenses, creates impediments to effective identification and enforcement of illegal home-share listings, and limits the

5.G
Packet Pg. 1050
2 of 10
amount of taxes collected from home-sharing activities in the City. Cloud-based software systems exist which can help cities automate licensing and permitting workflows, identify illegal home-share listings, and collect the required taxes owed. By leveraging the power of artificial intelligence and coupling it with human analysts, these services allow Santa Monica to increase efficiency and effectiveness in operations while better serving the community. The proposed Agreement with SHI International Corp. would include cloud-based software services from Granicus, LLC, for short term rental (home-share) address verification, compliance monitoring, permitting, and tax collection services for the City of Santa Monica.

Background
On May 12, 2015, the Santa Monica City Council adopted the "Home-Sharing Ordinance," adding Chapter 6.20 to the Santa Monica Municipal Code clarifying prohibitions against short-term vacation rentals and imposing regulations on homesharing. This law became effective on June 12, 2015, and was subsequently amended by ordinances adopted on January 24, 2017, June 27, 2017, and September 24, 2019.

The Home-Sharing Ordinance allows eligible residents (owners and long-term residents) to apply for a home-sharing permit and business license so that they can home-share their primary residence. In addition, the September 24, 2019 amendments to the ordinance contain listing and advertising requirements, restrictions on the number of group bookings, occupancy and visitor vehicle limitations, and other prohibitions.

These amendments took effect on October 24, 2019 and apply to all home-shares, including those operating under business licenses obtained prior to the effective date of the ordinance. On May 9, 2023, the City Council also approved an amendment to the Home-Sharing Ordinance which permitted home-sharing in certain qualifying accessory structures and created a home-sharing legalization program.

Discussion
The current Home-Sharing Ordinance provides for regulations of two types of ShortTerm Rentals:
• “Home-Sharing” – The law authorizes home-sharing, which is the rental of 30 consecutive days or less of one or more bedrooms in the home that is the

5.G
Packet Pg. 1051
3 of 10
primary residence of the host while the host lives on-site in the home throughout the visitor’s stay.
• "Vacation Rental” – The law continues the City’s longstanding prohibition against vacation rentals. A vacation rental is the rental of 30 consecutive days or less of a home, in whole or in part, for exclusive transient use. The visitor enjoys the exclusive private use of the unit.

Currently, the City of Santa Monica permits home-sharing by any natural person who:
(1) is either: (i) a long-term resident of a dwelling unit, or (ii) an owner of a dwelling unit; and (2) uses that dwelling unit as his or her primary residence.

According to insideairbnb.com, as of June 6, 2023, there are over 1,300 short-term rental listings in Santa Monica on Airbnb. AirDNA, another major short-term rental market analysis company, estimates there are just over 1,100 listings. This number does not account for listings found on sites other than Airbnb and VRBO. These listings are found throughout the city. The overwhelming majority of these listings are for entire homes/apartments, which likely violates the requirements of the Home-Sharing Ordinance as the host is required to live on-site during the guests’ stay. Whole unit listings are those most likely to result in the removal of housing from the long-term rental market.

5.G
Packet Pg. 1052
4 of 10
Santa Monica AirBnB Listings as of June 6, 2023
(Source: insideairbnb.com)

5.G
Packet Pg. 1053
5 of 10
Most recently, one Code Enforcement Officer has been assigned to addressing all home-sharing violations in the City. Complaints are addressed on a reactive basis. The investigative process is entirely manual, which makes the enforcement process slow and inefficient. In order to verify that a violation exists, the officer must find a link to a listing at the property where concerns are being raised. Links are often turned off and on by the host at various times of the day, often activated during hours where staff is unlikely to be on duty.

Once a live link is identified, staff must be able to tie the unit in the listing to a particular property or address. This is the most difficult part of the process as hosts generally do not post photos of the outside of the building or the unit on the listing. The addresses are also generally not included in the listing. Without being able to tie a listing to an address, Code Enforcement is unable to move forward with the enforcement process.

Leveraging the use of the Granicus, LLC software through an agreement with SHI International Corp will support the Code Enforcement Officer assigned to addressing home-sharing violations to more effectively address violations and streamline the permitting and revenue collection processes by automating the required processes, which are currently done manually. This service can enable more effective enforcement of the home-sharing program.

Granicus, LLC. provides a cloud-based software platform that engages in web scraping, a process that extracts underlying HTML code and data to extract content and data from a website, to identify listings and extract as much information as possible to allow their artificial intelligence (AI) models to narrow down the list of possible address/owner matches. Once a listing is found, Granicus uses the power of AI as well as human analysts to identify the exact addresses and owner information for each identifiable home-share /short-term rental listing. The fact that the City of Santa Monica has a high number of multi-family buildings will complicate the process and likely lower the effectiveness of the program, the platform will still result in a higher number of identifiable listings than the current manual process will.

5.G
Packet Pg. 1054
6 of 10
The Granicus software will also automate the systematic capture of listing screenshots.

Listing status, metadata and full screen screenshots are time stamped and made available in real time on the rental unit record. This evidence collection streamlines the code enforcement process by providing documented evidence of every address match to support all of Santa Monica’s enforcement efforts. Users can easily track the status of individual rentals and create case notes on the unit’s record.

As complaints are received, or violations are confirmed, the platform’s compliance monitoring abilities allows staff to stay in control of the enforcement process and save time by sending courtesy letters and notices of violation, using City approved templates, with the click of a button. These letters can include photos or other evidence which can increase our outreach effectiveness and efficiency. This process will enable Code Enforcement staff to be more proactive in the enforcement of the Home-sharing Ordinance.

The platform also includes a mobile permitting and registration portal. This simplifies Santa Monica’s currently manual permitting and registration processes and significantly reduces the administrative costs on the back end.

Transient Occupancy Tax (TOT) will also be collected through the Granicus platform.

Currently, TOT is primarily collected from Airbnb and VRBO. A few properties as well as the platform Trip Advisor also pay the City directly. The City entered into agreements with Airbnb and Homeaway whereby the platforms would collect the required taxes and remit them to the City on behalf of their users. The data included with the remittance is anonymized and cannot be traced to any specific listing nor easily audited. The Granicus platform will provide a user-friendly process to licensees where they can remit TOT for transactions booked through platforms beyond Airbnb and VRBO. Monthly emails will be automatically sent to licensees, reminding them of the deadline to pay the taxes owed and providing a direct link to the portal where income can be itemized, and taxes paid.

5.G
Packet Pg. 1055
7 of 10
Rental activity monitoring automates and strengthens the City’s ability to audit hosts, maximizing the impact of audit efforts. By looking for signs of rental activity, Granicus can assist with identifying tax fraud and occupancy and/or booking violations by homeshare listings. Listing reviews and calendar updates are two of the methods used to identify rental activity.

Granicus can help streamline the audit process by allowing the City to request all backup information be submitted through simple, interactive online forms. Hosts can easily upload short-term rental revenue statements to verify rental activity.

Concerned neighbors can call a 24/7 short term rental hotline or report incidents online directly through the service. This portal allows reporting parties to provide information on alleged incidents and are asked to submit photos, videos or other proof of the alleged violation. If a property is registered, Granicus immediately calls and texts hosts and/or emergency contacts to seek acknowledgement and resolution. Complaints and resolution notes are saved in the database so serial offenders can be held accountable.

A dashboard is provided where detailed reports are available, allowing the City to track all home-share related complaints in real time. Information will be widely available through 311, the City’s website and shared on social media and citywide messaging once it is available.

All personal data that is collected will be available only to those City staff members with login access. The primary users will be Code Enforcement, Finance, and City Attorney staff.

Past Council Actions
Meeting Date Description
4/28/2015 Ordinance 2484 – Creation of Home-Sharing Ordinance 1/10/2017 Ordinance 2535 – Home-Sharing Ordinance update; amend definitions, limit obligations on hosting platforms
6/13/2017 Ordinance 2547 – Home-Sharing Ordinance update; treatment of accessory dwelling units

5.G
Packet Pg. 1056
8 of 10
9/10/2019 Ordinance 2616 – Strengthen regulation of home-sharing and vacation rentals
10/25/2022 Resolution 11481 – Establish a special home-share legalization program to authorize previously permitted home-share operators to resume operations pending updates to the Home-Sharing
Ordinance and Zoning Ordinance
3/11/2023 City Council workshop to select Council priorities and provide direction on the Fiscal Year 2023-2025 budget
3/21/2023 Zoning Ordinance amendments for Housing Element implementation, including amendments to accessory structures 5/9/2023 Ordinance 2784 – Authorize home-sharing in certain accessory structures and incorporate a home-sharing legalization program Vendor Selection
Staff met with and attended demonstrations of the two most prominent short-term rental monitoring services, Granicus (Host Compliance) and Avenu Insights (Harmari). Both providers demonstrated an overview of their services and capabilities. After internal discussions, staff decided that Granicus is the system that best meets the needs of the City of Santa Monica.

Exception to Competitive Bidding
Staff recommends contracting with SHI International Corp. for services from Granicus, LLC. to furnish and deliver home-sharing address identification, compliance monitoring, registration, and tax collection services as an exception to competitive bidding per Municipal Code 2.24.250(c): competitive procedures were followed by a governmental agency, federal, state, county, city, joint powers agency, special district, or cooperative purchasing agency, that are equivalent to the procedures required in Chapter 2.24, and the goods or services are supplied to the City at the same or better price.

In 2018, The city of Mesa, Arizona conducted a competitive process through the Omnia Partners, Public Sector Purchasing Alliance, for technology products, services, solutions, and related products. Contract #2018011-02 was awarded to SHI International Corp. to provide information technology solutions and services. SHI International offers software services from Granicus. The City of Mesa, Arizona has partnered with OMNIA partners to make this solicitation available to other public agencies nationally, including state and local governmental entities, public and private primary, secondary and higher education entities, non-profit entities, and agencies for the public benefit. The City of Santa Monica will piggyback on this contract which offers a 4.5% discount for Granicus services.

5.G
Packet Pg. 1057
9 of 10
Environmental Review
The award contract is categorically exempt from CEQA pursuant to Section 15061(b)(3) of the CEQA Guidelines. The award contract is covered by the common sense exemption which states that CEQA does not apply, “where it can be seen with certainty that there is no possibility that the activity in question may have a significant effect on the environment.” The contract will provide the city with cloud-base software services for administrative functions. Therefore, it can be seen with certainty that the contract would not result in adverse physical impacts on the environment, and as such, is categorically exempt from CEQA.

Financial Impacts and Budget Actions
Staff seeks authority to approve funding from the General Fund to award a contract with SHI International to purchase Granicus cloud-based short-term rental software services.

Future year funding will be contingent on Council budget approval.

Agreement Request
FY 2023-24 Budget
Request Amount Future Years Account # Total Contract Amount $45,308 $410,252 01700005.550010 $455,560
The revenue impact is uncertain since part or all of the revenue collected from properties not currently paying could be offset by the removal of illegal listing that are paying. Staff will adjust revenue budgets accordingly in the future.

Prepared By: Daniel Mick, Code Enforcement Manager
Approved Forwarded to Council

5.G
Packet Pg. 1058
10 of 10
Attachments:

A. SHI Quote-23637892
B. Breakdown of Yearly Charges
C. RE_ Cooperative purchase agreement (SHI International) for short-term rental services through Granicus (Host Compliance)
D. Granicus Oaks Initiative Form
E. FY23-24 Living Wage Certification Form Granicus
F. SHI International - Oaks Initiative Form

5.G
Packet Pg. 1059

5.G.a
Packet Pg. 1060 Attachment: SHI Quote-23637892 (5869 : Homeshare Permitting, Address Identification, Compliance Monitoring, and Tax Collection Software)

5.G.a
Packet Pg. 1061 Attachment: SHI Quote-23637892 (5869 : Homeshare Permitting, Address Identification, Compliance Monitoring, and Tax Collection Software)

5.G.a
Packet Pg. 1062 Attachment: SHI Quote-23637892 (5869 : Homeshare Permitting, Address Identification, Compliance Monitoring, and Tax Collection Software)

5.G.a
Packet Pg. 1063 Attachment: SHI Quote-23637892 (5869 : Homeshare Permitting, Address Identification, Compliance Monitoring, and Tax Collection Software)

5.G.a
Packet Pg. 1064 Attachment: SHI Quote-23637892 (5869 : Homeshare Permitting, Address Identification, Compliance Monitoring, and Tax Collection Software)

5.G.a
Packet Pg. 1065 Attachment: SHI Quote-23637892 (5869 : Homeshare Permitting, Address Identification, Compliance Monitoring, and Tax Collection Software)

5.G.a
Packet Pg. 1066 Attachment: SHI Quote-23637892 (5869 : Homeshare Permitting, Address Identification, Compliance Monitoring, and Tax Collection Software)

5.G.a
Packet Pg. 1067 Attachment: SHI Quote-23637892 (5869 : Homeshare Permitting, Address Identification, Compliance Monitoring, and Tax Collection Software) # Product Granicus - Part#: Start End Year Total
1 Enterprise SSO NPN-Grani-Enter-A 1/1/2024 6/30/2024 1 $2,978.25 2 Esri Integration NPN-Grani-EsriI-A 1/1/2024 6/30/2024 1 $2,978.25 3 Address Identification NPN-Grani-Addre-A 10/1/2023 6/30/2024 1 $16,817.09 4 24/7 Hotline NPN-Grani-24/7H-A 1/1/2024 6/30/2024 1 $4,380.94 5 Compliance Monitoring NPN-Grani-Compl-A 1/1/2024 6/30/2024 1 $5,945.57 6 Rental Activity Monitoring NPN-Grani-Renta-A 1/1/2024 6/30/2024 1 $5,632.64 7 Enhanced Short-Term Rental Registration Portal NPN-Grani-Enhan-A 4/1/2024 6/30/2024 1 $2,221.92 8 Mobile Permitting & Registration NPN-Grani-Mobi-A 7/1/2023 6/30/2024 1 $0.00 9 Enhanced Short-Term Rental Tax Collection
Portal NPN-Grani-EnhanS-A 4/1/2024 6/30/2024 1 $2,221.92 10 Tax Collection NPN-Grani-TaxCo-A 7/1/2023 6/30/2024 1 $0.00 11 Custom API Integration NPN-Grani-Custo-A 4/1/2024 6/30/2024 1 $1,510.50 12 Certified Letters (RAM) NPN-Grani-Certi-A 4/1/2024 6/30/2024 1 $621.30 13 Enterprise SSO NPN-Grani-Enter-A 7/1/2024 6/30/2025 2 $4,932.20 14 Esri Integration NPN-Grani-EsriI-A 7/1/2024 6/30/2025 2 $6,165.14 15 Address Identification NPN-Grani-Addre-A 7/1/2024 6/30/2025 2 $23,319.75 16 24/7 Hotline NPN-Grani-24/7H-A 7/1/2024 6/30/2025 2 $9,068.79 17 Compliance Monitoring NPN-Grani-Compl-A 7/1/2024 6/30/2025 2 $12,307.65 18 Rental Activity Monitoring NPN-Grani-Renta-A 7/1/2024 6/30/2025 2 $11,659.88 19 Enhanced Short-Term Rental Registration Portal NPN-Grani-Enhan-A 7/1/2024 6/30/2025 2 $9,068.78 20 Mobile Permitting & Registration NPN-Grani-Mobi-A 7/1/2024 6/30/2025 2 $0.00 21 Enhanced Short-Term Rental Tax Collection
Portal NPN-Grani-EnhanS-A 7/1/2024 6/30/2025 2 $9,068.78 22 Tax Collection NPN-Grani-TaxCo-A 7/1/2024 6/30/2025 2 $0.00 23 Custom API Integration NPN-Grani-Custo-A 7/1/2024 6/30/2025 2 $6,165.14 24 Certified Letters (RAM) NPN-Grani-Certi-A 7/1/2024 6/30/2025 2 $2,466.05 25 Enterprise SSO NPN-Grani-Enter-A 7/1/2025 6/30/2026 3 $6,474.01 26 Esri Integration NPN-Grani-EsriI-A 7/1/2025 6/30/2026 3 $6,474.01 27 Address Identification NPN-Grani-Addre-A 7/1/2025 6/30/2026 3 $24,488.07 28 24/7 Hotline NPN-Grani-24/7H-A 7/1/2025 6/30/2026 3 $9,523.14 29 Compliance Monitoring NPN-Grani-Compl-A 7/1/2025 6/30/2026 3 $12,924.26 30 Rental Activity Monitoring NPN-Grani-Renta-A 7/1/2025 6/30/2026 3 $12,244.05 31 Enhanced Short-Term Rental Registration Portal NPN-Grani-Enhan-A 7/1/2025 6/30/2026 3 $9,523.12 32 Mobile Permitting & Registration NPN-Grani-Mobi-A 7/1/2025 6/30/2026 3 $0.00 33 Enhanced Short-Term Rental Tax Collection
Portal NPN-Grani-EnhanS-A 7/1/2025 6/30/2026 3 $9,523.12 34 Tax Collection NPN-Grani-TaxCo-A 7/1/2025 6/30/2026 3 $0.00 35 Custom API Integration NPN-Grani-Custo-A 7/1/2025 6/30/2026 3 $6,474.01 36 Certified Letters (RAM) NPN-Grani-Certi-A 7/1/2025 6/30/2026 3 $2,589.60 37 Enterprise SSO NPN-Grani-Enter-A 7/1/2026 6/30/2027 4 $6,798.36 38 Esri Integration NPN-Grani-EsriI-A 7/1/2026 6/30/2027 4 $6,798.36 39 Address Identification NPN-Grani-Addre-A 7/1/2026 6/30/2027 4 $25,714.93 40 24/7 Hotline NPN-Grani-24/7H-A 7/1/2026 6/30/2027 4 $10,000.24 41 Compliance Monitoring NPN-Grani-Compl-A 7/1/2026 6/30/2027 4 $13,571.77 42 Rental Activity Monitoring NPN-Grani-Renta-A 7/1/2026 6/30/2027 4 $12,857.46 43 Enhanced Short-Term Rental Registration Portal NPN-Grani-Enhan-A 7/1/2026 6/30/2027 4 $10,000.23 44 Mobile Permitting & Registration NPN-Grani-Mobi-A 7/1/2026 6/30/2027 4 $0.00 45 Enhanced Short-Term Rental Tax Collection
Portal NPN-Grani-EnhanS-A 7/1/2026 6/30/2027 4 $10,000.23 46 Tax Collection NPN-Grani-TaxCo-A 7/1/2026 6/30/2027 4 $0.00 47 Custom API Integration NPN-Grani-Custo-A 7/1/2026 6/30/2027 4 $6,798.36

5.G.b
Packet Pg. 1068 Attachment: Breakdown of Yearly Charges [Revision 2] (5869 : Homeshare Permitting, Address Identification, Compliance Monitoring, and Tax 48 Certified Letters (RAM) NPN-Grani-Certi-A 7/1/2026 6/30/2027 4 $2,719.34 49 Enterprise SSO NPN-Grani-Enter-A 7/1/2027 6/30/2028 5 $7,138.96 50 Esri Integration NPN-Grani-EsriI-A 7/1/2027 6/30/2028 5 $7,138.96 51 Address Identification NPN-Grani-Addre-A 7/1/2027 6/30/2028 5 $27,003.24 52 24/7 Hotline NPN-Grani-24/7H-A 7/1/2027 6/30/2028 5 $10,501.26 53 Compliance Monitoring NPN-Grani-Compl-A 7/1/2027 6/30/2028 5 $14,251.71 54 Rental Activity Monitoring NPN-Grani-Renta-A 7/1/2027 6/30/2028 5 $13,501.63 55 Enhanced Short-Term Rental Registration Portal NPN-Grani-Enhan-A 7/1/2027 6/30/2028 5 $10,501.24 56 Mobile Permitting & Registration NPN-Grani-Mobi-A 7/1/2027 6/30/2028 5 $0.00 57 Enhanced Short-Term Rental Tax Collection
Portal NPN-Grani-EnhanS-A 7/1/2027 6/30/2028 5 $10,501.24 58 Tax Collection NPN-Grani-TaxCo-A 7/1/2027 6/30/2028 5 $0.00 59 Custom API Integration NPN-Grani-Custo-A 7/1/2027 6/30/2028 5 $7,138.96 60 Certified Letters (RAM) NPN-Grani-Certi-A 7/1/2027 6/30/2028 5 $2,855.58 $455,559.99
Year Sum of Total $455,559.99
1 $45,308.38
2 $94,222.16
3 $100,237.39
4 $105,259.28
5 $110,532.78
Grand Total $455,559.99
Subtotal
Contract Total

5.G.b
Packet Pg. 1069 Attachment: Breakdown of Yearly Charges [Revision 2] (5869 : Homeshare Permitting, Address Identification, Compliance Monitoring, and Tax 1 Daniel Mick
From: Denise Mixon
Sent: Monday, April 24, 2023 5:16 PM
To: Daniel Mick
Subject: RE: Cooperative purchase agreement (SHI International) for short-term rental services through Granicus (Host Compliance)
Hi Daniel,
This appears to meet all the requirements.

Thank you,
Denise Mixon
Senior Buyer | 310-458-2211
From: Daniel Mick <[email protected]>
Sent: Monday, April 24, 2023 2:16 PM
To: Denise Mixon <[email protected]>
Subject: Cooperative purchase agreement (SHI International) for short-term rental services through Granicus (Host Compliance)
Denise,
I am still looking into potential options to forgo the RFP process in the hiring of a short-term rental vendor.

Host Compliance (Granicus) is 1 of 2 vendors that I am aware of that offer this type of service.

There is a cooperative purchasing agreement that was awarded by Mesa, AZ for SHI International/ OMNIA Partners, who offer the Host Compliance (Granicus) service at a 4.5% discount.

I believe you said that cooperative purchasing agreements had to meet 3 criteria.

I have included them below and links to the documents.
 The original bid must have been publicly advertised and opened using a process equivalent to the City’s.  The bid results must be readily available and publicly listed.  Information related to the agency bid including initial specifications, posting, award analysis and price.

The bid documents can be found on the OMNIA Partners website at https://www.omniapartners.com/publicsector/suppliers/shi/contract-documentation Additionally, the Mesa, AZ website has documents posted as well https://apps.mesaaz.gov/purchasingcontracts/Search  Search contact # 2018011
Can you review this information and let me know if the cooperative purchase agreement with SHI for Granicus’ services meet the requirements of the City?
Thank you in advance!

5.G.c
Packet Pg. 1070 Attachment: RE_ Cooperative purchase agreement (SHI International) for short-term rental services through Granicus (Host Compliance) (5869 2 Daniel Mick, CCEO, MPA, MUP
Code Enforcement Manager
City of Santa Monica
310-458-4984 x5367
[email protected]
santamonica.gov
Facebook | Twitter | Instagram
Subscribe to City of Santa Monica Email Updates

5.G.c
Packet Pg. 1071 Attachment: RE_ Cooperative purchase agreement (SHI International) for short-term rental services through Granicus (Host Compliance) (5869

CITY OF SANTA MONICA

OAKS INITIATIVE NOTICE

NOTICE TO APPLICANTS, BIDDERS, PROPOSERS

AND OTHERS SEEKING DISCRETIONARY PERMITS, CONTRACTS,

OR OTHER BENEFITS FROM THE CITY OF SANTA MONICA
Santa Monica’s voters adopted a City Charter amendment commonly known as the Oaks Initiative. The Oaks Initiative requires the City to provide this notice and information about the Initiative’s requirements. You may obtain a full copy of the Initiative’s text from the City Clerk.

This information is required by City Charter Article XXII—Taxpayer Protection. It prohibits a public official from receiving, and a person or entity from conferring, specified personal benefits or campaign advantages from a person or entity after the official votes, or otherwise takes official action, to award a “public benefit” to that person or entity. The prohibition applies within and outside of the geographical boundaries of Santa Monica.

All persons or entities applying or receiving public benefits from the City of Santa Monica shall provide the names of trustees, directors, partners, and officers, and names of persons with more than a 10% equity, participation or revenue interest. An exception exists for persons serving in those capacities as volunteers, without compensation, for organizations exempt from income taxes under Section 501(c)(3), (4), or (6), of the Internal Revenue Code. However, this exception does not apply if the organization is a political committee or controls political committees. Examples of a “public benefit” include public contracts to provide goods or services worth more than $25,000 or a land use approval worth more than $25,000 over a 12-month period.

In order to facilitate compliance with the requirements of the Oaks Initiative, the City compiles and maintains certain information. That information includes the name of any person or persons who is seeking a “public benefit.” If the “public benefit” is sought by an entity, rather than an individual person, the information includes the name of every person who is: (a) trustee, (b) director, (c) partner, (d) officer, or has (e) more than a ten percent interest in the entity. Therefore, if you are seeking a “public benefit” covered by the Oaks Initiative, you must supply that information on the Oaks Initiative Disclosure Form. This information must be updated and supplied every 12 months.

DocuSign Envelope ID: A8068B94-2625-4889-85F5-369066A14AA8

5.G.d
Packet Pg. 1072 Attachment: Granicus Oaks Initiative Form (5869 : Homeshare Permitting, Address Identification, Compliance Monitoring, and Tax Collection

CITY OF SANTA MONICA

OAKS INITIATIVE DISCLOSURE FORM
In order to facilitate compliance with the requirements of the Oaks Initiative, the City compiles and maintains certain information. That information includes the name of any person or persons who is seeking a “public benefit.” If the “public benefit” is sought by an entity, rather than an individual person, the information includes the name of every person who is: (a) trustee, (b) director, (c) partner, (d) officer, or has (e) more than a ten percent interest in the entity.

Public benefits include:

1. Personal services contracts in excess of $25,000 over any 12-month period;

2. Sale of material, equipment or supplies to the City in excess of $25,000 over a 12- month period;

3. Purchase, sale or lease of real property to or from the City in excess of $25,000 over a 12- month period;

4. Non-competitive franchise awards with gross revenue of $50,000 or more in any 12-month period;

5. Land use variance, special use permit, or other exception to an established land use plan, where the decision has a value in excess of $25,000;

6. Tax “abatement, exception, or benefit” of a value in excess of $5,000 in any 12- month period; or

7. Payment of “cash or specie” of a net value to the recipient of $10,000 in any 12- month period.

Name(s) of persons or entities receiving public benefit:

Name(s) of trustees, directors, partners, and officers:

Name(s) of persons with more than a 10% equity, participation, or revenue interest:

Prepared by: ____________________________Title: __________________________ Signature: ______________________________________ Date: ________________ Email: ____________________________________ Phone: ____________________ FOR CITY USE ONLY:

Bid/PO/Contract # ____________________________ Permit # ___________________________ Granicus, LLC
[email protected] (800) 314-0147
Please see the attached list. GovDelivery Holdings, LLC - 100% Owner DocuSign Envelope ID: A8068B94-2625-4889-85F5-369066A14AA8 Brendan Stierman Manager, Contracts
4/20/2023

5.G.d
Packet Pg. 1073 Attachment: Granicus Oaks Initiative Form (5869 : Homeshare Permitting, Address Identification, Compliance Monitoring, and Tax Collection granicus.com | [email protected] page 1
granicus.com
Granicus, LLC Officer List
Name Title
Mark Hynes Chief Executive Officer
Ira Kleinman Co-President
Patrick M. Severson Co-President
Chief Financial Officer Mahmudul Amin
Vice President Andrew Schoenthal
Vice President Ryan Atlas
Secretary Joshua Carter
Secretary Derek Klomhaus
DocuSign Envelope ID: A8068B94-2625-4889-85F5-369066A14AA8

5.G.d
Packet Pg. 1074 Attachment: Granicus Oaks Initiative Form (5869 : Homeshare Permitting, Address Identification, Compliance Monitoring, and Tax Collection

CITY OF SANTA MONICA

LIVING WAGE ORDINANCE
Certification for Providers of Services to the City of Santa Monica (Fiscal Year 23/24 – July 1, 2023 through June 30, 2024)

TO BE COMPLETED BY ALL CONTRACTORS PROVIDING SERVICES TO THE CITY OF SANTA MONICA IN EXCESS OF $54,200
The City of Santa Monica Municipal Code Chapter 4.65, Living Wage Ordinance (LWO), establishes a Minimum Wage of $19.73 per hour for certain employees of contractors providing services to the City where services exceed $54,200 or more and requires that contractors also provide the same health care and other benefits to employees’ same sex spouses and domestic partners as are provided to other employees’ spouses.

An employee covered by the LWO is any person who does not actually work as a manager, supervisor, or confidential employee, and who is not required to possess an occupational license.

The Living Wage Ordinance applies the services sought pursuant to this bid and bidders are required to prepare and return the Living Wage Certification Form. If the bidder is selected, the bidder must maintain payroll records that include, at minimum, the full name of each employee providing services under the contract, job classification and rate of pay. Bids that fail to include Certification Forms may be considered nonresponsive and excluded from further consideration.

Please prepare the following certification if you are a contractorengaging ina contract for services with the City of Santa Monica in excess of $54,200.

Your signature on this certification grants the City permission to review any and all payroll books and records and any company documents pertaining to the benefits offered to employees to assure your compliance with the LWO during the term of the contract.

Please direct any questions to:

City of Santa Monica Finance Department
Attention: Living Wage Compliance Section
1685 Main Street, Mail Stop 09
Santa Monica, CA 90401
You can also contact staff regarding living wage ordinance questions by e-mail at [email protected] or by phone 310-458-8281.

DocuSign Envelope ID: 03992D27-95C7-4B9D-897D-9387410B930C

5.G.e
Packet Pg. 1075 Attachment: FY23-24 Living Wage Certification Form Granicus (5869 : Homeshare Permitting, Address Identification, Compliance Monitoring,

CITY OF SANTA MONICA

LIVING WAGE ORDINANCE CERTIFICATION
July 1, 2023 through June 30, 2024

TO BE COMPLETED BY ALL CONTRACTORS PROVIDING SERVICES TO THE CITY OF SANTA MONICA IN EXCESS OF $54,200
MINIMUM WAGE - $19.73 per hour
Please read, complete, and sign the following:

THIS CONTRACT IS SUBJECT TO THE LIVING WAGE ORDINANCE

THIS CONTRACT IS NOT SUBJECT TO THE LIVING WAGE ORDINANCE If this contract is not subject to the Living Wage Ordinance requirements, please note the reason below and attach supporting documentation for exemption. For example, in order to be exempt pursuant to a collective bargaining agreement, a signed collective bargaining agreement must be attached. (a) ________ contractor is a government agency and is exempt (b) ________ contractor is a City grantee and is exempt (c) ________ contractor is a non-profit corporation and is exempt (d) ________ contractor is an employer whose employees are covered by a bona fide collective bargaining agreement where the waiver is explicitly set forth in an agreement in clear and unambiguous terms
(e) ________ contractor is a corporation providing banking services The undersigned, on behalf of himself or herself individually and on behalf of his or her business or organization, hereby certifies that he or she is fully aware of Santa Monica’s Living Wage Ordinance (LWO), and the applicability of the LWO, and the applicability of the subject contract, as determined herein. The undersigned further agrees to be bound by all terms of the LWO, as mandated in all sections of Santa Monica Municipal Code, Chapter 4.65. If, at any time during the term of the contract, the answers to the questions posed herein change so that Contractor would be subject to the LWO, Contractor will promptly notify the Director of Finance in writing. Contractor further understands and agrees that the failure to comply with the LWO, this certification, or the terms of the Contract as it applies to the LWO, shall constitute a default of the Contract, which shall be grounds for termination. City shall have the right to examine all books and records of the Contractor as they relate to compliance with the LWO. Payroll records shall at a minimum include the full name of each employee performing labor or providing services under the contract, job classification, and rate of pay.

These statements are made under penalty of perjury under the laws of the State of California.

Printed Name: _______________________________________Title: _______________________________ Signature: __________________________________________ Date: _______________________________ Contractor: ________________________________________ Bid Number (if applicable):_____________ Service Description:
_______________________________________________________________________________________ _______________________________________________________________________________________ Granicus, LLC Website creation and maintenance services, including the ability to post agendas/documents, create archives, create minutes, stream events and allows clerk's office to simplify the application process on their website. ✔ DocuSign Envelope ID: 03992D27-95C7-4B9D-897D-9387410B930C 7/31/2023
Kelly Oliver Vice President - Legal

5.G.e
Packet Pg. 1076 Attachment: FY23-24 Living Wage Certification Form Granicus (5869 : Homeshare Permitting, Address Identification, Compliance Monitoring,

CITY OF SANTA MONICA

OAKS INITIATIVE NOTICE

NOTICE TO APPLICANTS, BIDDERS, PROPOSERS

AND OTHERS SEEKING DISCRETIONARY PERMITS, CONTRACTS,

OR OTHER BENEFITS FROM THE CITY OF SANTA MONICA
Santa Monica’s voters adopted a City Charter amendment commonly known as the Oaks Initiative. The Oaks Initiative requires the City to provide this notice and information about the Initiative’s requirements. You may obtain a full copy of the Initiative’s text from the City Clerk.

This information is required by City Charter Article XXII—Taxpayer Protection.

It prohibits a public official from receiving, and a person or entity from conferring, specified personal benefits or campaign advantages from a person or entity after theofficial votes, or otherwise takes official action, to award a “public benefit” to that person or entity. The prohibition applies within and outside of the geographical boundaries of SantaMonica.

All persons or entities applying or receiving public benefits from the City of Santa Monica shall provide the names of trustees, directors, partners, and officers, and names of persons with more than a 10% equity, participation or revenue interest. An exception exists for persons serving in those capacities as volunteers, without compensation, for organizations exempt from income taxes under Section 501(c)(3), (4), or (6), of the Internal Revenue Code. However, this exception does not apply if the organization is a political committee or controls political committees.

Examples of a “public benefit” include public contracts to provide goods or services worth more than $25,000 or a land use approval worth more than $25,000 over a 12- month period.

In order to facilitate compliance with the requirements of the Oaks Initiative, theCity compiles and maintains certain information. That information includes the name of any personorpersons whois seeking a “publicbenefit.” If the“public benefit” is sought by an entity, ratherthan an individual person, the information includes the nameof everyperson who is: (a) trustee, (b) director, (c) partner, (d) officer, or has (e) more than a ten percent interest in the entity. Therefore, if you are seeking a “public benefit” covered by the Oaks Initiative, you must supply that information on the Oaks Initiative Disclosure Form. This information must be updated and supplied every 12 months.

5.G.f
Packet Pg. 1077 Attachment: SHI International - Oaks Initiative Form (5869 : Homeshare Permitting, Address Identification, Compliance Monitoring, and Tax

CITY OF SANTA MONICA

OAKS INITIATIVE DISCLOSURE FORM
In order to facilitate compliance with the requirements of the Oaks Initiative, the City compiles and maintains certain information. That information includes the name of any person or persons who is seeking a “public benefit.” If the “public benefit” is sought by an entity, rather than an individual person, the information includes the name of every person who is: (a) trustee, (b) director, (c) partner, (d) officer, or has (e) more than a ten percent interest in the entity.

Public benefits include:

1. Personal services contracts in excess of $25,000 over any 12-monthperiod;

2. Sale of material, equipment or supplies to the City in excess of $25,000 over a 12- month period;

3. Purchase, sale or lease of real property to or from the City in excess of $25,000 over a 12- month period;

4. Non-competitive franchise awards with gross revenue of $50,000 or more inany 12-month period;

5. Land use variance, special use permit, or other exception to an established land use plan, where the decision has a value in excess of $25,000;

6. Tax “abatement, exception, or benefit” of a value in excess of $5,000 in any 12- month period; or

7. Payment of “cash or specie” of a net value to the recipient of $10,000 in any 12- month period.

Name(s) of persons or entities receiving public benefit:

Name(s) of trustees, directors, partners, and officers:

Name(s) of persons with more than a 10% equity, participation, or revenue interest:

Prepared by: Title:

Signature: Date:

Email: Phone:

Permit #
FOR CITY USE ONLY:

Bid/PO/Contract #

5.G.f
Packet Pg. 1078 Attachment: SHI International - Oaks Initiative Form (5869 : Homeshare Permitting, Address Identification, Compliance Monitoring, and Tax City Council
Report
City Council Meeting: September 26, 2023
Agenda Item: 5.H
1 of 4
To: Mayor and City Council
From: Rick Valte, Public Works Director, Public Works, Water Resources Subject: Award Purchase Order with Badger Meter, Inc. to Furnish and Deliver Water Meters
Recommended Action
Staff recommends that City Council:

1. Adopt a finding of categorical exemption pursuant to Section 15302 (Replacement or Reconstruction) of the California Environmental Quality Act (CEQA) Guidelines.

2. Authorize the Procurement Manager to issue a purchase order with Badger Meter, Inc. for the purchase of positive-displacement water meters for the Water Resources Division of the Public Works Department. This recommended award is made as an exception to the competitive bidding process pursuant to Santa Monica Municipal Code (SMMC) Section 2.24.250(b) and is for a total amount not to exceed $1,658,000 over a five-year period, with future year funding contingent on Council budget approval.

5.H
Packet Pg. 1079
2 of 4
Summary
The City of Santa Monica’s Water Resources Division is charged with providing safe and reliable water and wastewater services to all residential, commercial, and institutional accounts within the City of Santa Monica. Each account is connected to the city water supply through a water meter that registers usage for bimonthly billing for water and wastewater services. New meters are installed for new construction projects and to replace aging meters on an approximate 20-year cycle to ensure the accuracy of meter reads and billing. Staff recommends issuing a purchase order with Badger Meter in an amount not to exceed $1,658,000 over a five-year period for the purchase of positive-displacement water meters along with data transmissions fees to transmit customer water usage data for billing.

Discussion
The City owns and maintains over 18,000 water meters throughout its water distribution system which are used to record water usage so that the Billing and Collections Office in the Revenue Division of the Finance Department may establish the quantity of water used and wastewater discharged to be billed to the customer. Water meters contain mechanical components which deteriorate over time, resulting in a loss of accuracy as water passes through the meter without being registered. Replacing meters on a timely basis can reduce water losses or “non-revenue” water from the City’s distribution system. New meters are also requested for new construction or tenant improvements through the Public Works Department permit counter. The City recovers the cost for the new meter purchases and installations through permit fees.

On August 23, 2022, City Council awarded an agreement to Badger Meter, Inc. to remove and replace approximately 65 percent of the City’s existing meters and equip 100 percent of the City’s meters with Advanced Metering Infrastructure (AMI)-ready water meters (“AMI project.”) The AMI project will enhance customer experience by providing real-time monitoring of their water usage and leak alerts. The completion of the AMI project in late 2026 will result in modernizing the majority of the City’s existing water meters to Badger AMI-equipped advanced water meters.

5.H
Packet Pg. 1080
3 of 4
Approximately 35% of the meters will not be replaced through the AMI project as they were either already AMI ready, scheduled for replacement prior to the AMI project, or were replaced within the last 7 years. Eventually all of the City’s water meters would be replaced with Badger meters with data transmitting abilities. The purchase order requested is for operational maintenance and replacement of the existing badger meters not replaced during the AMI project and any new meters requested to be installed by water customers.

Vendor Selection
This purchase order is being requested under the exception to the competitive bidding process for maintenance of the city’s meters (e.g., defective meters) and installation of new meters for new construction that are not covered by the AMI project.

Exception to Competitive Bidding
Staff recommends Badger Meter, Inc. to furnish and deliver positive-displacement water meters as an exception to competitive bidding per Muni Code 2.24.250 (b). This purchase meets the City’s exception to the competitive criteria (b), as the meters are proprietary to Badger.
b. when a good or service is copyrighted, patented or only available form one license holder, including, proprietary goods, original equipment manufacturers and/or exclusive distributors.

Environmental Review
The replacement of water meters is categorically exempt pursuant to Section 15302 (Replacement and Reconstruction) of the California Environmental Quality Act (CEQA) Guidelines. Section 15302 exempts Class 2 projects which “consists of replacement or reconstruction of existing structures and facilities where the new structure will be located on the same site as the structure replaced and will have substantially the same purpose and capacity as the structure replaced”. The new water meters would replace existing meters with essentially the same purpose and capacity, and therefore, the award for replacement water meters is categorically exempt from CEQA.

Past Council Actions

5.H
Packet Pg. 1081
4 of 4
Meeting Date Description
8/23/2022 (Attachment A) Bid Award for Advanced Metering Infrastructure (AMI) Meter Replacement
Financial Impacts and Budget Actions
Staff seeks authority to approve available funding from the Water Fund to award a purchase order to Badger Meter, Inc. for the purchase of positive-displacement water meters.

Purchase Order Request
FY 2023-24
Request Amount Department Account # Future Years Amount Total Contract
Amount
$300,000 50500001.525080 $1,358,000 $1,658,000
Future year funding is contingent on Council budget approval.

Prepared By: Thomas Poon, Senior Administrative Analyst Approved Forwarded to Council
Attachments:

A. Staff Report - August 23, 2022
B. Oaks Initiative Form - Badger Meter, Inc.

5.H
Packet Pg. 1082
City Council
Report
City Council Meeting: August 23, 2022
Agenda Item: 5.M
1 of 5
To: Mayor and City Council
From: Rick Valte, Public Works Director, Public Works, Water Resources Subject: Award Bid and Enter Into an Agreement with Badger, Inc. for AMI Smart Water Meters & Cloud-Based Interface
Recommended Action
Staff recommends that the City Council:

1. Award RFP# 320 to Badger Meter, Inc. to deliver, replace and install approximately 12,444 Advanced Metering Infrastructure (AMI) ready water meters along with AMI encoders and provide a cloud-based interface for an AMI System for the Public Works Department;

2. Authorize the City Manager to negotiate and execute an agreement with Badger Meter, Inc., in the amount not to exceed $13,500,000 (including 15% contingency).

3. Authorize the City Manager to negotiate and execute a Software as a Service (SaaS) Agreement with Badger Meter, Inc. in the amount not to exceed $300,000 over a five-year period.

Summary
The City’s Public Works Department – Water Resources Division delivers high-quality drinking water to approximately 18,400 metered water connections in the City. The current water meters are read manually on a bi-monthly schedule to bill each customer for their water use. For example, a customer’s June water bill is for water that is consumed during the prior two months (April and May). The Water Resources Division issued a request for proposals (RFP) for an Advanced Metering Infrastructure (AMI) system or smart water meters. The AMI Project was approved in the City’s CIP Budget and is funded through the 2021 Water Revenue Bonds. The AMI is a cloud-based system that transmits data via cellular network in near real time. The AMI system includes the replacement of aging non-AMI compatible meters, meter box lids,

5.H.a
Packet Pg. 1083 Attachment: Staff Report - August 23, 2022 (5916 : Badger Water Meters) 2 of 5
installation of cellular data transmitters (encoders) on every meter, data migration capability to the City’s billing software and a customer water monitoring portal.

Because the AMI provides real time information on water usage it allows for improved leak detection, which would significantly improve the City’s water conservation efforts, and provide customers with the ability to track their water use on a daily basis. Past studies have demonstrated that AMI systems could provide 5-7% in water savings from reduced residential water leaks. Long term benefits of the AMI system include more efficient billing, and improved accuracy in meter reads. Staff recommends that RFP #320 be awarded to Badger Meter, Inc. and that an agreement be negotiated and executed for the AMI System.

Discussion
Over the past five years, the Water Resources Division has conducted three independent AMI pilot tests utilizing different technologies. The current pilot test has been expanded and over 5% of the City’s water meters currently have AMI transmitters installed. The City’s meters are divided into 51 meter reading routes based on geographic location. As part of the pilot project, AMI transmitters have been fully installed in one of these routes and the data is currently being electronically transmitted into the City’s billing software and used for billing. This contract award is for the fullscale implementation of an AMI system for the City’s 18,400 meters.

The manual meter reading for the approximately 18,400 meters in the service area is performed on a bi-monthly schedule. Identifying hidden leaks or excessive water usage based on water consumption in a timely manner is difficult due to the meter reading cycle of 60 days. It takes one or two billing cycles, up to 120 days, for a leak or excessive usage to be identified from the meter reads. The end result is excessive water loss/usage and a high water bill due to this time delay. An AMI system would allow the customer to monitor their individual water usage and create alerts, via cell phone or e-mail, to notify them within a day or two of a potential water leak.

5.H.a
Packet Pg. 1084 Attachment: Staff Report - August 23, 2022 (5916 : Badger Water Meters) 3 of 5
The savings and efficiency benefits of the AMI system are mostly realized on the customer’s end from early detection of water leaks to real-time monitoring of daily water usage to minimize their water costs. The AMI system also provides cost savings to the City (estimated at $290,000 annually) by reducing the City’s reliance on more costly imported water and contractual services for meter reading.

The best qualified bidder, Badger Meter Inc., proposed a comprehensive scope of services to fully convert the City’s water metering infrastructure to an AMI system. The scope of services includes:
• Replacing approximately 12,444 water meters and upgrading them with AMI compatible water meters (approximately 67% of the total number of meters, the remaining 33% are AMI compatible and less than 8 years of age and do not need to be replaced),;
• Installation of cellular AMI transmitters (referred to as encoders) on new meters as well as meters in the system that are compatible;
• Replacement/modification of meter box lids to allow for cellular signal transmission;
• Staging and storage facilities for project implementation; • Migration of data into the City’s billing system, and • A customer portal to improve the customer’s experience in understanding their water usage.

The additional services offered by Badger Meter Inc. include a two-year cellular subscription fee and conducting a service line material survey during meter replacement for both the public and private side of the water service connection to replace lead service lines in compliance with the Environmental Protection Agency’s Lead and Copper Rule Revisions. Majority of the project costs are one-time costs to convert the City’s current water meter infrastructure to AMI. The lowest bid, Metron-Farnier, was not as comprehensive as the other three bids because it did not include the cost of the AMI compatible water meters and labor for installation.

5.H.a
Packet Pg. 1085 Attachment: Staff Report - August 23, 2022 (5916 : Badger Water Meters) 4 of 5
Vendor Selection
Bidder Recommendation
Best Bidder Badger Meter, Inc.

Evaluation Criteria • Experience – 20% of total score
• Technical Competence – 20% of total score
• Ability to Meet Project Work Plan and Timeliness – 20% of total score • References – 10% of total score
• Cost of Services, Cost Control – 30% of total score
Municipal Code SMMC 2.24.190
Submittals Received
Vendor Base Scope of Services Additional Services Total Aqua-Metrics Sales
Company
$11,345,202 $407,717 $11,752,919
Badger Meter, Inc. $11,305,418 $426,247 $11,731,665
Ferguson Waterworks $13,986,434 $0 $13,986,434
Metron-Farnier $6,198,3104 $0 $6,198,310
Bid Data
Date Posted Posted On Advertise In City
Charter & SMMC
Vendors
Downloaded
Date Publicly
Opened
5/9/2022 City’s Online
Bidding Site
Santa Monica Daily
Press
47 June 10, 2022
Best Bidder Justification
The proposals were reviewed by a selection panel consisting of staff from the Public Works Department – Water Resources Division. Evaluations were based on the following selection criteria: Experience; Technical Competence; Ability to Meet Project Work Plan and Timeliness; References; and Cost of Services, Cost Control. Based on these criteria, the selection panel unanimously ranked Badger Meter as the best qualified firm to provide the City with an AMI system. Badger Meter has successfully deployed over 10 million ORION endpoints for more than 3,000 utilities. They are the firm which provides the lowest cost while providing all the components for a successful deployment of an AMI system. The lowest bidder, Metron-Farnier, did not meet the full scope of services requirements as the bid only includes the AMI cellular transmitters and customer portal while the water meters were not included.

Financial Impacts and Budget Actions
Staff seeks authority to approve funding from the Water Fund to award a contract with

5.H.a
Packet Pg. 1086 Attachment: Staff Report - August 23, 2022 (5916 : Badger Water Meters) 5 of 5
Badger Meter, Inc for implementation of the AMI system in the City and ongoing software maintenance costs for the cloud-based portal. The initial capital outlay, which includes a 15% contingency, is being funded through proceeds from the 2021 Water Revenue Bond issuance, and staff seeks authority to approve use of bond proceeds to fund the award. Ongoing annual software maintenance costs will be funded through the Water Fund’s operating budget.

Contract Request
FY 2022-23
Request Amount CIP Account # Total Contract Amount
$13,500,000 C5008200.689740 $13,500,000
$36,432 505000001.550010 $300,000
$13,436,432 Total $13,800,000
Prepared By: Chris Aguillon, Water Resources Protection Specialist Approved Forwarded to Council
Attachments:

A. Oaks Initiative Disclosure (Badger)
B. Written Comment

5.H.a
Packet Pg. 1087 Attachment: Staff Report - August 23, 2022 (5916 : Badger Water Meters)

CITY OF SANTA MONICA

OAKS INITIATIVE DISCLOSURE FORM
In order to facilitate compliance with the requirements of the Oaks Initiative, the City compiles and maintains certain information. That information includes the name of any person or persons who is seeking a “public benefit.” If the “public benefit” is sought by an entity, rather than an individual person, the information includes the name of every person who is: (a) trustee, (b) director, (c) partner, (d) officer, or has (e) more than a ten percent interest in the entity.

Public benefits include:

1. Personal services contracts in excess of $25,000 over any 12-month period;

2. Sale of material, equipment or supplies to the City in excess of $25,000 over a 12- month period;

3. Purchase, sale or lease of real property to or from the City in excess of $25,000 over a 12- month period;

4. Non-competitive franchise awards with gross revenue of $50,000 or more inany 12-month period;

5. Land use variance, special use permit, or other exception to an established land use plan, where the decision has a value in excess of $25,000;

6. Tax “abatement, exception, or benefit” of a value in excess of $5,000 in any 12- month period; or

7. Payment of “cash or specie” of a net value to the recipient of $10,000 in any 12- month period.

Name(s) of persons or entities receiving public benefit:

Name(s) of trustees, directors, partners, and officers:

Name(s) of persons with more than a 10% equity, participation, or revenue interest:

Prepared by: Title:

Signature: Date:

Email: Phone:

Permit #
FOR CITY USE ONLY:

Bid/PO/Contract #
Kim K. Stoll Vice President - Sales & Marketing
08/09/2023
[email protected] (800)876-3837
Badger Meter, Inc.

None
Refer to Attached List

5.H.b
Packet Pg. 1088 Attachment: Oaks Initiative Form - Badger Meter, Inc. (5916 : Badger Water Meters) BADGER METER, INC.

BOARD OF DIRECTORS
2/2023
Kenneth C. Bockhorst
• Chairman, President and Chief Executive Officer: Badger Meter, Inc.

Todd A. Adams
• Chairman, President and Chief Executive Officer: Rexnord Gale E. Klappa
• Non-executive Chairman: WEC Energy Group
Gail A. Lione
• Senior Counsel: Dentons
• Adjunct Professor of Intellectual Property Law: Georgetown University School of Law • Retired Executive Vice President, General Counsel and Corporate Secretary & Chief Compliance Officer: Harley-Davidson Corporation
James W. McGill
• Retired Executive – Eaton Corporation
Tessa Myers
• Global Vice President- Software & Control: Rockwell Automation James F. Stern
• Executive Vice President, General Counsel and Secretary: A.O. Smith Corporation Glen E. Tellock
• President and Chief Executive Officer: Lakeside Foods Henry F. Brooks
• President - Power & Controls, Collins Aerospace (Raytheon Technologies Corporation)

5.H.b
Packet Pg. 1089 Attachment: Oaks Initiative Form - Badger Meter, Inc. (5916 : Badger Water Meters) Badger Meter, Inc. Corporate
Officers December 22, 2023
Elected Executive Officers:

Kenneth C. Bockhorst President and Chief Executive Officer Robert A. Wrocklage Sr. Vice President – Chief Financial Officer Karen M. Bauer Vice President – Investor Relations, Corporate Strategy and Treasurer Fred J. Begale Vice President – Engineering
William R.A. Bergum Vice President – General Counsel and Secretary Gregory M. Gomez Vice President – Global Flow Instrumentation and International Utility Sheryl L. Hopkins Vice President – Human Resources
William J. Parisen Vice President – Global Operations
Kimberly K. Stoll Vice President – Sales and Marketing
Daniel R. Weltzien Vice President – Controller
Elected Non-Executive Officers*:

Jennifer A. Awah-Manga Assistant Secretary Proposal Lead – Bid & Contract Administration Joanne K. Crumer-Pascale Assistant Treasurer Milwaukee Accounting Manager Wayne Dennis Assistant Secretary Senior Director – International Sales and Marketing and Business Development
Charla D. Dury Assistant Secretary Proposal Lead – Bid & Contract Administration Frank J. Fenton Assistant Secretary Director – Utility Sales Charity Granberry Assistant Treasurer Milwaukee Accounting Manager David A. Kutil Assistant Treasurer Director – Accounting & External Reporting Benjamin E. Loomis Assistant Secretary Milwaukee Credit Manager David A. Miller Assistant Secretary Counsel I
Pamela G. Stokke-Ceci Assistant Secretary Assistant General Counsel and Director *Scope of authority for Assistant Secretaries determined by job description and duties, as approved by the Corporation’s Secretary

5.H.b
Packet Pg. 1090 Attachment: Oaks Initiative Form - Badger Meter, Inc. (5916 : Badger Water Meters) City Council
Report
City Council Meeting: September 26, 2023
Agenda Item: 5.I
1 of 4
To: Mayor and City Council
From: Rick Valte, Public Works Director, Public Works, Water Resources Subject: Award Bid and enter into Agreement with General Pump Company, Inc. for Water Well and Booster Pump Repairs and Maintenance
Recommended Action
Staff recommends that the City Council:

1. Adopt a finding of categorical exemption pursuant to Section 15301 of the California Environmental Quality Act (CEQA) Guidelines.

2. Award Bid #4448 to General Pump Company, Inc. for water well and booster pump repair and maintenance for the Public Works Department.

3. Authorize the City Manager to negotiate and execute an agreement with General Pump Company, Inc. for an amount not to exceed $3,200,000 over a five-year period, with future year funding contingent on Council budget approval.

Summary
The City of Santa Monica’s Water Resources Division provides safe, reliable, and highquality drinking water to over 93,000 residents and over 2,700 businesses in the City.

The City’s local groundwater supply accounts for over 60 percent of the City’s water supply and historically costs 30 percent less than imported water supplies. To maintain reliable production of local groundwater, the Water Resources Division contracts out maintenance, repair and installation services for groundwater production wells and booster pumps used in the production, treatment, and distribution of high-quality drinking water to the community. Staff recommends awarding an agreement to service and maintain the City’s inventory of wells and booster pumps to General Pump Company, Inc. in an amount not to exceed $3,200,000 over a five-year period.

Discussion

5.I
Packet Pg. 1091
2 of 4
The Water Resources Division maintains three groundwater well fields that have a total of ten groundwater production wells and booster pumps at the Charnock and Arcadia Water Treatment Plants which distribute high-quality drinking water throughout the city.

Maintenance, installation, and repair services are critical to delivering reliable drinking water around the clock to the community. The City’s groundwater production wells pump groundwater from the Santa Monica Basin for treatment and require routine preventative maintenance activities including chemical treatments, jetting, nylon/wire brush services to remove well debris, video logging, and repairs to motors, casings, and controls, for efficient local groundwater production. Booster pumps on the drinking water distribution side help maintain adequate system water pressure and move water from groundwater wells to treatment facilities and water storage reservoirs that ultimately serve the community through the City’s 200+ mile network of water distribution mains and fire hydrants. The booster pumps require periodic replacement and repairs including fabrication of custom parts such as wear rings, line shafts, and bowl assemblies, to maintain reliable operations. Production, treatment, and distribution of local groundwater historically costs 30 percent less than purchasing imported water for potable water uses in the city. Maintaining reliable groundwater production helps maintain affordability of potable water to the city’s customers.

The selected contractor is also required to have a machine shop capable of fabricating custom well and pump parts, supplying and installing new equipment as needed, providing pump rigs, cranes, service trucks, and responding to urgent service requests within 24 hours of notice on a 24/7 basis.

Vendor Selection
Bidder Recommendation
Best Bidder General Pump Company, Inc.

Evaluation Criteria Price, the ability, capacity, and skill of the bidder to perform or provide the materials or services.

Municipal Code SMMC 2.24.180
Submittals Received
General Pump Company, Inc. $16,579 Lane Christensen Company $58,755

5.I
Packet Pg. 1092
3 of 4
Bid Data
Date
Posted Posted On
Advertise In
(City Charter & SMMC)
Vendors
Downloaded
Date Publicly
Opened
03/07/2023 City's Online
Bidding Site
Santa Monica Daily Press 12 04/20/2023
Best Bidder Justification
The bids were reviewed by a selection panel consisting of staff from the Public Works Department’s Water Resources Division and were evaluated based on experience and cost of services. Based on these criteria, the selection panel unanimously ranked General Pump Company, Inc. as the best qualified firm to provide water well and booster pump maintenance and repair services.

Environmental Review
The maintenance, repair, and replacement of groundwater wells and booster pumps are categorically exempt pursuant to Section 15301 (Existing Facilities) of the California Environmental Quality Act (CEQA) Guidelines. Section 15301 of provides exemption for the operation, repair, maintenance, permitting, or minor alteration of existing public or private structures, facilities, mechanical equipment, or topographical features, involving negligible or no expansion of use beyond that existing at the time of the lead agency's determination. This award agreement would ensure that the City’s existing groundwater wells and booster pumps are maintained and/or repaired. The agreement would not expand or materially change existing facilities or operations. Therefore, the award agreement is categorically exempt pursuant to Section 15301 of the CEQA Guidelines.

Financial Impacts and Budget Actions
Staff seeks authority to approve available funding from the Water Fund to award an agreement with General Pump Inc. for water well and booster pump maintenance and repair services.

Agreement Request
FY 2023-24 Budget
Request Amount
Account Number Future Year
Amount
Total Contract
Amount
200,000 50500001.550010 $866,667 $1,066,667
250,000 50500002.550010 $1,083,333 $1,333,333

5.I
Packet Pg. 1093
4 of 4
150,000 50500003.550010 $650,000 $800,000
600,000 Total: $2,600,000 $3,200,000
Future year funding is contingent on Council budget approval.

Prepared By: Thomas Poon, Senior Administrative Analyst Approved Forwarded to Council
Attachments:

A. Oaks Initiative Form - General Pump Company, Inc.

5.I
Packet Pg. 1094

CITY OF SANTA MONICA

OAKS INITIATIVE DISCLOSURE FORM
In order to facilitate compliance with the requirements of the Oaks Initiative, the City compiles and maintains certain information. That information includes the name of any person or persons who is seeking a “public benefit.” If the “public benefit” is sought by an entity, rather than an individual person, the information includes the name of every person who is: (a) trustee, (b) director, (c) partner, (d) officer, or has (e) more than a ten percent interest in the entity.

Public benefits include:

1. Personal services contracts in excess of $25,000 over any 12-month period;

2. Sale of material, equipment or supplies to the City in excess of $25,000 over a 12- month period;

3. Purchase, sale or lease of real property to or from the City in excess of $25,000 over a 12- month period;

4. Non-competitive franchise awards with gross revenue of $50,000 or more inany 12-month period;

5. Land use variance, special use permit, or other exception to an established land use plan, where the decision has a value in excess of $25,000;

6. Tax “abatement, exception, or benefit” of a value in excess of $5,000 in any 12- month period; or

7. Payment of “cash or specie” of a net value to the recipient of $10,000 in any 12- month period.

Name(s) of persons or entities receiving public benefit:

Name(s) of trustees, directors, partners, and officers:

Name(s) of persons with more than a 10% equity, participation, or revenue interest:

Prepared by: Title:

Signature: Date:

Email: Phone:

Permit #
FOR CITY USE ONLY:

Bid/PO/Contract #
Amy Kaing Contract Administrator
08/01/2023
[email protected] (909)599-9606, ext 260
General Pump Company, Inc.

Michael Bodart
Peter Brooks
Michael Bodart
Peter Brooks

5.I.a
Packet Pg. 1095 Attachment: Oaks Initiative Form - General Pump Company, Inc. (5917 : Water Well & Booster Pump Repairs & Maintenance) City Council
Report
City Council Meeting: September 26, 2023
Agenda Item: 5.J
1 of 5
To: Mayor and City Council
From: Wolfgang Knabe, Interim Fire Chief, Fire Department Subject: Award Bid 4458 to Bound Tree Medical LLC., Life-Assist Inc. and Henry Schein Inc. for Fire Department Medical Supplies
Recommended Action
Staff recommends that the City Council:

1. Award Bid #4458 to Bound Tree Medical, LLC. as the primary vendor and to LifeAssist Inc., and Henry Schein Inc. as secondary vendors, for the purchase of medical supplies for the Fire Department.

2. Authorize the City Manager to negotiate and execute a contract with Bound Tree, Medical LLC., as the primary vendor for the purchase and delivery of Fire Department medical supplies in an amount not to exceed $663,076 over a fiveyear period, with future funding contingent on Council budget approval; and

3. Authorize the Procurement Manager to issue Purchase Orders over a five-year period to Life-Assist Inc. in an amount not to exceed $55,256 and to Henry Schein Inc. in an amount not to exceed $27,628, as secondary vendors for the purchase and delivery of Fire Department medical supplies, with future year funding contingent on Council budget approval.

4. Adopt a finding of no possibility of significant effect pursuant to Section 15061(b)(3) (Common Sense Exemption) of the California Environmental Quality Act (CEQA) Guidelines.

Summary
The medical supplies purchased would be used by Fire Department personnel to maintain medical equipment and supplies as required by the Los Angeles County Emergency Medical Services Agency to provide pre-hospital emergency medical care.

Following a formal bid process, Bound Tree Medical LLC is recommended as the best bidder to provide and deliver these medical supplies. Life-Assist Inc. and Henry Schein Inc. are recommended as secondary or backup bidders to provide and deliver medical

5.J
Packet Pg. 1096
2 of 5
supplies in the event the primary vendor is unable to provide the supplies. The total projected expenditure for Bound Tree is $663,076, for Life-Assist is $55,256, and for Henry Schein is $27,628, which all include a possible 5% price increase per year based solely on a manufacturer’s increase; otherwise, current pricing remains in effect, for a total amount not to exceed $745,960.

Discussion
The Fire Department responds to nearly 13,000 emergency medical calls annually and uses a variety of medical supplies when responding to those calls that require the provision of emergency medical care. In support of this effort, staff purchases a variety of medical supplies and equipment to ensure the Department’s first responders are prepared to provide care to patients with medical conditions and traumatic injuries.

Supplies and equipment purchased by staff include disposable items such as:
bandages, splints, intravenous supplies, oxygen masks, medications, and airway equipment.

Due to the variety and quantity of medical supplies and equipment needed, vendors were asked to quote fifty of the most commonly ordered products based on historical purchases to evaluate pricing. In addition to price, bids were evaluated based on ability to meet specifications, ability to deliver product, and compliance with bid specifications for all medications and a majority of identified supplies.

In addition to the medical supplies, SMFD was interested in implementing an EMS medical supply and pharmaceutical dispensing system (unit) to further provide improved management of inventory. This device would have a variety of items which would have the ability to check multiple levels of authorization. The top three vendors based on price were invited to demonstrate their inventory management systems. Based on this evaluation, Bound tree Medical was selected as the medical equipment supplier. Life Assist and Henry Schein will be alternate suppliers, so if Bound Tree is unable to provide a specific medical supply item due to shortages or supply chain issues, the Fire Department can purchase from these alternate sources. If necessary, medical equipment from all vendors can utilize the inventory management system.

5.J
Packet Pg. 1097
3 of 5
Vendor Selection
Bidder Recommendation
Best Bidder Bound Tree Medical, LLC.

Evaluation Criteria Price; the services offered; experience and efficiency of the bidder; the ability of the bidder to provide such future maintenance or service as may be needed; any other factor that will further the intent set forth in Section 608 of the City Charter. The City shall have absolute discretion in determining the applicability and weight of the criteria listed above. .

Municipal Code SMMC 2.24.180
Bid Data
Date Posted Posted On Advertised In (City
Charter & Municipal
Code)
Vendors
Downloaded
Submittals
Received
Date Publicly
Opened
07/13/2023 City's Online
Bidding Site
Santa Monica Daily
Press
40 6 08/02/2023
Best Bidder Justification
Bound Tree Medical LLC is the best bidder to provide medical supplies based on cost, experience, and their inventory management system.

Life-Assist, and Henry Schein are proposed as secondary back up vendors, should the need arise in case Bound Tree Medical is unable to furnish and deliver the supplies needed.

Submittals Received
Agni Enterprises, LLC Bound Tree Medical,
LLC
Clean Space Project,
LLC Henry Schein Inc.

Life-Assist Inc. QuadMed

5.J
Packet Pg. 1098
4 of 5
Environmental Review
The award contract to provide medical supplies is exempt from the California Environmental Quality Act (CEQA) pursuant to Section 15061(b)(3) of the CEQA Guidelines. The award contract is covered by the commonsense exemption which states that CEQA does not apply, where it can be seen with certainty that there is no possibility that the activity in question may have a significant effect on the environment.

The contract will allow the City to continue to provide emergency medical services.

Therefore, it can be seen with certainty that the agreement would not result in adverse physical impacts on the environment, and as such, is categorically exempt from CEQA.

Financial Impacts and Budget Actions
Staff seeks authority to approve funding from the General Fund to award a contract with Bound Tree Medical to provide medical supplies for the Fire Department.

Contract Request – Bound Tree
Current Year
Request
Amount
Amount for
Future Years
FY 2023-24 Budget
Department Account #
Total Contract
Amount
$120,000 $543,076 01190002.525150 $663,076
Staff seeks authority to approve funding from the General Fund to award purchase orders with Life-Assist Inc. and Henry Schein, as secondary back up vendors, to provide medical supplies for the Fire Department.

5.J
Packet Pg. 1099
5 of 5
Purchase Order Request
Vendor Current
Year
Request
Amount
Amount for
Future Years
FY 2023-24 Budget
Department Account #
Total Contract
Amount
Life-Assist $10,000 $45,256 01190002.525150 $55,256
Henry Schein $5,000 $22,628 01190002.525150 $27,628
Future year funding is contingent on Council budget approval.

Prepared By: Terese Toomey, Principal Administrative Analyst Approved Forwarded to Council
Attachments:

A. Life-Assist FY23-24 OAKS exp. 8.9.24
B. Henry Schein Oaks_Initiative exp 8.17.24
C. Henry Schein Executive Officers 23 24
D. Boundtree Oaks exp. 7.31.24

5.J
Packet Pg. 1100

5.J.a
Packet Pg. 1101 Attachment: Life-Assist FY23-24 OAKS exp. 8.9.24 (5937 : Award Bid 4458 for Fire Department Medical Supplies)

5.J.a
Packet Pg. 1102 Attachment: Life-Assist FY23-24 OAKS exp. 8.9.24 (5937 : Award Bid 4458 for Fire Department Medical Supplies)

CITY OF SANTA MONICA OAKS INITIATIVE DISCLOSURE FORM
In order to facilitate compliance with the requirements of the Oaks Initiative, the City compiles and maintains certain information. That information includes the name of any person or persons who is seeking a “public benefit.” If the “public benefit” is sought by an entity, rather than an individual person, the information includes the name of every person who is: (a) trustee, (b) director, (c) partner, (d) officer, or has (e) more than a ten percent interest in the entity.

Public benefits include:

1. Personal services contracts in excess of $25,000 over any 12-month period;

2. Sale of material, equipment or supplies to the City in excess of $25,000 over a12- month period;

3. Purchase, sale or lease of real property to or from the City in excess of$25,000 over a 12- month period;

4. Non-competitive franchise awards with gross revenue of $50,000 or more inany 12-month period;

5. Land use variance, special use permit, or other exception to an establishedland use plan, where the decision has a value in excess of $25,000;

6. Tax “abatement, exception, or benefit” of a value in excess of $5,000 in any 12- month period; or

7. Payment of “cash or specie” of a net value to the recipient of $10,000 in any 12- month period.

Name(s) of persons or entities receiving public benefit:

Name(s) of trustees, directors, partners, and officers:

Name(s) of persons with more than a 10% equity, participation, or revenueinterest:

Prepared by: Title:

Signature: Date:

Email: Phone:

FOR CITY USE ONLY:

Bid/PO/Contract # Permit #
Henry Schein, Inc.

Please see attached.

Rob Herbert VP, US Enterprise Operations
[email protected] 631-390-8000
The Vanguard Group, Inc
DocuSign Envelope ID: 3355346C-C123-4081-919F-593E09FB2CDC 8/17/2023

5.J.b
Packet Pg. 1103 Attachment: Henry Schein Oaks_Initiative exp 8.17.24 (5937 : Award Bid 4458 for Fire Department Medical Supplies)

HENRY SCHEIN EXECUTIVE MANAGEMENT
Stanley M. Bergman
Chairman of the Board and Chief Executive Officer
Andrea Albertini
Chief Executive Officer, International Distribution Group Leigh Benowitz
Senior Vice President and Chief Global Digital Transformation James P. Breslawski
Vice Chairman of the Board and President
David Brous
Chief Executive Officer, Strategic Business Group
Trinh Clark
Senior Vice President and Chief Global Customer Experience Officer Brad Connett
Chief Executive Officer, North America Distribution Group Michael S. Ettinger
Executive Vice President and Chief Operating Officer
Lorelei McGlynn
Senior Vice President, Chief Human Resources Officer
Mark E. Mlotek
Executive Vice President, Chief Strategic Officer, Member of the Board of Directors James Mullins
Senior Vice President, Global Supply Chain
Kelly Murphy
Senior Vice President and General Counsel
Christopher Pendergast
Senior Vice President and Chief Technology Officer
Michael Racioppi
Senior Vice President, Chief Merchandising Officer
Walter Siegel
Senior Vice President and Chief Legal Officer
Ronald N. South
Senior Vice President, Chief Financial Officer
René Willi, Ph.D.

Chief Executive Officer, Global Oral Reconstruction Group

5.J.c
Packet Pg. 1104 Attachment: Henry Schein Executive Officers 23 24 (5937 : Award Bid 4458 for Fire Department Medical Supplies)

5.J.d
Packet Pg. 1105 Attachment: Boundtree Oaks exp. 7.31.24 (5937 : Award Bid 4458 for Fire Department Medical Supplies) City Council
Report
City Council Meeting: September 26, 2023
Agenda Item: 5.K
1 of 3
To: Mayor and City Council
From: David White, City Manager, City Manager's Office
Denise Anderson Warren, City Clerk, Records & Elections Services Department
Subject: Adoption of a Resolution Amending and Restating the Civility at Public Meetings Policy set forth in Resolution No. 10642 (CCS) Recommended Action
Staff recommends that the City Council:

1. Adopt a finding of no possibility of significant effect pursuant to Section 15061(b)(3) (Common Sense Exemption) of the California Environmental Quality Act (CEQA) Guidelines; and

2. Adopt the attached resolution to amend and restate the Civility at Public Meetings set forth in resolution No. 10642 (CCS) (the Civility Policy).

Summary
This report complies with Council direction to staff on July 26, 2022 to return with a resolution to adopt and promote a statement against hate. The statement against hate has been added to the City’s Code of Ethics and will be incorporated to the Code of Civility for public meetings through the attached resolution. The resolution was previously adopted on December 13, 2011, and would be amended and restated if Council adopts the attached resolution (Attachment A).

Discussion
The City of Santa Monica has seen increase in antisemitic, transphobic, homophobic, racist, and discriminatory hate speech targeted at both individuals and groups in recent years. Since 2020, Council has reaffirmed its commitment to equity and inclusion in a number of ways, including support for the creation of a Racial Equity Committee

5.K
Packet Pg. 1106
2 of 3
comprised of city staff from every department who develop and lead projects aimed at increasing equity each year, support for equity impact assessments to measure the impact of our work as a city organization, and a commitment to an ongoing review of city policies to identify areas where the city’s commitment to equity can be strengthened.

While equity and inclusion have been core values of the City for the last 5 years, these values have not been embedded in foundational documents for the city, including our Code of Ethics and City Council’s Code of Civility for public meetings. In July of 2022, Council directed staff to amend these policies to clearly state its position regarding hate motivated incidents in Santa Monica. The change has been made to the City’s Code of Ethics, and staff has prepared a resolution to amend and restate the civility at public meetings policy set forth in Resolution No. 10642 (CCS) (Attachment A) , which is excerpted below and attached to this report for adoption by Council.

Statement Against Hate
Hate has no place in Santa Monica. Across the nation and here in Santa Monica, we have witnessed an increase in antisemitic, transphobic, homophobic, racist and discriminatory hate speech targeted at both individuals and groups. Equity and inclusion remain at the core of Santa Monica’s values, and the City will not allow abusive or threatening hate speech, intolerance, or dehumanization to prevail over basic civil respect and human decency. We will continue to celebrate, include, and uplift the diverse communities who live, work, and play in Santa Monica.

Environmental Review
The Civility Policy is categorically exempt from CEQA pursuant to Section 15061(b)(3) of the CEQA Guidelines which states that CEQA does not apply, “where it can be seen with certainty that there is no possibility that the activity in question may have a significant effect on the environment.” Therefore, it can be seen with certainty that the proposed policy would not result in adverse physical impacts on the environment, and as such, is categorically exempt from CEQA.

5.K
Packet Pg. 1107
3 of 3
Past Council Actions
Meeting Date Description
July 26, 2022 Request of Mayor Himmelrich and Councilmembers Davis and de la Torre that the City Council adopt and promote the attached statement against hate and direct the City Manager and City Clerk to incorporate its language into the City’s Code of Ethics and the City Council’s Code of Civility for public meetings.

Financial Impacts and Budget Actions
There is no immediate financial impact or budget action necessary as a result of recommended action. Staff will return to Council if specific budget actions are required in the future.

Prepared By: Lisa Parson, Equity and Inclusion Manager
Approved Forwarded to Council
Attachments:

A. Amended and Restated Civility Policy
B. Written Comments

5.K
Packet Pg. 1108
1 City Council Meeting: September 26, 2023 Santa Monica, California RESOLUTION NUMBER _________ (CCS)
(City Council Series)

A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF

SANTA MONICA AMENDING AND RESTATING THE CIVILITY AT PUBLIC MEETINGS POLICY SET FORTH IN RESOLUTION NO. 10642 (CCS) WHEREAS, Council adopted Resolution 10642 (CCS) Endorsing Standards of Behavior that Promote Civility at All Public Meetings (the Civility Policy) on December 13, 2011; and
WHEREAS, the Civility Policy sets forth guidelines to encourage and facilitate the democratic process, individual rights of expression, robust debate, and tolerance for disparate views; and
WHEREAS, the Civility Policy applies to all persons attending public meetings in Santa Monica; and
WHEREAS, on July 26, 2022, as a Council Discussion Item, the Council gave direction to adopt and promote a statement against hate, and to add it to the City’s Code of Ethics and Code of Civility for public meetings; and WHEREAS, the Council now wishes to amend and restate the Civility Policy in Resolution No. 10642 (CCS) to include the City’s Statement Against Hate, as adopted by Council at its July 26, 2022 meeting.

NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF SANTA MONICA DOES RESOLVE AS FOLLOWS:

5.K.a
Packet Pg. 1109 Attachment: Amended and Restated Civility Policy [Revision 1] (5970 : Resolution - Civility at Public Meetings Policy) 2 SECTION 1. The Civility Policy set forth in Resolution No. 10642 (CCS) is hereby amended and restated to read:

In order to safeguard participatory democracy in Santa Monica, all persons attending public meetings in Santa Monica shall strive to:

1. Treat everyone courteously;

2. Listen to others respectfully;

3. Exercise self-control;

4. Give open-minded consideration to all viewpoints;

5. Focus on the issues and avoid personalizing debate;

6. Embrace respectful disagreement and dissent as democratic rights, inherent components of an inclusive public process, and tools for forging sound decisions.

Statement Against Hate: Hate has no place in Santa Monica. Across the nation and here in Santa Monica, we have witnessed an increase in antisemitic, transphobic, homophobic, racist and discriminatory hate speech targeted at both individuals and groups. Equity and inclusion remain at the core of Santa Monica’s values, and the City will not allow abusive or threatening hate speech, intolerance, or dehumanization to prevail over basic civil respect and human decency. We will continue to celebrate, include, and uplift the diverse communities who live, work, and play in Santa Monica.

Be it Further Resolved, that the City Council, all City Boards and Commissions, and City staff shall promote the use of and adherence to these guidelines for behavior at all public meetings within the City.

5.K.a
Packet Pg. 1110 Attachment: Amended and Restated Civility Policy [Revision 1] (5970 : Resolution - Civility at Public Meetings Policy) 3 SECTION 2. The City Clerk shall certify to the adoption of this Resolution, and thenceforth and thereafter the same shall be in full force and effect.

APPROVED AS TO FORM:
_________________________
Douglas Sloan, City Attorney

5.K.a
Packet Pg. 1111 Attachment: Amended and Restated Civility Policy [Revision 1] (5970 : Resolution - Civility at Public Meetings Policy) 1 Vernice Hankins
From: stayfree7 <[email protected]>
Sent: Monday, September 25, 2023 8:00 AM
To: councilmtgitems; Gleam Davis; Lana Negrete; Douglas Sloan Cc: David White; Denise Anderson-Warren; Nikima Newsome Subject: ---> item 5-K: OPEN LETTER to City Council re censorship of public comments

EXTERNAL
https://www.smobserved.com/story/2023/09/25/opinion/open-letter-to-council-alleges-city-intends-to-censor-publiccomments/7809.html Open Letter to Council Alleges City Intends to Censor Public Comments
Update to Civility Policy unconstitutional, writes resident To help protect your privacy,
Micro so ft Office prevented
auto matic downlo ad o f this
picture from the Internet.
facebo ok
Share
To help protect your privacy,
Micro so ft Office prevented
auto matic downlo ad o f this
picture from the Internet.
twitter
Tweet
To help protect your privacy,
Micro so ft Office prevented
auto matic downlo ad o f this
picture from the Internet.
pinterest
To help protect your privacy,
Micro so ft Office prevented
auto matic downlo ad o f this
picture from the Internet.
0 Comments
September 25, 2023
To help protect your priv acy, Microsoft Office prevented automatic download of this picture from the Internet.

Mayor Gleam Davis (left), City Attorney Douglas Sloan (right).

Dear Mayor Davis, Councilmembers and City Attorney Sloan, The purpose of this Open letter is to express grave concerns regarding the constitutionality of item 5-K agendized for the upcoming September 26, 2023 City Council meeting.

The name of the item is "Adoption of a Resolution Amending and Restating the Civility at Public Meetings Policy set forth in Resolution No. 10642 (CCS)." The item seeks the addition Item 5.K
09/26/23
1 of 22 Item 5.K
09/26/23

5.K.b
Packet Pg. 1112 Attachment: Written Comments (5970 : Resolution - Civility at Public Meetings Policy) 2 of the City's Statement Against Hate to the existing civility policy. The Statement was originally adopted in July 2022, and was recently added to the City's Code of Ethics.

It is my belief that this item seeks to legitimize censorship at public meetings under the guise of a civility policy.

The City's Statement Against Hate reads in part:
"Equity and inclusion remain at the core of Santa Monica's values, and the City will not allow abusive or threatening hate speech, intolerance, or dehumanization to prevail over basic civil respect and human decency. (...) Be it Further Resolved, that the City Council, all City Boards and Commissions, and City staff shall promote the use of and adherence to these guidelines for behavior at all public meetings within the City [emphasis added]." In contrast, the American Civil Liberties Union's website reads in part:
"Since its founding in 1920, the ACLU has fought for the free expression of all ideas, popular or unpopular. Where racist, misogynist, homophobic, and transphobic speech is concerned, the ACLU believes that more speech - not less - is the answer most consistent with our constitutional values."
Additionally, "Freedom of Expression – ACLU Position Paper" offers a powerful quote:

As one federal judge has put it, tolerating hateful speech is "the best protection we have against any Nazi-type regime in this country."
It is in the public interest to ensure that the approval of item 5-K by the Council will not result in a violation of the First Amendment of the US Constitution, the California Constitution, the Brown Act, or any other applicable law. Therefore I request that prior to the Council's vote on the item, the City Attorney respond at the 9/26/23 Council meeting to the concerns raised by this letter.

The First Amendment of the U.S. Constitution provides protection to and opportunity for free speech in public forums. The public meeting of a board or council is considered a "limited public forum," which means the government can regulate the time, place, and manner of speech.

To my knowledge, ample case law exists pertaining to civility policies at public meetings.

Courts have concluded such policies must be viewpoint neutral, may not be unconstitutionally vague, ambiguous or overbroad, and may not create a chilling effect on the public.

Item 5.K
09/26/23
2 of 22 Item 5.K
09/26/23

5.K.b
Packet Pg. 1113 Attachment: Written Comments (5970 : Resolution - Civility at Public Meetings Policy) 3 Here the Council seeks the inclusion of the City's Statement Against Hate in the civility policy for public meetings. The Statement deplores "hate speech." As you must know, no legal definition of "hate speech" exists. It is unclear what kind of language and/or viewpoints the Council is seeking to discourage. What might be considered "hate speech" can vary from speaker to speaker and listener to listener. Such ambiguity alone creates a chilling effect on the speakers.

Sadly, the intent to create a chilling effect (which is a form of censorship) was actually articulated by one of the sponsors of the City's Statement Against Hate, thenCouncilmember, now Mayor, Gleam Davis in July 2022.

Said Ms. Davis:
"My hope is that by adopting this, many people will think twice before some of the hateful things that have been said, posted, you know, on social media, and, you know... I don't know... No one is trying to curtail speech, and no one is trying to reduce First Amendment rights, but I do think... I would hope that in a community like Santa Monica, we are... people would think twice before posting things that are... I don't know any other word for it but, just horrific, the things I have seen. So this is just a reminder to people that good policy is made when we have civil discussions [emphasis added]."
Such clearly articulated intent to create a chilling effect cannot be mistaken to understand the addition of the Statement Against Hate to the civility policy as merely "aspirational government speech."
It is shocking that the intent to curtail free speech was publicly communicated from the dais by then-Councilmember, now Mayor Davis, who is an attorney and often claims to be a champion of the First Amendment.

Please note that local governments and their officials, employees, places and means of communication are subject to First Amendment principles, and risk-wise, are subject to civil rights liability, including the potential for individual liability per 42 U.S.C. § 1983.

I urge Mayor Davis and the Council to do their due diligence to ensure the constitutionality and otherwise legality of item 5-K, and to appraise the public of their findings at the Council meeting on Tuesday September 26, 2023 prior to voting on the item.

Censorship has no place in Santa Monica.

Regards,
Item 5.K
09/26/23
3 of 22 Item 5.K
09/26/23

5.K.b
Packet Pg. 1114 Attachment: Written Comments (5970 : Resolution - Civility at Public Meetings Policy) 4 To help protect your privacy, Microsoft Office prevented automatic download of this picture from the Internet.

Olga Zurawska
Santa Monica resident
member of The First Amendment Coalition
----------------------------
Item 5.K
09/26/23
4 of 22 Item 5.K
09/26/23

5.K.b
Packet Pg. 1115 Attachment: Written Comments (5970 : Resolution - Civility at Public Meetings Policy) 1 Vernice Hankins
From: Elaine Golden-Gealer <[email protected]>
Sent: Monday, September 25, 2023 9:45 AM
To: councilmtgitems
Cc: Elaine Golden-Gealer
Subject: OPPOSE ITEM 5-K If you care about Free Speech & the First Amendment - Vote NO on Item 5-K tomorrow night
Importance: High

EXTERNAL
https://www.smobserved.com/story/2023/09/25/opinion/open‐letter‐to‐council‐alleges‐ city‐intends‐to‐censor‐public‐comments/7809.html
Item 5.K
09/26/23
5 of 22 Item 5.K
09/26/23

5.K.b
Packet Pg. 1116 Attachment: Written Comments (5970 : Resolution - Civility at Public Meetings Policy) 1 Vernice Hankins
From: Danielle Charney <[email protected]>
Sent: Monday, September 25, 2023 12:21 PM
To: [email protected]; councilmtgitems; David White; [email protected]; Phil Brock; Lana Negrete; Gleam Davis; Jesse Zwick; Christine Parra; Oscar de la Torre; Caroline Torosis
Subject: Item 5K. City Council Meeting 9/26/2023

EXTERNAL
The actions of Gleam Davis to restrict speech is both hypocritical and disturbingly fascist in nature.

While I do not particularly enjoy the rants of some,  I find the ACTIONS of Ms Davis for one, and others on the Council to be of a far more egregious and damaging nature. They talk over residents, they do not listen, they turn their backs and very rarely respond. It is clear that Ms Davis only listens to those who tow her party line..as do Zwick and Torosis. There is no respect for residents. They do not listen. They do as they please.

Perhaps this long time abuse by Councils, past and present has something to do with the spicy rhetoric they now seek to restrict in an unconstitutional power play.

ACTIONS SPEAK LOUDER  Ms Davis..yours have sold our town out. To me, that is far more vulgar and horrific. Get down with your bad self.

Danielle Charney
Resident Since 1982
So tired of it all.

Item 5.K
09/26/23
6 of 22 Item 5.K
09/26/23

5.K.b
Packet Pg. 1117 Attachment: Written Comments (5970 : Resolution - Civility at Public Meetings Policy) 1 Vernice Hankins
From: Ann Maggio <[email protected]>
Sent: Monday, September 25, 2023 8:01 PM
To: councilmtgitems
Subject: Item 5-k Invites Endless Disruptions by Mayor/Mayor Pro Tem, Board Chair, aka Big Brother Arbitrators & holds them Personally Liable for First Amendment Violations

EXTERNAL
Dear City Council and City Attorney,
The points made in, "Open Letter to Council Alleges City Intends to Censor Public Comments" published by the SM Observer points out that your resolution is an attempt to chill the public's First Amendment Right to free speech. (https://www.smobserved.com/story/2023/09/25/opinion/open-letter-to-council-alleges-city-intendsto-censor-public-comments/7809.html)

This council resolution (Resolution No. 10642) fails to define "hate speech", the very thing you are attempting to curtail at city council, board and commission meetings.

Where are the definitions for:
 "hate speech"?
 "abusive hate speech"?
 "threatening hate speech"?
Who decides what it IS "hate speech", "abusive hate speech", "threatening hate speech" and what ARE NOT these things?
How is the public, whose languages, cultures, and various views points and expressions expected to feel included and participate when you present a resolution that is so completely sketchy? How does your definitions apply in conjunction with:
 "intolerance" ?
 "dehumanization"?
The fact is that these are subjective terms intended to be used to label people based on who is saying what about whom and who is hearing it.

This single example of the inconvenient truth of your resolution bears all the hallmarks of chilling speech to satisfy your means.

CASE:

Supporters of candidate A over candidate B sit through a public council meeting and are forced to endure "intolerant/abusive hate speech" interjected into the comments by speakers who support candidate B.  Because the arbitrator(s) of "Hate Speech" happen to those of you sitting on the dias failed to prevent such speech, likely because the position(s) spoken aligned with your own, then you are liable for violating your policy, correct?  In other words, the arbitrators of "hate speech" could be only what Big Brother says it is, correct? Item 5.K
09/26/23
7 of 22 Item 5.K
09/26/23

5.K.b
Packet Pg. 1118 Attachment: Written Comments (5970 : Resolution - Civility at Public Meetings Policy) 2 Countless opportunities exist with the passage of this resolution to CREATE more disruption as the arbitrators, namely the mayor or mayor pro‐tem and commission chairs would be required to act to censure all speech to compensate for this word salad of a resolution, severely lacking comprehension by the people you knowingly expect to apply it to.

It is my belief that as lawyers, Mayor Davis and Councilwoman Torosis are fully aware of the resolution's attempt to chill free speech.

It's odd that they along with the originator, former Mayor Himmelrich, have together managed to exclude dissenters, women’s rights defenders, journalists, etc., from the verbage.

Finally, should the resolution pass and an individual's First Amendment Rights be violated, as they most certainly will be violated, the person or persons having violated an individual's first amendment rights will be held personally liable per 42 U.S.C. § 1983.

Which councilperson is willing to take the risk of being sued for everything they have? Which member of a board of commission is willing to take this same risk? In addition to chilling free speech, this resolution appears to be an AGGRESSIVE attempt to dissuade members of the public from serving our city.

Shame on you!
#morespeechnotless
City Council Meeting: September 26, 2023 Santa Monica, California RESOLUTION NUMBER _________ (CCS)
(City Council Series)

A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF

SANTA MONICA AMENDING AND RESTATING THE CIVILITY AT PUBLIC MEETINGS POLICY SET FORTH IN RESOLUTION NO. 10642 (CCS) WHEREAS, Council adopted Resolution 10642 (CCS) Endorsing Standards of Behavior that Promote Civility at All Public Meetings (the Civility Policy) on December 13, 2011; and
WHEREAS, the Civility Policy sets forth guidelines to encourage and facilitate the democratic process, individual rights of expression, robust debate, and tolerance for disparate views; and
WHEREAS, the Civility Policy applies to all persons attending public meetings in Santa Monica; and
WHEREAS, on July 26, 2022, as a Council Discussion Item, the Council gave direction to adopt and promote a statement against hate, and to add it to the City’s Code of Ethics and Code of Civility for public meetings; and WHEREAS, the Council now wishes to amend and restate the Civility Policy in Resolution No. 10642 (CCS) to include the City’s Statement Against Hate, as adopted by Council at its July 26, 2022 meeting.

NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF SANTA MONICA DOES RESOLVE AS FOLLOWS:

SECTION 1. The Civility Policy set forth in Resolution No. 10642 (CCS) is hereby amended and restated to read:

In order to safeguard participatory democracy in Santa Monica, all persons attending public meetings in Santa Monica shall strive to:

Item 5.K
09/26/23
8 of 22 Item 5.K
09/26/23

5.K.b
Packet Pg. 1119 Attachment: Written Comments (5970 : Resolution - Civility at Public Meetings Policy) 3 1. Treat everyone courteously;

2. Listen to others respectfully;

3. Exercise self‐control;

4. Give open‐minded consideration to all viewpoints;

5. Focus on the issues and avoid personalizing debate;

6. Embrace respectful disagreement and dissent as democratic rights, inherent components of an inclusive public process, and tools for forging sound decisions.

Statement Against Hate: Hate has no place in Santa Monica. Across the nation and here in Santa Monica, we have witnessed an increase in antisemitic, transphobic, homophobic, racist and discriminatory hate speech targeted at both individuals and groups. Equity and inclusion remain at the core of Santa Monica’s values, and the City will not allow abusive or threatening hate speech, intolerance, or dehumanization to prevail over basic civil respect and human decency. We will continue to celebrate, include, and uplift the diverse communities who live, work, and play in Santa Monica.

Be it Further Resolved, that the City Council, all City Boards and Commissions, and City staff shall promote the use of and adherence to these guidelines for behavior at all public meetings within the City.

SECTION 2. The City Clerk shall certify to the adoption of this Resolution, and thenceforth and thereafter the same shall be in full force and effect.

APPROVED AS TO FORM:
_________________________
Douglas Sloan, City Attorney
Ann Maggio Thanawalla
"Unthinking respect for authority is the greatest enemy of truth."  ‐ Albert Einstein Item 5.K
09/26/23
9 of 22 Item 5.K
09/26/23

5.K.b
Packet Pg. 1120 Attachment: Written Comments (5970 : Resolution - Civility at Public Meetings Policy) 1 Vernice Hankins
From: GABRIEL NAVARRO <[email protected]>
Sent: Tuesday, September 26, 2023 8:46 AM
To: councilmtgitems
Subject: VOTE NO ON 5-K

EXTERNAL
Sent from my iPhone 11 Pro
Item 5.K
09/26/23
10 of 22 Item 5.K
09/26/23

5.K.b
Packet Pg. 1121 Attachment: Written Comments (5970 : Resolution - Civility at Public Meetings Policy) 2 Vernice Hankins
From: Kelli <[email protected]>
Sent: Tuesday, September 26, 2023 8:42 AM
To: councilmtgitems
Subject: VOTE NO ON 5K

EXTERNAL
Please VOTE NO on 5K!! I object to the removal of the First Amendment for speakers! We live here, pay taxes, have businesses so we have the right to speak up for ourselves and our city! Item 5.K
09/26/23
11 of 22 Item 5.K
09/26/23

5.K.b
Packet Pg. 1122 Attachment: Written Comments (5970 : Resolution - Civility at Public Meetings Policy) 3 Vernice Hankins
From: Sandy Laderas <[email protected]>
Sent: Tuesday, September 26, 2023 8:40 AM
To: councilmtgitems
Subject: Vote no on 5-K

EXTERNAL
Sent from Gmail Mobile
Item 5.K
09/26/23
12 of 22 Item 5.K
09/26/23

5.K.b
Packet Pg. 1123 Attachment: Written Comments (5970 : Resolution - Civility at Public Meetings Policy) 4 Vernice Hankins
From: Horace Hertz <[email protected]>
Sent: Tuesday, September 26, 2023 8:38 AM
To: councilmtgitems
Subject: NO ON 5K

EXTERNAL

DO NOT SUPPRESS FREEDOM OF SPEECH
The materials in this message are private and may contain information that is privileged and confidential, Protected Health Information within the meaning of the Health Insurance Portability and Accountability Act (HIPAA) and/or Medical Information within the meaning of the Confidentiality of Medical Information Act (CMIA). If you are not the intended recipient, be advised that any unauthorized review, use, disclosure, copying, forwarding, printing, distribution or the taking of any action in reliance on the contents of this information is STRICTLY PROHIBITED and may be unlawful.

If you have received this message by error, or have reason to believe that you are not authorized to receive it, please notify the sender immediately to arrange for return or destruction of these documents and delete this message.

Disclaimer
The information contained in this communication from the sender is confidential. It is intended solely for use by the recipient and others authorized to receive it. If you are not the recipient, you are hereby notified that any disclosure, copying, distribution or taking action in relation of the contents of this information is strictly prohibited and may be unlawful.

This email has been scanned for viruses and malware, and may have been automatically archived by Mimecast Ltd, an innovator in Software as a Service (SaaS) for business. Providing a safer and more useful place for your human generated data. Specializing in; Security, archiving and compliance. To find out more Click Here.

Item 5.K
09/26/23
13 of 22 Item 5.K
09/26/23

5.K.b
Packet Pg. 1124 Attachment: Written Comments (5970 : Resolution - Civility at Public Meetings Policy) 5 Vernice Hankins
From: stephen bourcier <[email protected]>
Sent: Tuesday, September 26, 2023 8:27 AM
To: councilmtgitems
Subject: Vote No on 5-k

EXTERNAL
Freedom of speech is a protected right.  I urge you to vote no on 5‐k.

Sent from my iPhone
Item 5.K
09/26/23
14 of 22 Item 5.K
09/26/23

5.K.b
Packet Pg. 1125 Attachment: Written Comments (5970 : Resolution - Civility at Public Meetings Policy) 6 Vernice Hankins
From: Janet Heinle <[email protected]>
Sent: Tuesday, September 26, 2023 8:18 AM
To: councilmtgitems
Subject: VOTE NO

EXTERNAL
VOTE NO ON 5-K
Janet Heinle
1047 Lincoln 90403
Item 5.K
09/26/23
15 of 22 Item 5.K
09/26/23

5.K.b
Packet Pg. 1126 Attachment: Written Comments (5970 : Resolution - Civility at Public Meetings Policy) 1 Vernice Hankins
From: Joyce Urode <[email protected]>
Sent: Tuesday, September 26, 2023 9:23 AM
To: councilmtgitems
Subject: vote no on 5 k

EXTERNAL
Sent from my iPhone
Item 5.K
09/26/23
16 of 22 Item 5.K
09/26/23

5.K.b
Packet Pg. 1127 Attachment: Written Comments (5970 : Resolution - Civility at Public Meetings Policy) 2 Vernice Hankins
From: Gail Gordon <[email protected]>
Sent: Tuesday, September 26, 2023 9:16 AM
To: councilmtgitems
Subject: No on 5K

EXTERNAL
Please give the public a voice.   Do not silence us. Our 1st amendment rights are based in our governments consƟtuƟon.

We live in this city and should be allowed to be part of the decisions that affect us.

Respecƞully
Gail Gordon
Sent from my iPhone
Item 5.K
09/26/23
17 of 22 Item 5.K
09/26/23

5.K.b
Packet Pg. 1128 Attachment: Written Comments (5970 : Resolution - Civility at Public Meetings Policy) 3 Vernice Hankins
From: Debra Rocco <[email protected]>
Sent: Tuesday, September 26, 2023 9:04 AM
To: councilmtgitems
Subject: VOTE NO ON 5-K

EXTERNAL
Sent from Debra’s ᏟᏠᏡᏢᏣᏤᏥ
Item 5.K
09/26/23
18 of 22 Item 5.K
09/26/23

5.K.b
Packet Pg. 1129 Attachment: Written Comments (5970 : Resolution - Civility at Public Meetings Policy) 1 Vernice Hankins
From: Catherine Rist <[email protected]>
Sent: Tuesday, September 26, 2023 10:15 AM
To: councilmtgitems
Subject: VOTE NO ON 5-K

EXTERNAL
Do the right thing.

Item 5.K
09/26/23
19 of 22 Item 5.K
09/26/23

5.K.b
Packet Pg. 1130 Attachment: Written Comments (5970 : Resolution - Civility at Public Meetings Policy) 2 Vernice Hankins
From: KARI NORDAAS <[email protected]>
Sent: Tuesday, September 26, 2023 9:35 AM
To: councilmtgitems
Subject: Vote NO on 5K

EXTERNAL
Kari Nordaas
2130 Oak st
SM 90405
Sent from my iPhone
Item 5.K
09/26/23
20 of 22 Item 5.K
09/26/23

5.K.b
Packet Pg. 1131 Attachment: Written Comments (5970 : Resolution - Civility at Public Meetings Policy) 1 Vernice Hankins
From: Deborah Dinsmore <[email protected]>
Sent: Tuesday, September 26, 2023 11:31 AM
To: councilmtgitems
Subject: Plz vote NO on 5-k

EXTERNAL
Deborah Dinsmore
Santa Monica, CA
Item 5.K
09/26/23
21 of 22 Item 5.K
09/26/23

5.K.b
Packet Pg. 1132 Attachment: Written Comments (5970 : Resolution - Civility at Public Meetings Policy) 1 Vernice Hankins
From: Jessica Rogers <[email protected]>
Sent: Tuesday, September 26, 2023 11:47 AM
To: councilmtgitems
Subject: Vote No on 5K

EXTERNAL
I am thoroughly against making any changes that would limit free speech during public comment.  It is much more dangerous to limit free speech and to listen to speech that can be interpreted as hateful.

Item 5.K
09/26/23
22 of 22 Item 5.K
09/26/23

5.K.b
Packet Pg. 1133 Attachment: Written Comments (5970 : Resolution - Civility at Public Meetings Policy) 1 September 12, 2023
(NOT APPROVED)

CITY OF SANTA MONICA

CITY COUNCIL MINUTES
SEPTEMBER 12, 2023
A regular meeting of the Santa Monica City Council was called to order by Mayor Davis at 5:32 p.m., on Tuesday, September 12, 2023, at City Council Chambers, 1685 Main Street, Santa Monica, CA.

Roll Call: Present: Mayor Gleam Davis
Mayor Pro Tem Lana Negrete
Councilmember Phil Brock
Councilmember Oscar de la Torre
Councilmember Christine Parra
Councilmember Caroline Torosis (Arrived at 5:42 p.m.)
Councilmember Jesse Zwick (Arrived at 5:37 p.m.)
Also Present: City Manager David White
City Attorney Douglas Sloan
Assistant City Clerk Nikima S. Newsome
CONVENE/PLEDGE On order of the Mayor, the City Council convened at 5:32 p.m., with all members present except Councilmembers Zwick and Torosis. City Manager David White led the assemblage in the Pledge of Allegiance.

AGENDA

MANAGEMENT
Motion by Councilmember Brock, seconded by Councilmember de la Torre to remove item 16.C. from the agenda. Motion passed unanimously with all Councilmembers present except Councilmembers Torosis and Zwick.

GENERAL PUBLIC
INPUT:
(Councilmember Jesse Zwick
arrived at 5:37 p.m.)
(Councilmember Caroline
Torosis arrived at 5:42 p.m.)
Members of the public John Medlin, Ron Ascherman, Jill Hawkins, Jerry Rubin, Michael Pitkin, Aubrey West, and Johnathan Foster commented on various local issues.

PUBLIC INPUT FOR

CLOSED SESSION,

SPECIAL AGENDA

ITEMS AND CONSENT
CALENDAR ONLY:

Members of the public Ted Winterer, Tom Larmore, Brian O’Neil, Richard Polanco (time donated by Esther Hickman), Maria Loya, Kevin Shenkman, Nicole Faries (time donated by Shari Davis), Ericka Lesley, Joseph Pertel, John Medlin, Debbie Mulvaney, and James Wiggins commented on closed session items.

5.L
Packet Pg. 1134 Minutes Acceptance: Minutes of Sep 12, 2023 5:30 PM (CONSENT CALENDAR) 2 September 12, 2023
No members of the public commented on special agenda items.

No members of the public commented on consent calendar items.

PROCLAMATIONS/

COMMENDATIONS

4.A. Proclamation: Suicide Prevention Month, was presented.

4.B. Proclamation: Hispanic Heritage Month, was presented.

4.C. Commendation: Eda Suh and Gary Rhoades, was presented.

CLOSED SESSIONS
(Councilmember de la Torre
was excused at 9:45 p.m.)
On order of the Mayor, the City Council recessed at 8:10 p.m., to consider closed sessions and returned at 9:59 p.m., with all members present, to report the following:

3.A. Conference with Labor Negotiator - Government Code Section 54957.6. City Negotiator: Mayor Unrepresented Employee: City Clerk Mayor Davis announced that City Clerk Denise Anderson-Warren reported that she will retiring at the end of the year and directed staff to begin the recruitment to fill the impending vacancy.

3.B. Conference with Real Estate Negotiator pursuant to Government Code Section 54956.8: Properties: Santa Monica Place Parking Structure 7, Downtown Santa Monica California; City Negotiator: Melissa Spagnuolo, Community Partnership Manager; Owner of Record: City of Santa Monica; Persons to be negotiated with: Julia Ladd, Jon Stoeckly, Macerich; Under negotiation: Price and Terms of Payment for Billboard License on Parking Structure The City Attorney advised this matter was heard with no reportable action taken.

3.C. Conference with Legal Counsel – Existing Litigation – Gov.

Code Section 54956.9(d)(1): Pico Neighborhood Association and Maria Loya v. City of Santa Monica, LASC Case No. BC 616804; California Supreme Court Case No. S26397
The City Attorney advised this matter was heard with no reportable action taken.

SPECIAL AGENDA
ITEMS:

4.D. City Manager's Report - 1) Low-Income E-Bike Voucher Program and 2) Update on Public Safety, was presented.

REPORT ON COUNCIL
TRAVEL
Councilmember Torosis reported that she traveled to St. Louis, MO to attend the National Local Progress Conference where she met with local elected officials from cities and school boards across the country. She

5.L
Packet Pg. 1135 Minutes Acceptance: Minutes of Sep 12, 2023 5:30 PM (CONSENT CALENDAR) 3 September 12, 2023
stated that no City funds were expended on the event as the City is not an organizational member of National Local Progress; she did want to report out on what information she will be bringing back to Santa Monica including but not limited to leveraging the ability of city attorneys to engage in affirmative litigation to deter bad actors; transitioning power in governing structures that work for more equitable representation; how to ensure equity in municipal bond finance so that when power shifts from local elected officials to bankers and bond attorneys, that officials can ensure that it is representative of the people they represent with alternative financing structures; further amplifying the demands of workers and improving working conditions to enact pro-worker policies in local jurisdictions; community based policing; and exploring the ideas of public utilities, public banks, and public grocery stores.

AGENDA

MANAGEMENT
Motion by Councilmember Brock, seconded by Councilmember Negrete to move item 16.D. to be heard next. Motion passed unanimously with all Councilmembers present.

NOISE REGULATIONS 16.D. Request of Councilmember Brock and Mayor Pro Tem Negrete to give direction to the City Attorney and City Manager to: (1) draft and return with Municipal Code amendments that would limit noise affecting City residents between 9 p.m. and 8 a.m.; (2) request that the City’s state lobbyist continue to advocate and pursue state legislation to enable the City to use sound-activated devices to enforce vehicle noise limits; (3) evaluate the ability to enforce California Vehicle Code 27150 and 27151 and (4) evaluate the costs and ability to deploy soundactivated devices to enforce noise limits on the Promenade, was continued to the 9/26/2023 Council meeting.

Councilmember Brock and Mayor Pro Tem Negrete stated that they were withdrawing item (1) from consideration and only considering items (2), (3), and 4.

Motion by Mayor Davis Councilmember Brock, seconded by
Councilmember Negrete to move item 16.D., as amended, to be heard with the rest of the Councilmember Discussion items. Motion passed unanimously with all Councilmembers present.

CONSENT CALENDAR: All items were considered and approved in one motion unless removed by a Councilmember for discussion.

Motion by Councilmember Brock, seconded by Mayor Pro Tem Negrete, to approve the Consent Calendar, reading resolutions by title only and waiving further reading thereof. The motion was approved by the following vote:

5.L
Packet Pg. 1136 Minutes Acceptance: Minutes of Sep 12, 2023 5:30 PM (CONSENT CALENDAR) 4 September 12, 2023
AYES: Councilmembers de la Torre, Torosis, Brock, Parra, Zwick Mayor Pro Tem Negrete, Mayor Davis
NOES: None
ABSENT: None

COMPENSATION PLAN

ADMINISTRATOR

SERVICES

5.A. Approval of Professional Services Agreement No. 11480 (CCS) with Nationwide Retirement Solutions, Inc. for Deferred Compensation Plan Administrator Services, was approved.

Recommended Action
Staff recommends that the City Council:

1. Adopt a finding of no possibility of significant effect pursuant to Section 15061(b)(3) (Common Sense Exemption) of the California Environmental Quality Act (CEQA) Guidelines; and

2. Authorize the City Manager to negotiate and execute an agreement with Nationwide Retirement Solutions, Inc. (Nationwide) for deferred compensation plan administrator services for a period of five years with two additional one-year renewal options. This recommended award is made as an exception to the competitive bidding process pursuant to Section 2.24.250 (b).

MINUTES 5.B. Minutes of City Council - Regular and Special Joint Meeting - Jun 27, 2023, were approved.

MINUTES 5.C. Minutes of City Council - Special Meeting - Jul 25, 2023, were approved.

PUBLIC INPUT ON

REMAINING AGENDA
ITEMS:

Motion by Mayor Davis, seconded Councilmember Zwick to re-open general public input to be heard simultaneously with public input on remaining agenda items. Motion passed unanimously with all Councilmembers present.

Member of the public Ahme Salem commented on 10.E.

Members of the public Michael Pitkin, Denise Barton, Carl Hansen, and Brad Ewing commented on 11.B.

Members of the public Andrew Moss, Bridie Roberts, Elisabeth Koch, Jim Conn, Kristal Romero, Dylan Kupsh, German Martinez, Dora Hernandez, Germana Escobar, Patricia Ibanez, Arturo Huezo, James Brine, Ericka Lesley, Jonah Breslau, Matthew Hom, Heira Ortiz, Beatriz Martinez, Exman Bucio, Kristin Sergant, Ignacia Urrutia, Carl Hansen, Brad Ewing, Jason Mastbaum commented on 16.D./General public input.

Members of the public Denise Barton Carl Hansen, Caro Vilain, Eli Gill, Brad Ewing, Connor Webb, Juan Matute, Jason Mastbaum commented on

5.L
Packet Pg. 1137 Minutes Acceptance: Minutes of Sep 12, 2023 5:30 PM (CONSENT CALENDAR) 5 September 12, 2023

16.E.

CONTINUE PAST 11:00
P.M.

Motion by Councilmember Torosis, seconded by Councilmember Zwick, to continue the meeting past 11. The motion failed by a roll call vote with Councilmembers Zwick, Torosis, and Mayor Davis voting yes, and Councilmembers Parra, Brock, de la Torre, and Mayor Pro Tem Negrete voting no.

Councilmember de la Torre explained his no vote by stating that he felt the meeting could have been handled better and that it was best to call it a night.

ORDINANCES:

FIREARM SALES

10.A. Second Reading and Adoption of an Ordinance Amending Santa Monica Municipal Code Chapter 3.24 to Regulate Retail Firearm Sales, Establish Additional Firearm Owner Responsibilities, Restrict Weapon Usage on City-Owned Property and Other Locations, Establish a Voluntary Commitment Program, and Ban Non-Serialized Firearms in the City, was continued to the 9/26/2023 Council meeting.

Recommended Action
Staff recommends that the City Council adopt the attached Ordinance.

OPEN CARRY 10.B. Second Reading and Adoption of an Ordinance Adding Santa Monica Municipal Code Chapter 3.29 to Prohibit the Open Carry of Knives, Daggers, and Swords in Public Areas, was continued to the 9/26/2023 Council meeting.

Recommended Action
Staff recommends that the City Council adopt the attached Ordinance.

NUISANCE ABATEMENT 10.C. Second Reading and Adoption of an Ordinance Amending the Text of the Santa Monica Municipal Code Creating Article 13, Neighborhood Preservation, and Chapter 13.02, Property
Maintenance, and Chapter 13.04, Vacant Properties and Moving Language Found in Chapter 8.96, Abatement of Nuisances, to New Chapter 13.06, Abatement of Nuisances, and Retitling Chapter 8.96 to Reserved, was continued to the 9/26/2023 Council meeting.

Recommended Action
Staff recommends that the City Council adopt the attached Ordinance.

SHARED MOBILITY

DEVICE PILOT

PROGRAM

10.D. Introduction and Adoption of an Urgency Ordinance Amending Santa Monica Municipal Code Section 3.22.090 to Extend the Second Shared Mobility Device Pilot Program, was continued to the 9/26/2023 Council meeting.

5.L
Packet Pg. 1138 Minutes Acceptance: Minutes of Sep 12, 2023 5:30 PM (CONSENT CALENDAR) 6 September 12, 2023
Recommended Action
Staff recommends that the City Council:

1. Adopt a finding of categorical exemption pursuant to Section 15301 and Section 15308 of the California Environmental Quality Act (CEQA) Guidelines

2. Introduce and adopt an urgency ordinance amending Santa Monica Municipal Code (SMMC) Section 3.22.090 to extend the term of the Second Shared Mobility Device Pilot Program from September 30, 2023, to a date thirty calendar days after execution of the contract(s) under SMMC Section 3.23 for permanent shared mobility services.

TAXICABS 10.E. Introduction and First Reading of an Ordinance Amending Santa Monica Municipal Code Chapter 6.49 on Taxicabs to Transition from Taxicab Franchises to Taxicab Permits, was continued to the 9/26/2023 Council meeting.

Recommended Action
Staff recommends that the City Council:

1. Adopt a finding of no possibility of significant effect pursuant to Section 15061(b)(3) and a finding of Categorical Exemption pursuant to Section 15301 of the California Environmental Quality Act (CEQA) Guidelines.

2. Introduce for first reading changes to the attached ordinance, SMMC 6.49, Taxicabs, that transition the City from a taxicab franchise program to a permit-based program.

STAFF

ADMINISTRATIVE
ITEMS:

COUNCIL RULES

11.A. Adoption of a Resolution Amending Council Rules of Order and Procedure, was continued to the 9/26/2023 Council meeting.

Recommended Action
Staff recommends that the City Council:

1. Adopt a finding of no possibility of significant effect pursuant to Section 15061(b)(3) (Common Sense Exemption) of the California Environmental Quality Act (CEQA) Guidelines.

2. Permanently adopt the public input pilot, previously extended to December 31, 2023, in order to efficiently implement hybrid public input model approved by Council in the 2023-25 biennial budget; and,

3. Adopt the attached proposed resolution amending the City Council’s Rules of Order and Procedure and repealing Resolution No. 11517 (CCS).

5.L
Packet Pg. 1139 Minutes Acceptance: Minutes of Sep 12, 2023 5:30 PM (CONSENT CALENDAR) 7 September 12, 2023
AFFORDABLE HOUSING 11.B. Approval of Exclusive Negotiating Agreement with AMCAL Multi-Housing, Inc. and Gen-Land, LLC, was continued to the 9/26/2023 Council meeting.

Recommended Action
Staff recommends that the City Council:

1. Authorize the City Manager to negotiate and execute an Exclusive Negotiating Agreement with AMCAL Multi-Housing, Inc. and Gen-Land, LLC, for the development of affordable and market housing on the assemblage site which includes City-owned parcels located adjacent to Expo Terminus Station.

2. Adopt a finding of no possibility of significant effect pursuant to Section 15061(b)(3) (Common Sense Exemption) of the California Environmental Quality Act (CEQA) Guidelines.

COUNCILMEMBER
DISCUSSION ITEMS:

HUMAN SERVICES

COMMISSION

16.A. Appointment to two seats on the Human Services Commission for terms both ending on 6/30/2026, was continued to the 9/26/2023 Council meeting.

L.A. WEST VECTOR

CONTROL DISTRICT

16.B. Appointment to one L.A. West Vector Control District seat for a term ending on 6/30/2026, was continued to the 9/26/2023 Council meeting.

SB 423 16.C. Request of Councilmember Brock and Councilmember Parra that the City of Santa Monica oppose SB 423 and direct the City Manager to have the City’s State lobbyist take all action necessary to advocate on the City’s behalf, was removed from the agenda.

NOISE REGULATIONS 16.D. Request of Councilmember Brock and Mayor Pro Tem Negrete to give direction to the City Attorney and City Manager to: (1) draft and return with Municipal Code amendments that would limit noise affecting City residents between 9 p.m. and 8 a.m.; (2) request that the City’s state lobbyist continue to advocate and pursue state legislation to enable the City to use sound-activated devices to enforce vehicle noise limits; (3) evaluate the ability to enforce California Vehicle Code 27150 and 27151 and (4) evaluate the costs and ability to deploy soundactivated devices to enforce noise limits on the Promenade, was amended to remove section 1 and the remainder of the item was continued to the 9/26/2023 Council meeting.

BIKE LANE SAFETY 16.E. Request of Councilmember Zwick, Councilmember Torosis, and Mayor Davis that the City Manager study and prioritize timely and effective solutions to prevent dangerous motor vehicle incursions into Santa Monica’s protected and unprotected bike lanes. Specifically, the City Manager should consider enhanced enforcement by parking

5.L
Packet Pg. 1140 Minutes Acceptance: Minutes of Sep 12, 2023 5:30 PM (CONSENT CALENDAR) 8 September 12, 2023
and traffic officers, photo enforcement to the extent allowable by law, a targeted curb management evaluation and space reallocation to reduce double parking in bike lanes, and the deployment of quick-build infrastructure to protect bike lanes and reorient parking on streets in the City’s existing and planned protected bikeway network whenever feasible, was continued to the 9/26/2023 Council meeting.

ADJOURNMENT On order of the Mayor, the City Council meeting adjourned at 12:25 a.m.

ATTEST: APPROVED:

Nikima S. Newsome Gleam Davis
Assistant City Clerk Mayor

5.L
Packet Pg. 1141 Minutes Acceptance: Minutes of Sep 12, 2023 5:30 PM (CONSENT CALENDAR) City Council
Report
City Council Meeting: September 26, 2023
Agenda Item: 8.A
1 of 2
To: Mayor and City Council
From: Douglas Sloan, City Attorney, City Attorney's Office, Administration Subject: Second Reading and Adoption of an Ordinance Amending Santa Monica Municipal Code Chapter 3.24 to Regulate Retail Firearm Sales, Establish Additional Firearm Owner Responsibilities, Restrict Weapon Usage on CityOwned Property and Other Locations, Establish a Voluntary Commitment Program, and Ban Non-Serialized Firearms in the City
Recommended Action
Staff recommends that the City Council adopt the attached Ordinance.

Executive Summary
At its meeting on August 22, 2023, the City Council introduced for first reading an Ordinance amending Santa Monica Municipal Code Chapter 3.24 to regulate retail firearm sales, establish additional firearm owner responsibilities, restrict weapon usage on City-owned property and other locations, establish a voluntary commitment program, and ban non-serialized firearms in the City. The ordinance is now presented to the City Council for adoption.