Hemet City Council
June 11, 2024

18.A

Master Services Agreement Page 3 of 20

D. Advanced Support. Customer may purchase Advanced Support services from RingCentral for use with the Services. The terms and cond itions that govern the Advanced Support can be found at: https://www.ringcentral.com/legal/enterprise-service- attachment.html.

E. Managed Services. Customer may purchase Managed Services from RingCentral for use with the Services. The terms and conditions that govern the Managed Services can be found at: https://www.ringcentral.com/legal/managed-services- attachment.html.

F. Subcontracting. RingCentral may provide any of the Services hereunder through any of its Affiliates or subcontractors, provided that RingCentral will bear the same degree of responsibility for acts and omissions for those subcontractors acting on RingCentral’s behalf in the performance of its obligations under this Agreement as it would bear if such acts and omissions were performed by RingCentral directly.

5. Use of the Service
A. Service Requirements. The Services are dependent upon Customer’s maintenance of sufficient Internet access, networks, and power as set forth in RingCentral’s Technical Sufficiency Criteria, available at https://www.ringcentral.com/legal/policies/technical-sufficiency-criteria.html. RingCentral will not be responsible for any deficiencies in the provision of the Services if Customer’s network does not meet RingCentral’s Technical Sufficiency Criteria.

B. Use Policies. Customer and its End Users may use the Services only in compliance with this Agreement, applicable Law, and the Use Policies referenced below, which are incorporated into and form part of this Agreement. Customer must ensure that its End Users comply with the Use Policies. Any breach of this Section (Use Policies) will be deemed a material breach of this Agreement. RingCentral may update the Use Policies from time to time and will provide notice of material updates to Customer at the email address on file with the Account. All updates will become effective thirty (30) days after such notice to Customer or upon posting for non-material changes. Customer may object to a modification that negatively impacts its use of the Service by sending written notice (“Objection Notice”) to RingCentral within thirty (30) days from the date of the notice of modification. If the Parties cannot reach agreement, then either Party may terminate the affected Services without penalty with thirty (30) days written notice to the other Party.
i. Acceptable Use Policy. The Services must be used in accordance with RingCentral’s Acceptable Use Policy, available at https://www.ringcentral.com/legal/acceptable-use-policy.html. Notwithstanding anything to the contrary in this Agreement, RingCentral may act immediately and without notice to suspend or limit the Services if RingCentral reasonably suspects fraudulent or illegal activity in the Customer’s Account, material breach of the Acceptable Use Policy, or use of the Services that could interfere with the functioning of the RingCentral Network provided such suspension or limitation may only be to the extent reasonably necessary to protect against the applicable condition, activ ity, or use. RingCentral will promptly remove the suspension or limitation as soon as the condition, activity or use is resolved and mitigated in full. If Customer anticipates legitimate but unusual activity on its Account, Customer should contact Customer Care in advance to avoid any Service disruption.
ii. Emergency Services. RingCentral’s policy governing the provision of emergency services accessed via the Services is available at https://www.ringcentral.com/legal/emergency-services.html. iii. Numbering Policy. The provision, use, and publication of numbers used in conjunction with the Services are governed by RingCentral’s Numbering Policies, available at https://www.ringcentral.com/legal/policies/numbering-policy.html.

6. Termination
A. Termination for Cause. Either Party may terminate this Agreement and any Services purchased hereunder in whole or part by giving written notice to the other Party: i) if the other Party breaches any material term of this Agreement and fails to cure such breach within thirty (30) days after receipt of such notice; ii) at the written recommendation of a government or regulatory agency following a change in either applicable Law or the Services; or iii) upon the commencement by or against the other Party of insolvency, receivership or bankruptcy proceedings or any other proceedings or an assignment for the benefit of creditors.

B. Effect of Termination. If Customer terminates the Services, a portion of the Services, or this Agreement in its entirety due to RingCentral’s material breach under Section 6(A) (Termination for Cause), Customer will not be liable for any fees or charges for terminated Services for any period subsequent to the effective date of such termination (except those arising from continued usage before the Services are disconnected), and RingCentral will provide Customer a pro -rata refund of any prepaid and unused fees or ch arges paid by Customer for terminated Services. If this Agreement or any Services are terminated for any reason other than as a result of a material breach by RingCentral or as otherwise permitted pursuant to Section 6(A) or as se t forth in Section 14(I) (Regulatory and Legal Changes) the Customer must, to the extent permitted by applicable Law and without limiting any other right or remedy of RingCentral, pay within thirty (30) days of such termination all amounts that have accr ued prior to such termination, as well as all sums remaining unpaid for the Services for the remainder of the then-current Term plus related Taxes and fees.

7. Intellectual Property
A. Limited License
i. Subject to, and conditional upon Customer’s compliance with, the terms of this Agreement, RingCentral grants to Customer and its End User, a limited, personal, revocable, non -exclusive, non -transferable (other than as permitted under this Agreement), non-sublicensable license to use any software provided or made available by RingCentral to the Customer as

18.A

Master Services Agreement Page 4 of 20

part of the Services ( “Software”) to the extent reasonably required to use the Services as permitted by this Agreement, only for the duration that Customer is entitled to use the Services and subject to the Customer being current on its payment obligations.
ii. Customer will not, and will not allow its End Users, to: (a) sublicense, resell, distribute or assign its right under the lic ense granted under this Agreement to any other person or entity; (b) modify, adapt or create derivative works of t he Software or any associated documentation; (c) reverse engineer, decompile, decrypt, disassemble or otherwise attempt to derive the source code for the Software; (d) use the Software for infringement analysis, benchmarking, or for any purpose other than as necessary to use the Services Customer is authorized to use; (e) create any competing Software or Services; or (f) remove any copyright or other proprietary or confidential notices on any Software or Services.

B. IP Rights
i. RingCentral’s Rights. Except as expressly provided in this Agreement, the limited license granted to Customer under Section 7(A) (Limited License) does not convey any ownership or other rights or licenses, express or implied, in the Services (including the Software), any relate d materials, or in any Intellectual Property and no IP Rights or other rights or licenses are granted, transferred, or assigned to Customer, any End User, or any other party by implication, estoppel, or otherwise.

All rights not expressly granted herein ar e reserved and retained by RingCentral and its licensors. The Software and Services may comprise or incorporate services, software, technology, or products developed or provided by third parties, including open-source software or code. Customer acknowledge s that misuse of RingCentral Services may violate third - party IP rights.
ii. Customer Rights. As between RingCentral and Customer, Customer retains title to all IP Rights that are owned by the Customer or its suppliers. To the extent reasonably required or desirable for the provision of the Services, Customer grants to RingCentral a limited, personal, non-exclusive, royalty-free, license to use Customer’s IP Rights in the same. Customer must provide (and is solely responsible for providing) all required notices and obtaining all licenses, consents, authorizations, or other approvals related to the use, reproduction, transmission, or receipt of any Customer Content that includes personal or Confidential Information or incorporates any third-party IP rights.

C. Use of Marks. Neither Party may use or display the other Party’s trademarks, service mark or logos in any manner without such Party’s prior written consent.

8. Confidentiality
A. Restrictions on Use or Disclosures by Either Party. During the Term of this Agreement and for at least one (1) year thereafter, the Receiving Party shall hold the Disclosing Party’s Confidential Information in confidence, shall use such Confidential Information only for the purpose of fulfilling its obligations under this Agreement, and shall use at least as great a standard of care in protecting the Confidential Information as it uses to protect its own Confidential Information.

Each Party may disclose Confidential Information only to those of its employees, agents or subcontractors who hav e a need to it in order to perform or exercise such Party’s rights or obligations under this Agreement and who are required to protect it against unauthorized disclosure in a manner no less protective than required under this Agreement. Each Party may disclose the other Party’s Confidential Information in any legal proceeding or to a governmental entity as required by Law.

These restrictions on the use or disclosure of Confidential Information do not apply to any information which is independentl y developed by the Receiving Party or lawfully received free of restriction from another source having the right to so furnish such information; after it has become generally available to the public without breach of this Agreement by the Receiving Party; which at the time of disclosure was already known to the Receiving Party, without restriction as evidenced by documentation in such Party’s possession; or which the Disclosing Party confirms in writing is free of such restrictions.

Upon termination of this Agreement, the Receiving Party will promptly delete, destroy or, at the Disclosing Party’s request, return to the Disclosing Party, all Disclosing Party’s Confidential Information in its possession, including deleting or rendering unusable all electronic files and d ata that contain Confidential Information, and upon request will provide the Disclosing Party with certification of compliance with this subsection.

9. Data Protection
A. Data Privacy. RingCentral respects Customer’s privacy and will only use the information provided by Customer to RingCentral or collected in the provision of the Services in accordance with RingCentral’s Data Processing Addendum, available at https://www.ringcentral.com/legal/dpa.html, incorporated by reference. RingCentral may update the Data Processing Addendum from time to time and will provide notice of any material updates to the Customer as required by applicable Laws at the email address on file with the Account. Such updates will be effective thirty (30) days after such notice to Customer.

B. Data Security. RingCentral will take commercially reasonable precautions, including, without limitation, technical (e.g., firewalls and data encrypti on), organizational, administrative, and physical measures, to help safeguard Customer’s Account, Account Data, and Customer Content against unauthorized use, disclosure, or modification. Customer must protect all End Points using commercially reasonable s ecurity measures. Customer is solely responsible to keep all user identifications and passwords secure. Customer must monitor use of the Services for possible unlawful or fraudulent use. Customer must notify RingCentral immediately if Customer becomes awar e or has reason to believe that the Services are being used fraudulently or without authorization by any End User or third party. Failure to notify RingCentral may result in the suspension or termination of th e Services and additional charges to Customer r esulting from such use. RingCentral will not be liable for any charges resulting from unauthorized use of Customer’s Account.

18.A

Master Services Agreement Page 5 of 20

C. Software Changes. RingCentral may from time-to-time push software updates and patches directly to Customer’s device(s) for installation and Customer will not prevent RingCentral from doing so. Customer must implement promptly all fixes, updates, upgrades and replacements of software and third -party software that may be provided by RingCentral. RingCentral will not be liable for inoperability of the Services or any other Services failures due to failure of Customer to timely implement the required changes.

10. Limitations of Liability
A. Excluded Damages
IN NO EVENT WILL EITHER PARTY OR ITS AFFILIATES OR ITS OR THEIR SUPPLIERS BE LIABLE FOR (1) INDIRECT, INCIDENTAL, PUNITIVE, OR CONSEQUENTIAL DAMAGES; (2) LOSS OF USE OR LOSS OF DATA; (3) LOSS OF BUSINESS OPPORTUNITIES, REVENUES OR PROFITS; OR (4) COSTS OF PROCURING REPLACEMENT PRODUCTS OR

SERVICES, IN ALL CASES WHETHER ARISING UNDER CONTRACT, WARRANTY, TORT (INCLUDING NEGLIGENCE OR

STRICT LIABILITY), OR ANY OTHER THEORY OF LIABILITY, AND EVEN IF SUCH PARTY HAS BEEN INFORMED IN ADVANCE OF SUCH DAMAGES OR SUCH DAMAGES COULD HAVE BEEN REASONABLY FORESEEN.

B. Liability Caps

EXCEPT AS SET FORTH HERE IN, THE TOTAL CUMULATIVE LIABILITY OF THE PARTIES UNDER THIS AGREEMENT WILL NOT EXCEED THE AMOUNTS PAID OR PAYABLE UNDER THIS AGREEMENT DURING THE PREVIOUS SIX (6) MONTHS. LIMITATIONS UNDER THIS SECTION (LIABILITY CAPS) WILL NOT APPLY TO:
i. FEES OWED BY CUSTOMER
ii. EITHER PARTY’S LIABILITY FOR INFRINGEMENT OF THE OTHER PARTY’S IP RIGHTS iii. EITHER PARTY’S LIABILITY RESULTING FROM GROSS NEGLIGENCE, FRAUD, OR WILLFUL OR CRIMINAL

MISCONDUCT
iv. CUSTOMER’S LIABILITY RESULTING FROM USE OF THE SERVICES IN BREACH OF THE ACCEPT ABLE USE

POLICY OR EMERGENCY SERVICES POLICY
v. EITHER PARTY’S LIABILITY ARISING FROM DEATH OR PERSONAL INJURY CAUSED BY NEGLIGENCE, OR FOR

ANY OTHER LIABILITY WHICH MAY NOT BE RESTRICTED, LIMITED, OR EXCLUDED PURSUANT TO APPLICABLE LAW.

11. Indemnification
A. Indemnification by RingCentral
i. RingCentral shall indemnify and hold harmless the Customer and its Affiliates for Indemnifiable Amounts, and shall defend any third-party claims or causes of action (a “Third Party Claim” ) to the extent such Third Party Claim arises out of or alleges that:
a. The Services, as provided by RingCentral, infringe or misappropriate the patent, copyright, trademark, or trade secret rights of a third party.
ii. RingCentral will have no obligations under subsection (i) above to the extent the Third Party Claim arises from: (a) use of the Services in combination with data, software, hardware, equipment, or technology not provided or authorized by RingCentral in writing unless any of the foregoing are necessary for the proper operation of the Services; (b) modifications to the Services not made by RingCentral; (c) Customer Content; (d) failure to promptly install any updates of any software or firmware or accept or use any modified or replacement items provided free of charge by or on behalf of RingCentral; (e) breach of the Agreement; or (f) a Third Party Claim brought by Customer’s Affiliate, successor, or assignee. iii. If such a Third -Party Claim is made or appears possible, Customer agrees to permit RingCentral, at RingCentral’s sole discretion and expense, to (a) modify or replace the Services, or component or part thereof, to make it non-infringing or (b) obtain the right for Customer to continue to use the Services. If RingCentral determines that neither alternative is commercially reasonable, RingCentral may terminate this Agreement in its entirety or with respect to the affected Service, component or part (a “Discontinued Component”), effective immediately on written notice to Customer, in which case Customer will not owe any fees or charges relating to the Discontinued Component for any period subsequent to the date of such termination, and will be entitled to receive a refund of any prepaid but unused fees relating to the Discontinued Component. In the event the removal of the Discontinued Component does not substantially affect Customer’s use of the Services, the refund or fee abatement pursuant to the foregoing shall be a reasonable portion of the total fees owed by Customer for the Services as a whole based on the significance of the Disc ontinued Component to the total value of the Services as a whole. RingCentral’s obligations under this Sub-Section will be RingCentral’s sole and exclusive liability and Customer’s sole and exclusive remedies with respect to any actual or alleged intellectual property violations.

B. Indemnification by Customer. To the extent permitted by the laws and the constitution of the jurisdiction of Customer, Customer shall indemnify, and hold harmless RingCentral and its Affiliates for Indemnifiable Amounts, and shall defend any Third Party Claims arising out of or in connection with: (i) material violation of applicable Law by the Customer, its Affiliates, or their respective End Users in connection with their use of the Services; (ii) use of the Services in breach of the Use Policies; (iii) failure to promptly install any updates of any software or firmware or accept or use modified or replacement items provided free of charge by or on behalf of RingCentral; or (iv) Customer Content.

18.A

Master Services Agreement Page 6 of 20

C. Defense and Indemnification Procedures. Any Party seeking indemnification under this Section 11 (the “Indemnified Party”) shall provide the Party from which it seeks such indemnification (the “Indemnifying Party”) with the following: (a) prompt written notice of the Third -Party Claim, (b) sole control over the defense and settlement of the Third -Party Claim, and (c) reasonable information, cooperation, and assistance (at the Indemnifying Party’s sole expense except for the value of the time of the Indemnified Party’s personnel) in connection with the defense and settlement of the Third-Party Claim. The Indemnified Party’s failure to comply with the foregoing obligations will not relieve the Indemnifying Party of its defense or indemnification obligations under this Section 11 (Indemnification) except to the extent that the Indemnifying Party is materially prejudiced by such failure.

The Indemnified Party will have the right to participate (but not control), at its own expense, in the defense of such Third -Party Claim, including any related s ettlement negotiations. No such claim may be settled by the Indemnifying Party without the Indemnified Party’s express written consent (not to be unreasonably withheld, conditioned, or delayed) unless such settlement includes a full and complete release of all claims and actions against the Indemnified Party by each party bringing such Third - Party Claim, requires no admission of fault, liability, or guilt by the Indemnified Party, and requires no act by the Indemni fied Party other than the payment of a sum of money fully indemnified by the Indemnifying Party.

12. Warranties
A. RingCentral Warranty. RingCentral will provide the Services using a commercially reasonable level of skill and care, in material compliance with all applicable Laws and otherwise subject to t he terms of this Agreement . To the extent permitted by Law, RingCentral shall pass through to Customer any and all warranties RingCentral receives in connection with equipment provided to Customer by or on behalf of RingCentral.

B. Customer Warranty. Customer’s and its End Users’ use of the Services must always comply with all applicable Laws and this Agreement. Further, when Customer’s subscription for Services exceeds one (1) fiscal year, Customer warrants that it shall exercise due diligence and best effor ts to secure an adequate appropriation of funds on time from its legislative or similar government body to pay for the contracted Services in the follow-on fiscal year(s).

C. Disclaimer of Warranties . EXCEPT AS SPECIFICALLY SET FORTH IN THIS AGREEMENT AND TO THE FULLEST EXTENT PERMITTED BY LAW, THE SERVICES ARE PROVIDED “AS IS” AND “AS AVAILABLE,” AND RINGCENTRAL

MAKES NO OTHER WARRANTIES, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE IMPLIED

WARRANTIES OF MERCHANTABILITY, NON-INFRINGEMENT, QUIET ENJOYMENT, AND FITNESS FOR A PARTICULAR

PURPOSE AND ANY WARRANTIES ARISING FROM A COURSE OF DEALING OR USAGE IN TRADE, TOGETHER WITH SIMILAR WARRANTIES, WHETHER ARISING UNDER ANY LAW OR OTHERWISE. TO THE EXTENT THAT

RINGCENTRAL CANNOT DISCLAIM ANY SUCH WARRANTY AS A MATTER OF APPLICABLE LAW, THE SCOPE AND DURATION OF SUCH WILL BE LIMITED TO THE FULLEST EXTENT PERMITTED BY LAW.

13. Dispute Resolution
A. Governing Law. Any dispute arising out of or relating to this Agreement shall be governed and construed in accordance with the laws of CALIFORNIA, without regard to its choice of law rules, and the parties agree to submit to the jurisdiction of, an d venue in, the courts in that state. The United Nations Convention on Contracts for the International Sale of Goods does not apply to this Agreement or Customer’s use of the products or Services.

B. Good Faith Attempt to Settle Disputes . In the event of a dispute, each Party shal l appoint a duly authorized representative who shall use all reasonable endeavors to resolve in good faith any dispute within reasonable timescales.

C. Equitable Relief. Any breach of either Party’s IP Rights may cause that Party irreparable harm for which mo netary damages will be inadequate and such Party may, in addition to other remedies available at Law or in equity, obtain injunctive relief without the necessity of posting a bond or other security, proof of damages, or similar requirement, in additional t o any other relief to which such Party may be entitled under applicable Law.

14. Miscellaneous
A. Relationship of the Parties. RingCentral and Customer are independent contractors, and this Agreement will not establish any relationship of partnership, joint venture, employment, franchise or agency between RingCentral and Customer.

B. Assignment. Neither Party may assign the Agreement or any portion thereof without the other Party’s prior written consent (which such consent may not be unreasonably withheld or delayed), however either Party may assign the Agreement and all of that Party’s rights and obligations thereunder without consent (a) to an Affiliate; (b) to the Party’s successor or surviving entity in connection with a merger, acquisition, consolidation, sale of all or substantially all of its assets used in connection with the provision of Services under this Agreement; or (c) as part of the transfer or disposition of more than fifty percent (50%) of a Party’s voting control or assets. This Agreement will bind and inure to the benefit of the Parties, and their permitted assigns and successors.

C. Notices. Except where otherwise expressly stated in the Agreement, all notices or other communications must be in English and are deemed to have been fully given when mad e in writing and delivered in person, upon delivered email, confirmed facsimile, or five days after deposit with an reputable overnight courier service, and addressed as follows: To RingCentral a t RingCentral, Inc., Legal Dept., 20 Davis Drive, Belmont, CA 94002 USA, with a copy to [email protected], and to Customer at either the physical address or email address associated with the Customer Account.

Customer acknowledges and agrees that all electronic notices have the full force and effect of paper notices. The addresses to which notices may be given by either Party may be changed (a) by RingCentral upon written notice given to Customer pursuant to this Section or (b) by Customer in the Administrative Portal.

18.A

Master Services Agreement Page 7 of 20

D. Force Majeure. Excluding either Party’s payment obligations under the Agreement, neither Party will be responsible or liable for any failure to perform or delay in performing to the extent resulting from any event or circumstance that is beyond that Party’s reasonable control, including without limitation any act of God; national emergency; third -party telecommunications networks; riot; war; terrorism; governmental act or direction; change in Laws; fiber, cable, or wire cut; power outage or reduction; rebellion; revolution; insurrection; earthquake; storm; hurricane; flood, fire, or other natural disaster; strike or labor disturbance; or other cause, whether similar or dissimilar to the foregoing, not resulting from the actions or inactions of such Party.

E. Third-Party Beneficiaries. RingCentral and Customer agree that there will be no third-party beneficiaries to this Agreement.

F. Headings, Interpretation. The headings, section titles, and captions used in the Agreement are for convenience of reference only and will have no legal effect. All defined terms include related grammatical forms, and, whenever the context may requir e, the singular form of nouns and pronouns include the plural, and vice versa. The Parties agree that this Agreement will be deemed to have been jointly and equally drafted by them, and that the provisions of this Agreement therefore should not be construed against a Party or Parties on the grounds that the Party or Parties drafted or was more responsible for drafting the provision(s).

G. Anti-Bribery. Each Party represents that in the execution of this Agreement and in the performance of its obligations under this Agreement it has complied and will comply with all applicable anti-bribery Laws and regulations, including, without limitation, the U.S. Foreign Corrupt Practices Act, the UK Bribery Act, and similar applicable Laws.

H. Export Control. Any services, products, software, and technical information (including, but not limited to, services and training) provided pursuant to the Agreemen t may be subject to U.S. export Laws and regulations. Customer will not use distribute, transfer, or transmit the services, products, software, or technical information (even if incorporated into other products) e xcept in compliance with U.S. and other applicable export regulations.

I. Regulatory and Legal Changes. In the event of any change in Law, regulation or industry change that would prohibit or otherwise materially interfere with RingCentral’s ability to provide Services under this Agreement, RingCentra l may terminate the affected Services or this Agreement or otherwise modify the terms thereof.

J. Entire Agreement. The Agreement, together with any exhibits, Order Forms, Use Policies, and Attachments, each of which is expressly incorporated into this Agreem ent with this reference, constitutes the entire agreement between the Parties and supersedes and replaces any and all prior or contemporaneous understandings, proposals, representations, marketing materials, statements, or agreements, whether oral, written, or otherwise, regarding such subject. RingCentral expressly rejects in their entirety any additional or conflicting terms or conditions contained in Customer purchase order, or similar Customer document, which the Parties agree are solely for the Customer’s convenience.

K. Order of Precedence. In the event of any conflict between the documents comprising this Agreement, precedence will be given to the documents in the following descending order: (i) the applicable Order Form (including any hyperlinks); (ii) the applicable Attachment; (iii) the main body of this Agreement; (iv) Use Policies and Data Processing Addendum incorporated by reference in this Agreement; and (v) and any other document expressly referred to in this Agreement which governs the Services. With respect to data processing, the Data Processing Addendum shall take precedence over any inconsistent terms in any of the documents listed in the previous sentence.

L. Amendments. Except as otherwise provided, this Agreement may only be modified by a wri tten amendment executed by authorized representatives of both Parties. In no event will handwritten changes to any terms or conditions, including in the applicable Order Form, be effective.

M. Severability and Waiver. In the event any provision of this Agreement is held by a court of competent jurisdiction to be invalid, void or unenforceable, such provision(s) will be stricken and the remainder of this Agreement will remain legal, valid, and binding.

The failure by either Party to exercise or enforce any right conferred by this Agreement will not be deemed to be a waiver of any such right or to operate so as to bar the exercise or enforcement of any such or other right on any later occasion. Except as otherwise expressly stated in this Agreement, all rights and remedies stated in the Agreement are cumulative and in addition to any other rights and remedies available under the Agreement, at Law, or in equity.

N. Publicity. Subject to Customer’s prior written approval, which may not be unreasonably withheld or denie d, in each instance, and notwithstanding anything to the contrary in this Agreement, RingCentral may identify Customer as a customer (including use of any Customer logo or trademark) and may refer to this Agreement during its earnings calls and in connecti on with its business deals, press releases, and marketing and/or promotional materials.

O. Execution. Each Party represents and warrants that: (a) it possesses the legal right and capacity to enter into the Agreement and to perform all of its obligations th ereunder; (b) the individual signing the Agreement and (each executable part thereof) on that Party’s behalf has full power and authority to execute and deliver the same; and (c) the Agreement will be a binding obligation of that Party. Each Party agrees t hat an Electronic Signature, whether digital or encrypted, is intended to authenticate this Agreement and to have the same force and effect as manual signatures.

P. Counterparts. This Agreement may be executed electronically and in separate counterparts each of which when taken together will constitute one in the same original.

Q. Survival. The rights and obligations of either Party that by their nature would continue beyond the expiration or termination of this Agreement or an Order Form will survive expiration or termination of this Agreement or the Order Form, including without limitation payment obligations, warranty disclaimers, indemnities, limitations of liability, definitions and miscellaneous.

18.A

Master Services Agreement Page 8 of 20

R. Family Education Rights and Privacy Act (FERPA). Customer Content when in-transit on the RingCentral Network and when at-rest within RingCentral Data Centers may contain communications and/or educational records pertaining to students in connection with the performance of the Services pursuant to the Agreement. Rin gCentral shall only use or disclose such Customer Content as is reasonably necessary to provide the Services or for RingCentral to otherwise perform its obligations under the Agreement.

18.A

Master Services Agreement Page 9 of 20

EXHIBIT A

DEFINITIONS

Definitions. Capitalized terms used in this Agreement but otherwise not defined have the following meaning:

1. “Account” means the numbered account established with RingCentral and associated with Customer and the Services provided to Customer under this Agreement. For billing and convenience purposes, multiple services, Digital Lines, or End Users may be included in a single billing account, and/or a single Customer may have multiple billing accounts encompassing different geographic locations, business units, or other designations as requested by Customer and accepted by RingCentral.

2. “Account Administrator” means the person(s) who have been granted authority by Customer to set up, amend, or otherwise control settings and/or make additional purchases for the Account via the Administrative Portal. Accou nt Administrators may have varying levels of Account rights, skills, or permissions.

3. “Account Data” means: any business contact information provided with the Account; RingCentral-generated logs of calling or other metadata developed or collected in the pro vision of the Services; configuration data; and records of Digital Lines and any Services purchased under this Agreement.

4. “Administrative Fees” means any administrative recovery fees, 911 cost recovery fees and the like separately charged by RingCentral to Customer.

5. “Administrative Portal” means the online administrative portal through which Account Administrators control settings and/or make additional purchases for the Account.

6. “Affiliate(s)” means a person or entity that is controlled by a Party hereto, controls a Party hereto, or is under common control with a Party hereto, and “control” means beneficial ownership of greater than fifty percent (50%) of an entity’s then -outstanding voting securities or ownership interests.

7. “Attachment(s)” means documents appended to the contract containing additional terms for products and Services. Attachments and the terms and conditions contained therein are part of this Agreement.

8. “Confidential Information” means any information disclosed by or on behalf of the Disclos ing Party) to the Receiving Party that should reasonably be considered as confidential given the nature of the information and the circumstances surrounding its disclosure.

9. “Customer Care” means Customer support operations delivered by RingCentral and/or its subcontractors.

10. “Customer Content” means the content of calls, facsimiles, SMS messages, voicemails, voice recordings, shared files, conferences, or other communications transmitted or stored through the Services.

11. “Digital Line” means a phone number ass igned to an End User or a specifically designated location (e.g., conference room) and the associated voice service for inbound and outbound calling that permits an End User generally to make and receive calls to and from the public switched telephone network as well as to and from other extensions within the same Account.

12. “Disclosing Party” means the Party disclosing Confidential Information or on whose behalf Confidential Information is disclosed by such Party’s agents, including but not limited to, its Affiliates, officers, directors, employees, and attorneys.

13. “Electronic Signatures” means an electronic sound, symbol, or process, including clicking a digital button to accept, attached to or logically associated with a contract or other record and executed or adopted by a person with the intent to sign the record.

14. “End Point” means an application or device through which any End -User might access and/or use any of the Services, including without limitation IP Desk Phones, Desktop Clients, Web Clients, Mobile Applications, and Software Integrations.

15. “End User” means an individual user to whom Customer makes the Services available, and may be a natural person, and may include but is not limited to Customer’s employees, consultants, clients, external users, invitees, contractors, and agents.

16. “Helpdesk Support” shall mean the performance of the following tasks:
• Standard feature/functionality (“how to”) support for End Users (i.e. call forwarding, voice mail set-up, etc.). • Standard management of the Admin Interface within the product. • Support all moves, adds, changes, and deletes of employees.

17. “Indemnifiable Amounts” means all (X) damages and other amounts awarded against the Indemnified Party by a court of competent jurisdiction pursuant to a final judgment in connection with such Third -Party Claim; (Y) any amounts payable by the Indemnified Party or its Affiliates pursuant to a binding, written agreement settling the Third Party Claim, provided such ag reement is approved in advance in writing by the Indemnifyi ng Party; and (Z) all reasonable costs and expenses paid to third parties by the Indemnified Party or its Affiliates in connection with the Indemnified Party’s or its Affiliates’ attorneys’ fees and related expenses.

18. “Indemnifying Party” and “Indemnified P arty” have the meanings set forth in Section 11(C) (Defense and Indemnification Procedures).

19. “Initial Term” has the meaning set forth in Section 2(D) (Services Term).

18.A

Master Services Agreement Page 10 of 20

20. “Intellectual Property Rights” or “IP Rights” means all common law and statutory rights (whether registered or unregistered, or recorded or unrecorded, regardless of method) arising out of or associated with: (a) patents and patent applications, inventi ons, industrial designs, discoveries, business methods, and processes; (b) copyrights and copyright registrations, and “moral” rights; (c) the protection of trade and industrial secrets and Confidential Information; (d) other proprietary rights relating to intangi ble property; (e) trademarks, trade name s and service marks; (f) a person’s name, likeness, voice, photograph or signature, including without limitation rights of personality, privacy, and publicity; (g) analogous rights to those set forth above; and (h) divisions, c ontinuations, continuations-in-part, renewals, reissuances and extensions of the foregoing (as applicable).

21. “Law” means any law, statute, regulation, rule, ordinance, administrative guidance, treaty or convention, or court or administrativ e order or ruling of any governing Federal, State, local or non-U.S. governmental body with jurisdiction over the Services.

22. “Order Form(s)” means a request for Service describing the type and quantity of Services required by Customer and submitted and accepted by the Parties in accordance with Section 2(A) (Ordering Services). The Order Form may be presented and executed via the Administrative Portal.

23. “Receiving Party” means the Party or its agents, including, but not limited to its Affiliates, officers, directors, employees, and attorneys receiving Confidential Information.

24. “Renewal Term” has the meaning set forth in Section 2(D) (Services Term).

25. “RingCentral Network” means the network and supporting facilities between and among the RingCentral points of presence (“PoP(s)”), up to and including the i nterconnection point between the RingCentral’s network and facilities, and the public Internet, and the Public Switched Telephone Network (PSTN). The RingCentral Network does not include the public Internet, a Customer’s own private network, or the PSTN.

26. “Service(s)” means all services provided under this Agreement and set forth in one or more Order Form(s).

27. “Start Date” means the date so identified in the relevant Order Form or the date on which Customer orders Services via the Administrative Portal.

28. “Taxes” means any and all federal, state, local, municipal, foreign, and other taxes and fees charged or collected from Customers, including but not limited to any Universal Service Fund, TRS and 911 taxes and fees.

29. “Term” means the Initial Term plus any Renewal Terms.

30. “Third Party Claim” has the meaning set forth in Section 11(A) (Indemnification by RingCentral).

31. “Use Policy” refers to any of the policies identified in Section 5(B) (Use Policies).

18.A

Master Services Agreement Page 11 of 20

ATTACHMENT A

SERVICE ATTACHMENT - RINGEX SERVICES

This Service Attachment is a part of the Master Services Agreement (the “Agreement”) that includes the terms and conditions agreed by the Parties under which RingCentral will provide to the Customer the RingEX Services as described under the applicable Order Form (the “Services”).

1. Service Overview
The Services are a cloud-based unified communications service that includes enterprise-class voice, fax, call handling, mobile apps, and bring-your-own-device (BYOD) capability that integrates with a growing list of applications.

The Services include:
 Voice Services, including extension-to-extension calling and the ability to make and receive calls to and from the public switched telephone network (PSTN)
 Video and audio-conferencing service, including screen sharing  Collaboration Tools, including One-to-One and Team Chat, File Sharing, task management, SMS/Texting (where available), and other innovative tools
The Services may be accessed from a variety of user End Point s, including IP Desk Phones, Desktop Clients, Web Clients, Mobile Applications, and Software Integrations.

2. RingEX Purchase Plans
A. Tiers of Service . The Services are made available in several pricing tiers, which are described more fully at https://www.ringcentral.com/office/plansandpricing.html. While RingCentral offers unlimited monthly plans for some of its products and services, RingCentral Services are intended for regular business use. “Unlimited” use does not permit any use otherwise prohibited by the Acceptable Use Policy, available at https://www.ringcentral.com/legal/acceptable-use-policy.html, including trunking, access stimulation, reselling of the Services, etc.

B. Minute and Calling Credit Bundles. Each plan includes a number of Toll-Free minutes, per month, which are pooled to create a single allotment of Toll -Free minutes available for the entire account. Core/Advanced/Ultra tier plans include a monthly allotment of 100/1000/10000 toll free minutes per account, respectively. Overage charges of 3.9¢ per minute apply to calls made in excess of allotment.

International Calling Credit Bundles can be purchased in addition to any base amount included with the purchased tier.

International External Calls are charged against Calling Credits on the Account per destination rates, or as overage once Calling Credits are exceeded. Currently effective rates are available at https://www.ringcentral.com/support/international-rates.html.

Extension-to-Extension Calls within the Customer account never incur any usage fee and are unlimited, except to the extent that such calls are forwarded to another number that is not on the Customer account.

Additional Calling Credits may be purchased through the Auto-Purchase feature, which can be selected for automatic purchase in various increments on the Administrative Portal. Auto-Purchase is triggered when the combined usage of all End Users on an Account exceeds the total Calling Credits or when End Users make calls with additional fees (e.g., 411).

Minute Bundles and Calling Credit Bundles expire at the end of month and cannot roll over to the following month. Auto - Purchased Calling Credits expire twelve (12) months from date of purchase. Bundles may not be sold, transferred, assigned, or applied to any other customer.

C. Enhanced Business SMS Allotment and Pricing. Each plan includes a number of SMS per each user, per month, which are pooled to create a single allotment of SMS available to the entire account. Core/Advanced/Ultra tier plans include a mon thly allotment of 25/100/200 SMS, per user respectively. Each SMS sent or received will be deducted from the pool of available SMS on the account. Overage charges apply to SMS sent or receive in excess of allotment and will be charged at the then-applicable rates, available at https://www.ringcentral.com/support/new-sms-rates.html. Additional SMS bundles are available for purchase at discounted prices. Customer must successfully register phone numbers with the SMS registar prior to using SMS. RingCentral may attempt to deliver SMS sent from unregistered phone numbers at its discretion, however unregistered SMS are excluded from the monthly allotment and any purchased SMS bundles, and will be charged at then -applicable unregistered SMS rates, available at https://www.ringcentral.com/support/new-sms-rates.html.

3. Operator Assisted Calling, 311, 511 and other N11 Calling RingCentral does not support 0+ or operator assisted calling (including, without limitation, collect calls, third party billing calls, 900, or other premium line numbers or calling card calls). The Services may not support 211, 311, 411, 511 and/or N11 callin g. To the extent they are supported, additional charges may apply for these calls.

18.A

Master Services Agreement Page 12 of 20

4. Directory Listing Service
RingCentral offers directory listing (the “Directory Listing Service” ). If Customer subscribes to the Directory Listing Service, RingCentral will share certain Customer Contact Data with third parties as reasonably necessary to include in the phone directory (“Listing Information” ). This information may include, but is not limited to, Customer’s company name, address, and phone numbers. Customer authorizes RingCentral to use and disclose the Listing Information for the purpose of publishing in, and making publicly available through, third-party directory listing services, to be selected by RingCentral or third-party service providers in their sole dis cretion. Customer acknowledges and agrees that by subscribing to the Directory Listing Service, Customer’s Listing Information may enter the public domain and that RingCentral cannot control third parties’ use of such information obtained through the Directory Listing Service.

A. Opt Out. Customer may opt out of the Directory Listing Service at any time; however, RingCentral is not obligated to have Customer’s Listing Information removed from third -party directory assistance listing services that have already received Customer’s information.

B. No Liability. RingCentral will have no responsibility or liability for any cost, damages, liabilities, or inconvenience caused by calls made to Customer’s telephone number; materials sent to Customer, inaccuracies, errors or omissions with Listing Information; or any other use of such information. RingCentral will not be liable to Customer for any use by third parties of Customer’s Listing Information obtained through the Directory Listing Service, including without limitat ion the use of such information after Customer has opted out of the Directory Listing Service.

5. Global RingEX or RingCentral Global Office. Global RingEX (which is also known as RingCentral Global Office and references in the Service Description to Global R ingEX shall also refer to Global Office) provides a single communications system to companies that have offices around the world, offering localized service in countries for which Global RingEX is available. Additional information related to Global RingEX Services is available at http://www.ringcentral.com/legal/policies/global-office-countries.html. This section sets forth additional terms and conditions concerning RingCentral’s Global RingEX for customers that subscribe to it.

A. Emergency Service Limitations for Global RingEX. RingCentral provides access to Emergency Calling Services in many, but not all, countries in which RingCentral Global RingEX is available, allowing End Users in most countries to access Emergency Services. Emergency Services may only be accessed within the country in which the Digital Line is assigned, e.g., an End User with a Digital Line assigned in Ireland may dial Emergency Services only within Ireland. Access to Emergency Calling Services in RingCentral Global RingEX countries, where available, is subject to the Emergency Services Policy, available at https://www.ringcentral.com/legal/emergency-services.html. Customer must make available and will maintain at all times traditional landline and/or mobile network telephone services that will enable End Users to call the applicable Emergency Services number. Customer may not use the RingCentral Services in environments requiring fail -safe performance or in which the failure of the RingCentral Services could lead directly to death, personal injury, or severe physical or environmental damage.

B. Global RingEX Provided Only in Connection with Home Country Service. RingCentral provides Global RingEX Service only in connection with Services purchased in the Home Country. RingCentral may immediately suspend or terminate Customer’s Global RingEX Services if Customer t erminates its Digital Lines in the Home Country. All invoicing for the Global RingEX Services will be done in the Home Country on the Customer’s Account, together with other Services purchased under this Agreement, using the Home Country’s currency. Custom er must at all times provide a billing address located in the Home Country. RingCentral will provide all documentation, licenses, and services in connection with the Global RingEX Service in English; additional language support may be provided at RingCentral’s sole discretion.

C. Primary Place of Use of Global RingEX Service. Customer represents and warrants that the primary place of use of the Global RingEX Services will be the country in which the Digital Line is assigned, e.g., an End User with a Digital Line assigned in Ireland will primarily use that Digital Line in Ireland.

D. Relationships with Local Providers. In connection with the provision of Global RingEX Services, RingCentral relies on local providers to supply certain regulated communication services; for example (i) for the provision of local telephone numbers within local jurisdictions; (ii) to enable you to place local calls within local jurisdictions; and (iii) to enable you to receive calls from non- RingCentral numbers on Customer’s Global RingEX telephone number(s), by connecting with the local public switched telephone network. Customer hereby appoints RingCentral as Customer’s agent with power of attorney (and such appointment is coupled with an interest and is irrevocable during the Term) to c onclude and enter into agreements with such local providers on Customer’s behalf to secure such services. RingCentral’s locally licensed affiliates provide all telecommunications services offered to Customer within the countries in which such affiliates ar e licensed; in some cases, RingCentral may obtain services from locally licensed providers on Customer’s behalf. RingCentral is responsible for all contracting, billing, and customer c are related to those services. Customer is responsible for providing Rin gCentral with all information necessary for RingCentral to obtain numbers in Global RingEX countries.

18.A

Master Services Agreement Page 13 of 20

6. Additional Services. RingCentral offers add -on services for the Services (where available), which are described at https://www.ringcentral.com/legal/microsoft-teams-services-attachment.html. Additional terms or charges may apply, depending on the selected features.

7. Bring Your Own C arrier (BYOC) Services. RingCentral offers a software -as-a-service in which customers provide and maintain their own local telecommunications services, which may be connected to RingCentral's cloud PBX, videoconferencing, and team messaging services. BYOC and additional terms are described and available at https://www.ringcentral.com/legal/BYOC-service- description.html.

8. Definitions. Terms used herein but not otherwise defined ha ve the meanings ascribed to them in the Agreement. For purposes of this Service Attachment, the following terms have the meanings set forth below:

A. “Digital Line” means a phone number assigned to an End User or a specifically designated location (e.g., conf erence room) and the associated voice service for inbound and outbound calling that permits the End User generally to make and receive calls to and from the public switched telephone network as well as to and from other extensions within the same Account.

B. “End Point” means an application or device through which any End-User might access and/or use any of the Services, including without limitation IP Desk Phones, Desktop Clients, Web Clients, Mobile Applications, and Software Integrations.

C. “Extension-to-Extension Calls” means calls made and received between End Points on the Customer Account with RingCentral, regardless of whether the calls are domestic or international.

D. “External Calls” means calls made to or received from external numbers on the PSTN that a re not on the Customer Account with RingCentral.

E. “Home Country” means the United States or the country that is otherwise designated as Customer’s primary or home country in the Order Form.

18.A

Master Services Agreement Page 14 of 20

ATTACHMENT B

RINGCENTRAL SECURITY ADDENDUM

1. Scope
This document describes the Information Security Measures (“Measures”) that RingCentral has in place when processing Protected Data through RingCentral Services.

2. Definitions
For purposes of this Security Addendum only, capitalized terms, not otherwise defined herein, have the meaning set forth in the Agreement.

A. “Ring Central Services”, or “Services”, means services offered by RingCentral and acquired by the Customer.

B. “Customer” means the entity that entered into the Agreement with RingCentral.

C. “Protected Data ” means Customer and partner data processed by RingCentral Services, as defined in the applicable RingCentral DPA or Agreement, including “personal data” and “personal information” as defined by applicable privacy laws, confidential data as defined in the A greement, account data, configuration data, communication content including messages, voicemail, and video recording.

D. “Agreement” means the agreement in place between RingCentral and the Customer for the provision of the Services.

E. “Personnel” means RingCentral employees, contractors or subcontracted Professional Services staff.

3. Information Security Management
A. Security Program
RingCentral maintains a written information security program that:
i. Includes documented policies or standards appropriate to govern th e handling of Protected Data in compliance with the Agreement and with applicable law.
ii. Is managed by a senior employee responsible for overseeing and implementing the program. iii. Includes administrative, technical, and physical safeguards reasonably designed to protect the confidentiality, integrity, and availability of Protected Data.
iv. Is appropriate to the nature, size, and complexity of RingCentral’s business operations.

B. Security Policy Management
RingCentral’s security policies, standards, and procedures:
i. Align with information security established industry standards. ii. Are subject to ongoing review.
iii. May be revised to reflect changes in industry best practices.

C. Risk Management
RingCentral:
i. Performs cybersecurity risk assessments to identify threats to their business or operations at least annually. ii. Updates RingCentral policies, procedures and standards as needed to address threats to RingCentral’s business or operations.

4. Independent security assessments
A. External Audit
RingCentral:
i. Uses qualified independent third -party auditors to perform security audits covering systems, environments, and networks where Protected Data is processed, including
a. SOC2 Type II
b. IES/ISO 27001.
ii. maintains additional audits and compliance certifications as appropriate for RingCentral’s business and as identified at www.ringcentral.com/trust-center.html.

B. Distribution of Reports
Copies of relevant audit reports and certifications:
i. Will be provided to Customer on request.

18.A

Master Services Agreement Page 15 of 20

ii. Are subject to Non-Disclosure Agreement.

C. Annual Risk Assessment Questionnaire
Customer may, on one (1) occasion within any twelve (12) month period, request that RingCentral complete a third -party risk assessment questionnaire within a reasonable time frame.

In case of conflict between this section and the equivalent section in the RingCentral DPA, the DPA takes precedence.

5. Human Resource Security
A. Background Checks
RingCentral requires pre-employment screenings of all employees. RingCe ntral ensures criminal background searches on its employees to the extent permitted by law. Each background check in the US includes:
i. An identity verification (SSN trace).
ii. Criminal history checks for up to seven (7) years for felony and misdemeanors at the local, state, and federal level, where appropriate.
iii. Terrorist (OFAC) list search, as authorized by law.

Internationally, criminal history checks are conducted as authorized by local law.

Background checks are conducted by a member of the National Assoc iation of Professional Background Screeners or a competent industry-recognized company in the local jurisdiction.

B. Training
RingCentral will ensure that all employees including contractors:
i. Complete annual training to demonstrate familiarity with RingCentral’s security policies. ii. Complete annual training for security and privacy requirements, including CyberSecurity awareness, GDPR, and CCPA. iii. Have the reasonable skill and experience suitable for employment and placement in a position of trust within RingCentral.

C. Workstation Security
RingCentral ensures that:
i. RingCentral employees either use RingCentral owned and managed devices in the performance of their duties or Bring Your Own Device (BYOD) device.
ii. All devices, whether RingCentral owned and managed or Bring Your Own Device (BYOD) device, are enrolled in the full RingCentral managed device program.

D. Data Loss Prevention
RingCentral employs a comprehensive system to prevent the inadvertent or intentional compromise of RingCentral data and Protected Data.

E. Due Diligence Over Sub-Contractors
RingCentral will:
i. maintain a security process to conduct appropriate due diligence prior to engaging sub-contractors. ii. assess the security capabilities of any such sub-contractors on a periodic basis to ensure subcontractors’ ability to comply with the Measures described in this document.
iii. apply written information security requirements that oblige sub -contractors to adhere to RingCentral’s key information security policies and standards consistent with and no less protective than these Measures.

F. Non-Disclosure
RingCentral ensures that employees and contractors/sub-contractors who process Protected Data are bound in writing by obligations of confidentiality.

6. Physical Security
A. General
RingCentral:
i. Restricts access to, controls, and monitors all physical areas where RingCentral Services process Protected Data (“Secure Areas”).
ii. Maintains appropriate physical security controls on a 24-hours-per-day, 7-days-per-week basis (“24/7”).

18.A

Master Services Agreement Page 16 of 20

iii. Revokes any physical access to Secure Areas promptly after the cessation of the need to access buildings and system(s). iv. Performs review of access rights on at least an annual basis.

B. Access and Authorization Processes
RingCentral maintains a documented access authorization and logging process. The authorization and logging process will include at minimum:
i. Reports detailing all access to Secure Areas, including the identities and dates and times of access. ii. Reports to be maintained for at least one year as allowed by law. iii. Video surveillance equipment to monitor and record activity at all Secure Areas entry and exit points on a 24/7 basis to the extent permitted by applicable laws and regulations.
iv. Video recording to be maintained for at least 30 days or per physical location provider’s policies.

C. Data Centers
To the extent that RingCentral is operating or using a data center, RingCentral ensures that physical security controls are i n alignment with industry standards such as ISO 27001 and SSAE 16 or ISAE 3402 or similar standard including:
i. Perimeter security including fencing/barriers and video surveillance. ii. Secure access including security guard/reception.
iii. Interior access controlled through RFID cards, 2FA, anti-tailgating controls. iv. Redundant utility feeds and support for continuous delivery through backup systems. v. Redundant network connection from multiple providers.

7. Logical Security
A. User Identification and Authentication
RingCentral:
i. Maintains a documented user management lifecycle management process that includes manual and/or automated processes for approved account creation, account removal and account modification for all Information Resources and across all environments.
ii. Ensures that RingCentral users have an individual accounts for unique traceability. iii. Ensures that RingCentral users do not use shared accounts; where shared accounts are technically required controls are in place to ensure traceability.
iv. RingCentral user passwords are configured aligned with current NIST guidance.

For the customer facing applications, Customers may choose to integrate with SSO (Single Sign on) so that Customer retains control over their required password settings including Customer’s existing MFA/2FA solutions.

B. User Authorization and Access Control
RingCentral:
i. Configures remote access to all network s storing or transmitting Protected Data to require multi -factor authentication for such access.
ii. Revokes access to systems and applications that contain or process Protected Data promptly after the cessation of the need to access the system(s) or application(s).
iii. Has the capability of detecting, logging, and reporting access to the system and network or attempts to breach security of the system or network.

RingCentral employs access control mechanisms that are intended to:
i. Limit access to Protected Data to o nly those Personnel who have a reasonable need to access said data to enable RingCentral to perform its obligations under the Agreement. ii. Prevent unauthorized access to Protected Data.
iii. Limit access to users who have a business need to know. iv. Follow the principle of least privilege, allowing access to only the information and resources that are necessary. v. Perform review access controls on a minimum annual basis for all RingCentral’s systems that transmit, process, or store Protected Data.

18.A

Master Services Agreement Page 17 of 20

8. Telecommunication and Network Security
A. Network Management
RingCentral:
i. Maintains network security program that includes industry standard firewall protection and two -factor authentication for access to RingCentral’s networks.
ii. Deploys an Intrusion Detection Systems (IDS) and/or Intrusion Prevention Systems (IPS) to generate, monitor, and respond to alerts which could indicate potential compromise of the network and/or host. iii. Monitors web traffic from the Internet and from internal sources to detect cyber -attacks including Distrib uted Denial of Service (DDoS) attacks against web sites / services and to block malicious traffic.

B. Network Segmentation
RingCentral:
i. Implements network segmentation between the corporate enterprise network and hosting facilities for Services. ii. Ensures separation between environments dedicated to development, staging, and production. iii. Restricts access between environments to authorized devices. iv. Controls configuration and management of network segregation and firewall rules through a formal request and approval process.

C. Network Vulnerability Scanning
RingCentral:
i. Runs internal and external network vulnerability scans against information processing systems at least quarterly. ii. Evaluates findings based on (where applicable) CVSS score and assessment of impact, likelihood, and severity. iii. Remediates findings following industry standard timelines.

9. Operations Security
A. Asset Management
RingCentral:
i. Maintains an accurate and current asset register covering hardware and software assets used for the delivery of services. ii. Maintains accountability of assets throughout their lifecycle. iii. Maintains processes to wipe or physically destroy physical assets prior to their disposal.

B. Configuration Management
RingCentral:
i. Maintains baseline configurations of information systems and applications based on industry best practices including:
a. Removal of all vendor-provided passwords.
b. Remove/disable unused services and settings.
c. Anti-malware/endpoint protection as technically feasible. ii. Enforces security configuration settings for systems used in the provision of the Services. iii. Ensures that clocks of all information processing systems are synchronized to one of more reference time sources.

C. Malicious Code Protection
i. To the extent practicable, RingCentral has endpoint protection in place, in the f orm of Endpoint Detection and Response (EDR) and/or antivirus software, installed and running on servers and workstations. ii. EDR alerts are monitored, and immediate action is taken to investigate and remediate any abnormal behavior. iii. Where used, antivirus software will be current and running to scan for and promptly remove or quarantine viruses and other malware on Windows servers and workstations.

D. Vulnerability, Security Patching
RingCentral:
i. Monitors for publicly disclosed vulnerabilities and exposures for impact to Supplier’s information systems and products.

18.A

Master Services Agreement Page 18 of 20

ii. Ensures quality assurance testing of patches prior to deployment. iii. Ensures that all findings resulting from network vulnerability scanning and relevant publicly disclosed vulnerabilities and exposures are remediated according to industry best practices, including CVSS score and assessment of impact, likelihood and severity and are remediated following industry standard timelines.

E. Logging and Monitoring
RingCentral shall ensure that:
i. All systems, devices or applications associated with the access, processing, storage, communication and/or transmission of Protected Data, generate audit logs.
ii. Access to Protected Data is logged.
iii. Logs include sufficient detail that they can be used to detect significant unauthorized activity. iv. Logs are protected against unauthorized access, modification, and deletion. v. Logs are sent to a centralized location for aggregation and monitoring.

10. Software Development and Maintenance
A. Secure Development Lifecycle
RingCentral:
i. Applies secure development lifecycle practices, including, during design, development, and test cycles. ii. Ensures that products are subject to security design review including threat considerations and data handling practices. iii. Ensures that Services are subject to a secure release review prior to promotion to production.

B. Security Testing
As part of the secure development lifecycle, RingCentral:
i. Performs rigorous security testing, including, as technically feasible:
a. static code analysis.
b. source code peer reviews.
c. dynamic and interactive security testing.
d. security logic, or security “QA” testing.
ii. Ensures that Internet -facing applications are subject to application security assessment reviews and testing to identify common security vulnerabilities as identified by in dustry-recognized organizations (e.g., OWASP Top 10 Vulnerabilities, CWE/SANS Top 25 vulnerabilities).
iii. For all mobile applications (i.e. running on Android, Blackberry, iOS, Windows Phone) that collect, transmit or display Protected Data, conducts an appli cation security assessment review to identify and remediate industry -recognized vulnerabilities specific to mobile applications.
iv. Does NOT use Protected Data for testing.
v. Makes all reasonable effort to identify and remediate software vulnerabilities prior to release.

C. Annual Penetration Testing
RingCentral:
i. Engages qualified, independent third-party penetration testers to perform annual penetration test against its Products and environments where Protected Data is hosted.
ii. Requires sub-processors to perform similar penetration testing against their systems, environments, and networks. iii. Ensures remediation of all findings in a commercially reasonable period of time.

D. Product Vulnerability Management
RingCentral:
i. Uses commercially reasonable efforts to regularly identify software security vulnerabilities in RingCentral Services. ii. Provides relevant updates, upgrades, and bug fixes for known software security vulnerabilities, for any software provided or in which any Protected Data is processed.

18.A

Master Services Agreement Page 19 of 20

iii. Ensures that all find ings resulting from internal and external testing are evaluated according to industry best practices, including CVSS score and assessment of impact, likelihood and severity and are remediated following industry standard timelines.

E. Open Source and Third-Party Software
RingCentral:
i. Maintains an asset registry of all third-party software (TPS) and open-source software (OSS) incorporated into the Services. ii. Uses commercially reasonable efforts to ensure the secure development and security of open -source software and third- party software used by RingCentral.
iii. Uses commercially reasonable efforts to evaluate, track and remediate vulnerabilities of open -source software (OSS) and other third-party libraries that are incorporated into the Services.

11. Data Handling
A. Data Classification
RingCentral maintains data classification standards including:
i. Public data, data that is generally available or expected to be known to the public. ii. Confidential data, data that is not available to the general public.

Protected Data is classified as RingCentral Confidential Data.

B. Data Segregation
RingCentral:
i. Ensures physical or logical segregation of Protected Data from other customers’ data. ii. Ensures physical separation and access control to segregate Protected Data from RingCentral data.

C. Encryption of Data
RingCentral:
i. Shall ensure encryption of Protected Data in electronic form in transit over all public wired networks (e.g., Internet) and a ll wireless networks (excluding communication over Public Switch Telephone Networks). ii. Excepting the Engage Communities feature of Engage Digital, shall ensure encryption of Protected Data in electronic form when stored at rest.
iii. Uses industry standard encryption algorithms and key strengths to encrypt Protected Data in transit over all public wired networks (e.g., Internet) and all wireless networks.

D. Destruction of Data
RingCentral shall:
i. Ensure the secure deletion of data when it is no longer required. ii. Ensure that electronic media that has been used in the delivery of Services to the Customer will be sanitized before disposal or repurposing, using a process that assures data deletion and prevents data from being reconstructed or read. iii. Destroy any equipment containing Protected Data that is damaged or non-functional.

12. Incident Response
RingCentral’s incident response capability is designed to comply with statutory and regulatory obligations governing incident response. As such, RingCentral:

A. Maintains an incident response capability to respond to events potentially impacting the confidentiality, integrity and/or availability of Services and/or data including Protected Data.

B. Has a documented incident response plan based on industry best practices.

C. Has a process for evidence handling that safeguards the integrity of evidence collected to including allow ing detection of unauthorized access to.

D. Will take appropriate steps and measures to comply with statutory and regulatory obligations governing incident response.

When RingCentral learns of or discovers a security event which impacts Protected Data, Ring Central will notify Customer without undue delay and will take commercially reasonable steps to isolate, mitigate, and/or remediate such event.

18.A

Master Services Agreement Page 20 of 20

13. Business Continuity and Disaster Recovery
A. Business Continuity
RingCentral:
i. Ensures that responsibilities for service continuity are clearly defined and documented and have been allocated to an individual with sufficient authority.
ii. Has a business continuity plan (BCP) in place designed to provide ongoing provision of the Services to Customer. iii. Develops, implements, and maintains a business continuity management program to address the needs of the business and Services provided to the Customer. To that end, RingCentral completes a minimum level of business impact analysis, crisis management, business continuity, and disaster recovery planning. iv. Ensures that the scope of the BCP encompasses all relevant locations, personnel and information systems used to provide the Services.
v. Ensure that its BCP includes, but is not limited to, elements such location workarounds, appl ication workarounds, vendor workarounds, and staffing workarounds, exercised at minimum annually. vi. Reviews, updates, and tests the BCP at least annually.

B. Disaster Recovery
RingCentral:
i. Maintains a disaster recovery plan, which includes, but is not limited to, infrastructure, technology, and system(s) details, recovery activities, and identifies the people/teams required for such recovery, exercised at least annually. ii. Ensures that the disaster recovery plan addresses actions that RingCentral will take in the event of an extended outage of service.
iii. Ensures that its plans address the actions and resources required to provide for (i) the continuous operation of RingCentral, and (ii) in the event of an interruption, the recovery of the functions required to enable RingCentral to provide the Services, including required systems, hardware, software, resources, personnel, and data supporting these functions.

18.A

00091740.2

PROFESSIONAL SERVICES AGREEMENT

BY AND BETWEEN

THE CITY OF HEMET

A CALIFORNIA MUNICIPAL CORPORATION

AND

ICS INTELESYS, INC. DBA INTELESYS

A CALIFORNIA CORPORATION

AGREEMENT # 2024-083

18.A

00091740.2 Page | 1

PROFESSIONAL SERVICES AGREEMENT

FOR HOSTED TELEPHONE SYSTEM INTEGRATION AND INSTALLATION BETWEEN THE CITY OF HEMET AND ICS INTELESYS, INC. DBA INTELESYS THIS PROFESSIONAL SERVICES AGREEMENT (“Agreement”) is made and entered into this 11th day of June, 2024 (“Effective Date”), by and between the CITY OF HEMET (“City”), a California municipal corporation and ICS Intelesys, Inc. dba Intelesys, a California corporation (“Consultant”). For the purposes of this Agreement City and Consultant are sometimes hereinafter referred to as “Party” and hereinafter collectively ref erred to as the “Parties.”

RECITALS

1. City has sought by Request for Proposal to provide phone system integration and installation defined and described particularly in Section 2, “Scope of Services and Schedule of Performance” of this Agreement.

2. Consultant was selected by City to perform those services.

3. Consultant was selected by City on the basis of Consultant’s demonstrated competence and the professional qualifications necessary for the satisfactory performance of the services required.

4. City has auth ority to enter into this Agreement and the City Manager has authority to execute this Agreement.

5. The Parties desire to formalize the selection of Consultant for performance of those services defined and described particularly in Section 2 “Scope of Services” of this Agreement and desire that the terms of that performance be as particularly defined and described herein.

O

PERATIVE PROVISIONS
NOW, THEREFORE, for and in consideration of the mutual promises and covenants made by the Parties and contained herein and other consideration, the value and adequacy of which are hereby acknowledged, the Parties agree as follows:

S
ECTION 1. T ERM OF AGREEMENT
(
a) Subject to the provisions of Section 21 "Termination of Agreement" of this Agreement, the Term of this Agreement is through June 30, 2025, commencing on the Effective Date, unless otherwise extended by written agreement of the Parties. (b
) The City Manager may, in his or her sole discretion, unilaterally exercise an option to extend the Agreement on a month-to-month basis following expiration on the same terms and conditions, including compensation as set forth in Section 4 “Compensation.”

18.A

00091740.2 Page | 2

(c) Consultant acknowledges that the Agreement term may extend over multiple City fiscal years, and that the work and compensation under this Agreement is contingent on the City Council appropriating funding for and authorizing such work and compensation for those fiscal years. This Agreement may be terminated by the City Manager at the end of a fiscal year when sufficient funding is not appropriated and authorized for the subsequent fiscal year. City is not obligated to pay Consultant for any amounts not duly appropriated and authorized by the City Council.

SECTION 2. SCOPE OF SERVICES

Subject to this Agreemen t, all addendums and exhibits attached and incorporated hereto, Consultant agrees to perform the services and tasks set forth in Exhibit “A,” “Scope of Services” (hereinafter, the “Services”), and the City agrees to retain and does hereby retain Consultant for the Services.

SECTION 3. ADDITIONAL SERVICES

Consultant shall not be compensated for any work rendered in connection with its performance of this Agreement that is in addition to or outside of the Services unless such additional services are authorized in advance and in writing in accordance with Section 25 “Administration and Implementation” or Section 27 “Amendment” of this Agreement. If and when such additional work is authorized, such additional work shall be deemed to be part of the Services.

S
ECTION 4. COMPENSATION

(a) Subject to any limitations set forth in this Agreement, City agrees to pay Con sultant the amounts specified in Exhibit “B” “Compensation” and made a part of this Agreement by this reference. The total compensation, including reimbursement for actual expenses, shall not exceed Forty -Six Thousand Three Hundred and Twenty -Five Dollars ($46,325.00) (“Not to Exceed Amount”) unless additional compensation is approved in writing in accordance with Section 2 5 “Administration and Implementation” or Section 27 “Amendment” of this Agreement.

(b) All City vendors and consultants receiving ne w contracts, contract renewals, or contract extensions must sign up to receive electronic payments through the City's Automated Clearing House (ACH) payments service/provider. Electronic payments are processed bi - weekly and are safe and secure. To enroll i n ACH electronic payments contact [email protected].

18.A

00091740.2 Page | 3

(c) Payment to Consultant for work performed pursuant to this Agreement shall not be deemed to waive any defects in work performed by Consultant.

(d) If this Agreement is extended pursuant to Section 1 “Term of Agreement,” the City shall pay the same rates specified in Exhibit “B” “Compensation.” SECTION 5. METHOD OF PAYMENT AND INVOICING

(a) Payment shall be made in accordance with City’s usual accounting procedures upon receipt and approval of an itemized invoice setting forth the services performed. The invoices shall be emailed to [email protected]. Under no circumstances shall the total amount paid to Consultant under this Agreement exceed the City Manager’s authority without approval by the City Council.

(b) Consultant shall submit within 30 days of the end of each month a complete and accurate written itemized invoice for services performed and /or goods provided. The invoice must be in a format approved by City. In order to receive payment, Consultant shall submit to City an itemized invoice, on a monthly basis, for services performed pursuant to this Agreement. Each itemized invoice shall ident ify at the top of the first page, the Not to Exceed Amount (as set by Section 4(a) above), the total amount billed to date, the services rendered during the billing period, and the amount due for the statement invoice for which reimbursement is sought in t he statement invoice. The invoice shall detail charges by the following categories: labor (by sub- category), travel, materials, equipment, supplies, and sub consultant contracts. Sub consultant charges shall be detailed by the following categories: labor, travel, materials, equipment and supplies. If the compensation set forth in Section 4(a) and Exhibit “B” include payment of labor on an hourly basis (as opposed to labor and materials being paid as a lump sum), the labor category in each invoice shall include detailed descriptions of tasks performed and the amount of time incurred for or allocated to that task. City shall independently review each invoice submitted by the Consultant to determine whether the work performed and expenses incurred are in compliance with the provisions of this Agreement. In the event that no charges or expenses are disputed, the invoice shall be approved and paid according to the terms set forth in subsection (c). In the event any charges or expenses are disputed by City, the original invoice shall be returned by City to Consultant for correction and resubmission.

(c) Except as to any charges for work performed or expenses incurred by Co nsultant which are disputed by City, City will use its best efforts to cause Co nsultant to be paid within forty-five (45) days of receipt of Consultant’s correct and undisputed invoice.

(d) The Parties estimate that performance of this Agreement will be accomplished without an increase in the Not to Exceed Amount. Consultant shall notify the City in writing whenever it has reason to believe that the costs the Consultant expects to incur under this Agreement in the following sixty (60) days, when added to all costs previously incurred, will exceed eighty percent (80%) of the N ot to Exceed Amount specified herein. As part of the

18.A

00091740.2 Page | 4

notification, the Consultant shall provide the City with a revised estimate of the total cost of performing this Agreement.

SECTION 6. INSPECTION AND FINAL ACCEPTANCE

City may inspect and accept or reject any of Co nsultant’s work under this Agreement, either during performance or when completed. City shall reject or finally accept Consultant’s work within sixty (60) days after submitted to City. City shall reject work by a timely written explanation, ot herwise, Consultant’s work shall be deemed to have been accepted. City’s acceptance shall be conclusive as to such work except with respect to latent defects, fraud , and such gross mistakes as amount to fraud. Acceptance of any of Consultant’s work by City shall not constitute a waiver of any of the provisions of this Agreement including, but not limited to, Section 17 “Indemnification” and Section 18 “Insurance.”

S
ECTION 7. OWNERSHIP OF DOCUMENTS

All original maps, models, designs, drawings, photographs, studies, surveys, reports, data, notes, computer files, files and other documents prepared, developed, or discovered by Consultant in the course of providing the Services pursuant to this Agreement shall become the sole property of City and ma y be used, reused or otherwise disposed of by City without the permission of the Consultant. Upon completion, expiration, or termination of this Agreement, Consultant shall turn over to City all such original maps, models, designs, drawings, photographs, studies, surveys, reports, data, notes, computer files, files, and other documents.

If and to the extent that City utilizes for any purpose not related to this Agreement any maps, models, designs, drawings, photographs, studies, surveys, reports, data, not es, computer files, files, or other documents prepared, developed, or discovered by Consultant in the course of providing the Services pursuant to this Agreement, Consultant ’s guarantees and warranties in Section 11 “Standard of Performance” of this Agreement shall not extend to such use of the maps, models, designs, drawings, photographs, studies, surveys, reports, data, notes, computer files, files or other documents.

S
ECTION 8. INTELLECTUAL PROPERTY RIGHTS ASSIGNMENT

For no additional compensation, Consultant hereby assigns to City all of Consultant’s rights, title, and interest in and to the content of all deliverable materials created by Consultant or its employees, agents, or sub consultants , including copyrights, i n connection with the Services performed under this Agreement. Consultant shall promptly execute and deliver and shall cause its employees, agents, and sub consultants to promptly execute and deliver, upon request by the City or any of its successors or assigns at any time and without further compensation of any kind, any power of attorney, assignment, application for copyright, patent, trademark or other intellectual property right protection, or other papers or instruments which may be necessary or desirable to fully secure, perfect or otherwise protect to or for the City, its successors, and assigns, all right, title and interest in and to the content of the deliverable materials. For purposes of this

18.A

00091740.2 Page | 5

section deliverable materials include all works, tangible or not, created under this Agreement including, without limitation, documents, material, data, reports, manuals, specifications, artwork, drawings, sketches, computer programs and databases, schematics, photographs, video and audiovisual recordings, sound recordings, marks, logos, graphic designs, notes, website, domain names, inventions, processes, formulas matters and combinations thereof, and all forms of intellectual property. The provisions of this paragraph are binding on the successors, assigns and heirs of Consultant and shall survive the termination of Consultant’s Services under this Agreement.

S
ECTION 9. CONSULTANT’S BOOKS AND RECORDS

(a) Consultant shall maintain any and all documents and records demonstrating or relating to Consultant’s performance of the Services. Consultant shall maintain any and all ledgers, books of account, invoices, vouchers, canceled checks, or other documents or records evidencing or relating to work, services, expenditures, and disbursements charged to City pursuant to this Agreement. Any and all such documents or records shall be maintained in accordance with generally accepted accounting principles and shall be sufficiently complete and detailed so as to permit an accurate evaluation of the Se rvices provided by Consultant pursuant to this Agreement. Any and all such documents or records shall be maintained for three (3) years from the date of execution of this Agreement and to the extent required by laws relating to audits of public agencies and their expenditures.

(b) Any and all records or documents required to be maintained pursuant to this section shall be made available for inspection, audit , and copying, at any time during regular business hours, upon request by City or its designated representative. Copies of such documents or records shall be provided directly to the City for inspection, audit and copying when it is practical to do so; otherwise, unless an alternative is mutually agreed upon, such documents and records shall be made available at Consultant’s address indicated for receipt of notices, “Section 23,” of this Agreement.

(c) Where City has reason to believe that any of the documents or records required to be maintained pursuant to this section may be lost or discarded due to dissolution or termination of Consultant’s business, City may, by written request, require that custody of such documents or records be given to the City. Access to such documents and records shall be granted to City, as well as to its successors in interest and authorized representatives.

S
ECTION 10. INDEPENDENT CONTRACTOR

(a) Consultant is and shall at all times remain a wholly independent contractor and not an officer, employee, or agent of City. Consultant shall have no authority to bind City in any manner, nor to incur any obligation, debt , or liability of any kind on behalf of or against City, whether by contract or otherwise, unless such authority is expressly conferred under

18.A

00091740.2 Page | 6

this Agreement or is otherwise expressly conferred in writing by City.

(b) The personnel performing the Services under this Agreement on behalf of Consultant shall at all times be under Consultant ’s exclusive direction and control. Neither City, nor any elected or appointed boards, officers, officials, employees or agents of City, shall have control over the conduct of Consultant or any of Consultant ’s officers, employees, sub consultants or agents except as set forth in this Agreement. Consultant shall not at any time or in any manner represent that Consultant or any of Consultant’s officers, employees, or agents are in any manner officials, officers, employees or agents of City.

(c) Neither Consultant, nor any of Consultant’s officers, employees or agents, shall obtain any rights to retirement, health care or any other benefits which may otherwise accrue to City’s employees. Consultant expressly waives any claim C onsultant may have to any such rights.

S
ECTION 11. STANDARD OF PERFORMANCE

Consultant represents and warrants that it has the qualifications, experience, and facilities necessary to properly perform the Services required under this Agreement in a thorough, competent, and professional manner. Consultant shall at all times faithfully, competently, and to the best of its ability, experience, and talent, perform all Services. In meeting its obligations under this Agreement, Consultant shall employ, at a minimum, generally accepted standards and practices utilized by persons engaged in providing services similar to the Services required of Consultant under thi s Agreement, and shall use such skill, prudence, and diligence as other members of Consultant’s profession commonly possess and exercise. In addition to the general standards of performance set forth in this section, additional specific standards of performance and performance criteria may be set forth in Exhibit “A” “Scope of Services ” that shall also be applicable to Consultant’s work under this Agreement. Where there is a conflict between a general and a specific standard of performance or performance criteria, the specific standard or criteria shall prevail over the general.

S
ECTION 12. COMPLIANCE WITH APPLICABLE LAWS; PERMITS AND LICENSES

Consultant shall keep itself informed of and comply with all applicable federal, state , and local laws, statute s, codes, ordinances, regulations , and rules in effect during the term of this Agreement. Consultant shall at all times observe and comply with all such laws, ordinances , and regulations, and shall be solely responsible for any failure to comply with all applicable laws, ordinances, and regulations. Consultant represents and warrants that Consultant has obtained or shall promptly obtain all necessary licenses to perform th e Services set forth in this Agreement and that such licenses are in good standing, including but not limited to obtaining a City business license. Consultant further represents and warrants that the services provided herein shall conform to all ordinances , policies, and practices of the City. Neither City nor any elected or appointed

18.A

00091740.2 Page | 7

boards, officers, officials, employees or agents of City, shall be liable, at law or in equity, as a result of any failure of Consultant to comply with this section.

SECTION 13. PREVAILING WAGE LAWS

Consultant is aware of the requirements of California Labor Code Section 1720, et seq., and 1770, et seq., as well as California Code of Regulations, Title 8, Section 16000, et seq., (“Prevailing Wage Laws”), which require the pay ment of prevailing wage rates and the performance of other requirements on certain “public works” and “maintenance” projects. To the extent applicable, Consultant shall defend, indemnify, and hold the City, its elected officials, officers, employees, and a gents free and harmless f rom any claim or liability arising out of any failure or alleged failure of Consultant to comply with the Prevailing Wage Laws.

S
ECTION 14. NONDISCRIMINATION

Consultant and subconsultants shall not unlawfully discriminate, harass , or allow harassment against any person because of sex, sexual orientation, gender, gender identity, gender expression, reproductive health decision- making, race, color, religious creed, marital status, ancestry, national origin, medical condition, geneti c information, age, disability (mental and physical), or military or veteran status in connection with or related to the performance of this Agreement. Consultant and subconsultants shall comply with the provisions of the Fair Employment and Housing Act (G ov. Code, § 12900 et seq.) and the applicable regulations promulgated thereunder (Cal. Code of Regs, tit. 2, § 7285.0 et seq.). The applicable regulations of the Fair Employment and Housing Commission implementing Government Code, § 12990 (a)- (f), are incorporated into this Agreement by reference and made a part hereof as set for in full (Cal.

Code of Regs, tit. 2, § 7285.0, et seq.). Consultant shall include the non- discrimination and compliance provisions of this section in all subcontracts to perform work under this Agreement.

S
ECTION 15. CONFLICTS OF INTEREST

(a) Consultant covenants that neither it nor any officer or principal of its firm, has or shall acquire any interest, directly or indirectly, which would conflict in any manner with the interests of City or which would in any way hinder Consultant ’s performance of the Services. Consultant further covenants that in the performance of this Agreement, no person having any such interest shall be employed by it as an officer, employee, agent or subcontractor without the express written consent of the City Manager. Consultant agrees to at all times avoid conflicts of interest or the appearance of any conflicts of interest with the interests of City in the performance of this Agreement. (b) City understands and acknowledges that Consultant is, as of the date of execution of this Agreement, independently involved in the performance of non- related services for other governmental agencies and private parties. Consultant is unaware of any stated position of

18.A

00091740.2 Page | 8

City relative to such projects. Any future position of City on such projects shall not be considered a conflict of interest for the purposes of this section. (c) City understands and acknowledges that Consultant will, perform non-related services for other governmental agencies and private parties following the completion of the Services under this Agreement. Any such future service shall not be considered a conflict of interest for purposes of this section.

S
ECTION 16. CONFIDENTIAL INFORMATION; RELEASE OF INFORMATION

(a) All information gained or work product produced by Consultant in per formance of this Agreement shall be considered confidential unless such information is in the public domain or already known to Consultant. Consultant shall not release or disclose any such information or work product to persons or entities other than Cit y without prior written authorization from the City Manager, except as may be required by law.

(b) Consultant, its officers, employees, agents , or sub consultants , shall not, without prior written authorization from the City Manager or unless requested by the City Attorney of City, voluntarily provide declarations, letters of support, testimony at depositions, response to interrogatories or other information concer ning the work performed under this Agreement. Response to a subpoena or court order shall not be considered "voluntary" provided Consultant gives City notice of such court order or subpoena.

(c) If Consultant, or any officer, employee, agent , or sub consultant of Consultant, provides any information or work product in violation of this Agreement, then City shall have the right to reimbursement and indemnity from Consultant for any damages, costs , and fees, including attorney’s fees, caused by or incurred as a result of Consultant’s conduct.

(d) Consultant shall promptly notify City should Consultant , its officers, employees, agents , or sub consultants be served with any summons, complaint, subpoena, notice of deposition, request for documents, interrogatories, request for admiss ions or other discovery request, court order or subpoena from any party regarding this Agreement and the work performed thereunder. City retains the right but has no obligation, to represent Consultant or be present at any deposition, hearing , or similar proceeding. Consultant agrees to cooperate fully with City and to provide City with the opportunity to review any response to discovery requests provided by Consultant . However, this right to review any such response does not imply or mean the right of City to control, direct, or rewrite said response.

S
ECTION 17. INDEMNIFICATION

(a) To the fullest extent permitted by law, Consultant shall indemnify, protect, defend (with legal counsel reasonably selected by the City) and hold harmless City and any and all of its elected and appointed officials, officers, employees, representatives and agents

18.A

00091740.2 Page | 9

(“Indemnified Parties”) from and against any and all claims, actions and proceedings (whether at law or equity, administrative or judicial), demands, orders, judgments, losses, injuries (including, without limitation, injury to or death of an employee of Consultant or sub consultants ), liabilities of every kind (including, without limitation, incidental and consequential damages, court costs, and litigation expenses, and fees of expert consultants or expert witnesses incurred in connection therewith and cost of investigation) , damages, costs and expenses, including attorney’s fees and costs, (collectively "Claims") that arise out of, pertain to, or relate to, directly or indirectly, in whole or in part, performance of Services by Consultant, its officers, agents, employees , representatives, sub consultants , anyone directly or indirectly employed by any of them, or anyone that they c ontrol.

Consultant’s duty to indemnify, protect, defend, and hold harmless Indemnified Parties, shall not include any Claims arising from the sole negligence or willful misconduct of the Indemnified Parties.

(b) Consultant agrees to obtain executed indemnity agreements with provisions identical to those set forth here in this section from each and every sub consultant , subcontractor, or any other person or entity involved by, for, with, or on behalf of Consultant in the performance of this Agreement naming the Indemnified Parties as additional indemnitees.

In the event Consultant fails to obtain such indemnity obligations from others as required here, Consultant agrees to be fully responsible according to the terms of this section.

Failure of City to monitor compliance with these requirements imposes no additional obligations on City and will in no way act as a waiver of any rights hereunder. This obligation to indemnify and defend City as set forth herein is binding on the successors, assigns, or heirs of Consultant and shall survive the termination of this Agreement and this section.

S
ECTION 18. INSURANCE

Consultant agrees to obtain and maintain in full forc e and effect during the T erm of this Agreement the insurance policies set forth in Exhibit “C” “Insurance” and made a part of this Agreement. All insurance policies shall be subject to approval by City as to form and content.

These requirements are subject to amendment or waiver if so approved in writing by the City Manager. Consultant agrees to provide City with copies of required policies upon request.

S
ECTION 19. ASSIGNMENT

The expertise and experience of Consultant are material considerations for this Agreement.

City has an interest in the qualifications and capability of the persons and entities who will fulfill the duties and obligations imposed upon Consultant under this Agreement. In recognition of that interest, Consultant shall not assign or transfer this Agreement or any portion of this Agreement or the performance of any of Consultant’s duties or obligations under this Agreement without the prior written consent of the City , which may be given in the sole and absolute discretion of the City Manager. Any attempted assignment shall be ineffective, null, and void, and shall constitute

18.A

00091740.2 Page | 10

a material breach of this Agreement entitling City to any and all remedies at law or in equity, including termination of this Agreement pursuant to Section 21 “Termination of Agreement.” City acknowledges, however, that Consultant , in the performance of its duties pursuant to this Agreement, may utilize sub consultants.

If in the performance of its duties Consultant utilizes sub consultants or subcontractors, Consultant covenants that subcontracts, if any, shall contain a provision making sub consultants or subcontractors subject to all provisions stipulated in this Agreement, including without limitation, the insurance obligations set for th in Section 18 “Insurance.” The Consultant acknowledges and agrees that the City is an intended beneficiary of any work performed by any sub c onsultant or subcontractor for purposes of establishing a duty of care between any sub consultant or subcontractor and the City.

SECTION 20. CONTINUITY OF PERSONNEL

Consultant shall make every reasonable effort to maintain the stability and continuity of Consultant’s staff and subcontractors / sub consultants, if any, assigned to perform the Servic es.

Consultant shall notify City of any changes in Consultant’s staff and subcontractors/ sub consultants, if any, assigned to perform the Services prior to and during any such performance.

SECTION 21. TERMINATION OF AGREEMENT

(a) City may terminate this Agreement in its sole and absolute discretion, with or without cause, at any time by giving written notice of termination to Consultant. In the event such notice is given, Consultant shall cease immediately all work in progress.

(b) Consultant may terminate this Agreement for cause at any time upon thirty (30) days written notice of termination to City.

(c) If either Consultant or City fail to perform any material obligation under this Agreement, then, in addition to any other remedies, either Consultant, or Cit y may terminate this Agreement immediately upon written notice.

(d) Upon termination of this Agreement by either Consultant or City, all property belonging exclusively to City which is in Consultant’s possession shall be returned to City. Consultant shall fur nish to City a final invoice for work performed and expenses incurred by Consultant, prepared as set forth in Section 5 “Method of Payment and Invoicing” of this Agreement. This final invoice shall be reviewed and paid in the same manner as set forth in Section 5 “Method of Payment and Invoicing” of this Agreement.

(e) Upon written notice, City may suspend all or any portion of Consultant’s performance under this Agreement at its sole option and for its convenience for a reasonable period of time not to excee d six (6) months. City will pay to Consultant a sum equivalent to the reasonable value of the services satisfactorily provided up to the date of suspension. City

18.A

00091740.2 Page | 11

may rescind the suspension prior to or at six (6) months by providing Consultant with written notice of the rescission, at which time Consultant would be required to resume performance in compliance with the terms and provisions of this Agreement. Consultant will be entitled to an extension of time to complete performance under this Agreement equal to the length of the suspension unless otherwise agreed to in writing by the Parties.

SECTION 22. EXCUSABLE DELAYS

Neither Party shall be liable for damages, including liquidated damages, if any, caused by delay in performance or failure to perform due to causes beyond the control of either Party. Such causes include, but are not limited to, acts of God, acts of the public enemy, a cts of federal, state or local governments, acts of City, court orders, fires, floods, epidemics, strikes, embargoes, and unusually severe weather. The term and price of this Agreement shall be equitably adjusted for any delays due to such causes.

S
ECTION 23. NOTICES.

All notices required or permitted to be given under this Agreement shall be in writing and shall be personally delivered, or sent by telecopier or certified mail, postage prepaid and return receipt requested, addressed as follows:

To City: City of Hemet
Attn: City Manager
445 E. Florida Ave.

Hemet, CA 92543

To Consultant: ICS Intelesys, Inc. dba Intelesys
Attn: Richard Balzer
3155 Sedona Court Bldg B
Ontario, CA 91764

Notice shall be deemed effective on the date personally delivered or transmitted by facsimile or, if mailed, three (3) days after deposit of the same in the custody of the United States Postal Service.

SECTION 24. AUTHORITY TO EXECUTE.

The person or persons executing this Agreement on behalf of Co nsultant represents and warrants that he/she/they has/have the authority to so execute this Agreement and to bind Consultant to the performance of its obligations hereunder.

18.A

00091740.2 Page | 12

SECTION 25. ADMINISTRATION AND IMPLEMENTATION.

This Agreement shall be administered and executed by the City Manager or his or her designated representative. The City Manager shall have the authority to issue interpretations and to make amendments to this Agreement, including amendments that commit additional funds, consistent with Section 27 “Amendment” and the City Manager’s contracting authority under the Hemet Municipal Code.

S
ECTION 26. BINDING EFFECT.

This Agreement shall be binding upon the heirs, executors, administrators, successors and assigns of the Parties.

S
ECTION 27. AMENDMENT.

No amendment to or modification of this Agreement shall be valid unless made in writing and approved by Consultant and by City. The City Manager shall have the authority to approve any amendment to this Agreement if the total compensation under this Agreement, as amended, would not exceed the City Manager’s contracting authority. All other amendments shall be approved by the City Council. The Parties agree that the requirement for written modifications cannot be waived and that any attempted waiver shall be void.

S
ECTION 28. WAIVER.

Waiver by any Party to this Agreement of any term, condition, or covenant of this Agreement shall not constitute a waiver of any other term, condition, or covenant. Waiver by any Party of any breach of the provisions of this Agreement shall not constitute a waiver of any other provision nor a waiver of any subsequent breach or violation of any provision of this Agreement.

Acceptance by City of any work or services by Consultant shall not constitute a waiver of any of the provisions of this Agreement.

S
ECTION 29. LAW TO GOVERN; VENUE.

This Agreement shall be interpreted, construed and governed according to the laws of the State of California. In the event of litigation between the Parties, venue in state trial courts shall lie exclusively in the County of Riverside, California. In the event of litigation in a U.S. District Court, venue shall lie exclusively in the Central District of California, in Riverside.

S
ECTION 30. ATTORNEY’S FEES, COSTS AND EXPENSES.

In the event litigation or other proceeding is required to enforce or interpret any provision of this Agreement, the prevailing Party in such litigation or other proceeding shall be entitled to an award of reasonable attorney’s fees, costs and expenses, in addition to any other relief to which it may be entitled.

18.A

00091740.2 Page | 13

SECTION 31. ENTIRE AGREEMENT.

This Agreement, including the attached exhibits and addendums, along with any amendments thereto, is the entire, complete, final and exclusive expres sion of the Parties with respect to the matters addressed therein and supersedes all other agreements or understandings, whether oral or written, or entered into between Consultant and City prior to the execution of this Agreement. No statements, representations or other agreements, whether oral or written, made by any Party which are not embodied herein shall be valid and binding.

SECTION 32. SEVERABILITY.

If any term, condition or covenant of this Agreement is declared or determined by any court of competent jurisdiction to be invalid, void or unenforceable, the remaining provisions of this Agreement shall not be affected thereby and the Agreement shall be read and construed without the invalid, void or unenforceable provision(s).

S
ECTION 33. INCORPORATION AND CONFLICTING TERMS.

(a) The following documents are incorporated and made part of this Agreement by this reference:

1. All exhibits and addendums

2. All amendments

3. Consultant’s proposal, if any

4. Any laws, regulations, requirements, or restrictions, applicable to the funding source used by City to pay Consultant for any portion of work done under Agreement (“Funding Restrictions”)
(b) The documents listed above shall be referred to collectively as the “Agreement Documents.” The Agreement Documents are int ended to be complementary, and a requirement in one Document is effective as if it appeared in all the Documents. In the event of a conflict between any of the Agreement Documents, the Documents shall be given effect in the following order: Funding Restric tions, Amendments (most recent first), this Agreement, Insurance requirements, exhibits and addendums, and Consultant’s proposal. Where the requirements of one Document are more stringent then another the more stringent shall govern.

S
ECTION 34. TIME OF THE ESSENCE.

Time is of the essence for each and every provision of this Agreement.

18.A

00091740.2
Signature Page

PROFESSIONAL SERVICES AGREEMENT

FOR HOSTED TELEPHONE SYSTEM INTEGRATION AND INSTALLATION BETWEEN THE CITY OF HEMET AND ICS INTELESYS, INC. DBA INTELESYS

IN WITNESS WHEREOF, the Parties hereto have executed this Agreement on the date and year first-above written.

CITY OF HEMET
___________________________
Mark Prestwich
City Manager
ATTEST:

CITY CLERK
By: ___________________________
APPROVED AS TO FORM:

CITY ATTORNEY
By: ____________________________

CONSULTANT
By:

Its:

18.A

00091740.2
Exhibit A – Scope of Services
Page | 1
EXHIBIT “A”

SCOPE OF SERVICES
Design, program, deploy, and train RingCentral Cloud PBX as follows:

Number of site surveys to be conducted by Intelesys - 17 Number of phones to be installed and configured by Intelesys - 95 Number of analog stations to be installed and configured by Intelesys - 175 Number of analog devices to be installed by Intelesys – (8) Audiocodes units Number of users to be configured by Intelesys - 325
Number of hunt groups to be configured by Intelesys – All Number of work groups to be configured by Intelesys – All Number of Basic Contact Center Agents to be configured by Intelesys - 50 Number of page groups to be configured by Intelesys - All Number of auto attendant greetings to be recorded by Intelesys - All Number of end-user training classes to be conducted by Intelesys – 12 Number of days end-user training classes to span - 3
Number of end-users to be trained by Intelesys - 180
Number of end-user trainer hours on site after conversion - 6 Number of web-based admin training classes to be conducted by Intelesys - 2 Number of SIP devices to be installed by Intelesys - 0
Number of headsets to be installed by Intelesys - 0
Number of overhead paging systems to be connected by Intelesys - 2 Number of music on hold/ad on hold units to be connected by Intelesys - 0 Number of new paging horns or speakers to be installed by Intelesys - 0 Number of external ringers to be connected by Intelesys - 0 Number of network assessments to be conducted by Intelesys - 1 Number of new cabling drops to be installed by Intelesys - 0 Number of patch cables to be provided by Intelesys - 95

18.A

00091740.2
Exhibit A – Scope of Services
Page | 2
Intelesys Responsibilities
Intelesys will be responsible for executing the following activities. Activities not expressly included in this SOW are outside the scope of this SOW.

Project Management
In support of the services to deploy the Ring Central phone system, Intelesys shall assign a designated project manager, to interface directly with the customer project manager. The Intelesys project manager’s responsibilities are as follows:

1. Server as the primary interface to the customer organization.

2. Coordinate the site installation priorities and the installation schedules with the customer project manager. The customer and Intelesys will mutually agree to a project timeline.

3. Function as the escalation focal point for issues that may arise under this SOW.

4. Participate in, and sometimes lead status meetings regarding the project.

5. Provide, at the customer’s written or oral request, status updates as to the progress of the services under this SOW. These updates will be provided via email or through telephone conversations.

6. Implement mutually agreed upon processes for the internal management of schedules inherent to the services provided under this SOW (such as scheduling of installation dates and go-live).

7. Develop and maintain an action items and issues list.

Call Flow Design Implementation
During this phase of the project, Intelesys shall review with the customer the provided call flows specific to the Ring Central implementation. The duties include:

1. Review of call flow for Ring Central phone system with recommendation for best practices in implementation.

2. Question and answer follow-up discovery to fully understand customer requirements.

3. Translation of call flows to IPBX specific configuration.

Additional tasks discovered through the discovery phase of the Ring Central` project lifecycle and not mentioned in this SOW shall be considered out of scope and shall be handled by formal change control process as described in the change control process of this SOW.

Installation, Configuration, and Integration

1. Configure Ring Central phone system via online portal.

2. DHCP definitions for Ring Central compatible phones

3. Configure phone system to route calls as defined in call flows.

4. Install and configure desktop application on PCs that meets or exceeds Ring Central’s hardware and software requirements.

5. Configure auto attendants and voicemail per design.

6. Notify customer of each “customer not ready” occurrence. Causes may include but not limited to the following:
a. Lack of physical access to the site
b. Customer local site contact not available to assist with the installation c. Customer provided inside wiring is not operational

18.A

00091740.2
Exhibit A – Scope of Services
Page | 3
d. Lack of adequate power or environmental conditions as specified by equipment manufacturer

Intelesys will perform the following test and turn -up activities applicable to the site(s) after the equipment installation:

1. Confirm that equipment configuration is properly installed and operational.

2. Confirm that desktop client is properly installed and operational on designated agent PCs.

3. Confirm that call flows are configured properly in Ring Central admin portal and inbound IPBX calls route appropriately.

4. Confirm that inbound calls route properly a nd proper messages are played when calls route to entities such as auto attendants and voicemail.

5. Obtain signoff from the customer project manager on the implementation acceptance form located in this SOW after successful installation and turn-up of the site(s).

Training
Intelesys will provide the following two types of training classes. They are as follows:

1. End-user training
a. These classes are completed at customer’s site and cover basic system operation.

Class times range about an hour

2. Web based admin training
a. These classes are completed over the web and cover basic system administration.

Class times range from three to four hours.

It is the responsibility of the customer to schedule and coordinate the scheduling of their staff

Support
Intelesys will provide the following support activities:

On the first customer business day after successful test and turn -up (go-live), the Intelesys onsite representative will be available for several hours at the customer site (see labor detail form for exact number of hours) where services were provided in this SOW during regular customer business hours to answer any questions or address any issues related to the services provided in this SOW.

18.A

00091740.2
Exhibit B – Compensation
Page | 1
EXHIBIT “B”

COMPENSATION

Compensation for the Services shall not exceed Forty-Six Thousand Three Hundred and Twenty- Five Dollars ($46,325.00) (“Not to Exceed Amount”)

18.A

EXHIBIT “C”

INSURANCE
(A) INSURANCE REQUIREMENTS. Consultant shall provide and maintain insurance, acceptable to the City, in full force and effect throughout the Term of this Agreement, against claims for injuries to persons or damages to property which may arise from or in connection with the performance of the Services by C onsultant, its agents, representatives or employees.

Insurance is to be placed with insurers with a current A.M. Best's rating of no less than A:VII. Consultant shall provide the following scope and limits of insurance:

1. MINIMUM SCOPE OF INSURANCE. Consultant shall maintain the following types and limits of insurance.

2. M
INIMUM LIMITS OF INSURANCE.

GENERAL LIABILITY INSURANCE. Consultant shall maintain commercial general liability insurance with coverage at least as broad as Insurance Services Office form CG 00 01, in an amount not less than $1,000,000 per occurrence, $2,000,000 general aggregate, for bodily injury, personal injury, and property damage. The policy must include contractual liability that has not been amended. Any endorsement restricting standard ISO “insured contract” language will not be accepted.

A
UTOMOBILE LIABILITY INSURANCE. Consultant shall maintain automobile liability insurance at least as broad as Insurance Services Office form CA 00 0 1 covering bodily injury and property damage for all activities of the Co nsultant arising out of or in connection with Services to be performed under this Agreement, including coverage for any owned, hired, non- owned or rented vehicles, in an amount not less than $1,000,000 combined single limit for each accident.

PROFESSIONAL LIABILITY (ERRORS & OMISSIONS) INSURANCE. Consultant shall maintain professional liability insurance that covers the Services to be performed in connection with this Agreement, in the minimum amount of $1,000,000 per claim and in the aggregate. Any policy inception date, continuity date, or retroactive date must be before the effective date of this Agreement and Consultant agrees to maintain continuous coverage through a period no less than three (3) years after completion of the services required by this Agreement.

W
ORKERS’ COMPENSATION INSURANCE. Consultant shall maintain Workers’ Compensation Insurance (Statutory Limits) and Employer’s Liability Insurance (with limits of at least $1,000,000 per accident or disease). Consultant shall submit to City, along with the certificate of insurance, a Waiver of Subrogation endorsement in favor of City , its officers, agents, employees , and volunteers.

U
MBRELLA OR EXCESS LIABILITY INSURANCE. [Optional depending on limits required] . As an option to meet the limits of insurance required by this Agreement, Consultant may obtain and maintain an umbrella or excess liability insurance policy with limits that will provide bodily injury, personal injury and property damage liability coverage at least as broad as the primary coverages

18.A

set forth above, including commercial genera l liability, automobile liability, and employer’s liability. Such policy or policies shall include the following terms and conditions:

1. A drop- down feature requiring the policy to respond if any primary insurance that would otherwise have applied proves to be uncollectible in whole or in part for any reason;

2. Pay on behalf of wording as opposed to reimbursement;

3. Concurrency of effective dates with primary policies;

4. Policies shall “follow form” to the underlying primary policies; and

5. Insureds under primary policies shall also be insureds under the umbrella or excess policies.
(B) OTHER PROVISIONS. Each insurance policy required by this Agreement shall be endorsed and state the coverage shall not be suspended, voided, canceled by the insurer or either Party to this Agreement, reduced in coverage or in limits except after thirty (30) days' prior written notice by certified mail, return receipt requested, has been given to City. (C) O
THER REQUIREMENTS. Consultant agrees to deposit with City, at or before the effective date of this Agreement, certificates of insurance necessary to satisfy City that the insurance provisions of this contract have been complied with. The City Attorney may require that Consultant furnish City with copies of original endorsements effecting coverage required by this Section. The certificates and endorsements are to be signed by a person authorized by that insurer to bind coverage on its behalf. City reserves the right to inspect complete, certified copies of all required insurance policies, at any time.

1. Upon request from the City, Consultant shall furnish certificates and endorsements from each subcontractor identical to those Consultant provides.

2. Any deductibles or self -insured reten tions must be declared to and approved by City. At the option of City, either the insurer shall reduce or eliminate such deductibles or self -insured retentions with respect to City or its respective elected or appointed officers, officials, employees, and volunteers or the Consultant shall procure a bond guaranteeing payment of losses and related investigations, claim administration, defense expenses and claims.

3. The procuring of such required policy or policies of insurance shall not be construed to limit Con sultant’s liability hereunder nor to fulfill the indemnification provisions and requirements of this Agreement.

4. Coverage provided by Consultant shall be primary and any insurance or self-insurance procured or maintained by City shall not be required to contribute with it. The limits of insurance required herein may be satisfied by a combination of primary and umbrella or excess insurance.

Any umbrella or excess insurance shall contain or be endorsed to contain a provision that such coverage shall also apply on a primary and

18.A

non-contributory basis for the benefit of City before the City ’s own insurance or self-insurance shall be called upon to protect it as a named insured.

5. All insurance coverage maintained or procured pursuant to this agreement shall be endorsed to waive subrogation against City , its elected or appointed officers, agents, officials, employees and volunteers or shall specifically allow Consultant or others providing insurance evidence in compliance with these specifications to waive their right of recovery prior to a loss. Consultant hereby waives its own right of recovery against City, and shall require similar written express waivers and insurance clauses from each of its sub consultants.

6. General liability policies shall provide or be endorsed to provide that City and its officers, officials, employees, agents, and volunteers shall be additional insureds under such policies. This provision shall also apply to any excess/umbrella liability policies.

18.A

Date:

No.: 11242
5/10/2024
Quote
Intelesys
Phone: (888) 546-8353
Fax: (909) 305-2100
3155-B Sedona Court
Ontario, CA 91764
Prepared for: Prepared by: Rick Balzer
Scott Underwood (951) 765-3765 Account No.: 56925
City of Hemet Phone: (951) 765-2303
445 E. Florida Ave Job: Cabling Installation
Hemet, CA 92543 U.S.A.

Quantity TotalSellUOM DiscountItem ID Description
EANetwork Hardware Extreme AP 410 $167,217.00 139.00 $1,203.00 $0.00 EANetwork Hardware AP Mounting Bracket $5,004.00 139.00 $36.00 $0.00 EADiscount T Omnia Discount ($77,499.45)0.45 ($172,221.00)$77,499.45 HRSupport Third party
products
AP Software Support 1yr $4,170.00 139.00 $30.00 $0.00
HRSupport Third party
products
XIQ Pilot SaaS 1YR $20,850.00 139.00 $150.00 $0.00
EADiscount NT Omnia Discount ($3,002.40)0.12 ($25,020.00)$3,002.40 EALabor-Fixed Setup Extreme Portal, design,
program and install Access Points
$32,435.00 1.00 $32,435.00 $0.00
EADiscount NT Discount Omnia ($4,865.25)0.15 ($32,435.00)$4,865.25 Item Total: $229,676.00
Your Price: $144,308.90
$8,998.55 Sales Tax
SubTotal: $153,307.45
Total: $153,307.45
$85,367.10 You saved:

For a savings of 37.17%
Prices are firm until 6/30/2024 Terms: Net 30
Date: 5/10/2024
Date:__________
___________
Prepared by: Rick Balzer, [email protected]
Price may very depending on changes to scope of work.

Includes (4) AP's per fire station
Test all existing cables and label both ends of wiring No network configuration is provided within this quote Does not include scissorlift rental if needed
Does not include after hours labor cost
Accepted by:
quote.rpt Page 1Printed: 5/23/2024 2:07:16PMPage 88 of 108

18.A

Date:

No.: 11247
5/17/2024
Quote
Intelesys
Phone: (888) 546-8353
Fax: (909) 305-2100
3155-B Sedona Court
Ontario, CA 91764
Prepared for: Prepared by: Rick Balzer
Scott Underwood (951) 765-3765 Account No.: 56925
City of Hemet Phone: (951) 765-2303
445 E. Florida Ave Job: Cabling Installation
Hemet, CA 92543 U.S.A.

Quantity TotalSellUOM DiscountItem ID Description
EAC-Cable Cat6A Plenum Cable Feet $9,736.38 24,250.00 $0.4015 $0.00 EAC-Cable Cat6 Data Jacks $776.00 388.00 $2.00 $0.00
EAC-Cable 24 Port blank patch panel $774.50 25.00 $30.98 $0.00 EAC-Cable 1 Port Faceplates $296.82 194.00 $1.53 $0.00
EAC-Cable Misc. Hardware - Sleeves, ties and
clips
$1,095.00 1.00 $1,095.00 $0.00
EAC-Cable Patch Cables $1,421.91 333.00 $4.27 $0.00
EADiscount T Omnia Discount ($6,345.32)0.45 ($14,100.70)$6,345.32 EALabor-Fixed Labor complete 139 cable drops with
termination and labeling
$22,245.00 1.00 $22,245.00 $0.00
EALabor-Fixed Labor complete 55 cable drops with
termination and labeling
$8,245.00 1.00 $8,245.00 $0.00
EADiscount NT Discount Omnia ($4,573.50)0.15 ($30,490.00)$4,573.50 Item Total: $44,590.61
Your Price: $33,671.79
$736.75 Sales Tax
SubTotal: $34,408.54
Total: $34,408.54
$10,918.82 You saved:

For a savings of 24.49%
Prices are firm until 6/30/2024 Terms: Net 30
Prepared by: Rick Balzer, [email protected] Date: 5/17/2024 Price may very depending on changes to scope of work.

Run 139 CAT6A data cables for new wireless access point locations Run (55) new cables for network endpoints
Install new patch panels
Test all existing cables and label both ends of wiring
No network configuration is provided within this quote
Does not include scissorlift rental if needed
Does not include after hours labor cost
Date:__________
___________
Accepted by:
quote.rpt Page 1Printed: 5/23/2024 2:04:13PMPage 89 of 108

18.A

Presenting
Data Switch Replacement
Aruba and Fortinet
Dat
e: May 8, 2024
C
ontact: Aaron Betts, Operations Officer
909-809-7332
[email protected]
In
telesys | Ontario, CA | (888) 546-8353 | www.it4ps.com

18.A

Description ‐ Aruba Switches  Qty   List Price
Omnia Sell
Price  Total
HPE Aruba 6100 48G Class4 PoE 4SFP           8  $5,559.00 $1,995.00 15,960.00 Aruba 6100 24G Class4 PoE 4SFP           9  $3,649.00 $1,295.00 11,655.00 Aruba 6100 Ethernet Switch 12 Ports        27  $1,869.00 $1,001.00 27,027.00 Aruba 6200F 48G Class4 PoE 4SFP        14  $9,689.00 $2,590.00 36,260.00 Aruba 6200F 24G Class4 PoE 4SFP           4  $5,989.00 $2,030.00 8,120.00 Aruba 6300F 48 ports           2  $13,719.00 $8,870.97 17,741.94 HPE 10gb Single Mode SFP        20  $3,707.00 $2,142.86 42,857.14 HPE 10gb Multi Mode SFP        54  $1,322.00 $765.63 41,343.75 HPE 50gb Multi Mode SFP           4  $2,519.00 $1,733.00 6,932.00 HPE 40gb Multi Mode SFP           4  $2,295.00 $1,350.00 5,400.00 Wire Management        64   $        225.00  $180.00 11,520.00 Cat 5e Patch cables ‐ varied lengths and colors
per design   1,091  $            4.23  $2.75 3,000.25
$227,817.08
$ 29,445.00
$19,933.99
$277,196.07
$10,995.00
Sales Tax
Project Total
Optional Chassis upgrade City Hall
Replace (80) obsolete data switches with supported PoE next generation switches across (64) MDF's /IDF's
LABOR
Scope of Work ‐ City of Hemet Data Switch Replacement ‐ Aruba Omnia Joint Purchase Vehicle Pricing
*All products and services are bid at prevailing wage rates and associated payroll filing will be handled by Intelesys  per DIR requirements.  California DIR number 1000032005 expires 6/30/2026 Re‐wire data switches with color coded patch cables at proper length with wire management Install and connect fiber modules in new data switches
Install wire management in each MDF / IDF
Develop data topography in conjunction with client for effective routing and traffic management Program data switches with proper routing, QOS, VLAN;s and port management per client des ign Hardware Total
Labor Total ‐ Omnia rates billed at 35% off catalog rates Network Engineer (76 hrs.) ‐ $225, Onsite technician (120 Hs) ‐$175, and remote programming (48 hrs.) $150 Prices valid until 6-30-2024, billing processed via OMNIA Government Contract

18.A

Description ‐ Fortinet Switches  Qty   List Price
Omnia Sell
Price  Total
Fortinet 48 Port POE        22  $2,495.00 $1,984.00 43,648.00 Fortinet 24 Port POE        46  $1,595.00 $1,018.75 46,862.50 Fortinet 48 Port POE 40GB           2  $8,995.00 $5,250.00 10,500.00 Fortinet 10GE Singe Mode SFP        20  $795.00 $468.75 9,375.00 Fortinet 10GE Multi Mode SFP        54  $595.00 $350.00 18,900.00 Fortinet 40GE Multi Mode SFP           4  $3,800.00 $2,254.88 9,019.51 HPE 40gb Multi Mode SFP           4  $2,295.00 $1,350.00 5,400.00 Wire Management        64   $        225.00  $180.00 11,520.00 Cat 5e Patch cables ‐ varied lengths and colors
per design   1,091  $            4.23  $2.75 3,000.25
$158,225.26
$ 29,445.00
$13,844.71
$201,514.97
$10,995.00
Labor Total ‐ Omnia rates billed at 35% off catalog rates Network Engineer (76 hrs.) ‐ $225, Onsite technician (120 Hs) ‐$175, and remote programming (48 hrs.) $150 Sales Tax
Project Total
Optional Chassis upgrade City Hall
Scope of Work ‐ City of Hemet Data Switch Replacement ‐ Fortinet Omnia Joint Purchase Vehicle Pricing
*All products and services are bid at prevailing wage rates and associated payroll filing will be handled by Intelesys  per DIR requirements.  California DIR number 1000032005 expires 6/30/2026 LABOR
Replace (80) obsolete data switches with supported PoE next generation switches across (64) MDF's /IDF's
Re‐wire data switches with color coded patch cables at proper length with wire management Install and connect fiber modules in new data switches
Install wire management in each MDF / IDF
Develop data topography in conjunction wit h  client for effective routing and traffic management Program data switches with proper routing, QOS, VLAN;s and port management per client design Hardware Total
Prices valid until 6-30-2024, billing processed via OMNIA Government Contra ct

18.A

Scope of Work: Programming and Installation of (80) Data Switches with Routing, VLAN, and QoS Design – City of Hemet
Thi
s document outlines the scope of work for the programming and installation of (80) data switches, including routing, VLAN, and Quality of Service (QoS) design. The project aims to establish a robust network infrastructure to support efficient data transmission, segmentation, and prioritization within the organization.

Objectives:

Program and configure (80) data switches to ensure seamless communication and network reliability.

Implement VLAN (Virtual Local Area Network) to segment network traffic and enhance security.

Design and configure routing protocols to facilitate efficient data routing between network segments.

Establish Quality of Service (QoS) policies to prioritize network traffic and optimize bandwidth utilization.

Tasks and Deliverables:

Pre-Installation Preparation:

Conduct site survey to assess network topology, requirements, and potential challenges.

Develop a comprehensive implementation plan outlining timelines, resources, and milestones.

Procure necessary equipment, including switches, cables, and accessories.

Programming and Configuration:

Configure each data switch according to the provided specifications and network requirements.

Implement VLANs to logically segment network traffic and enhance security.

Design and configure routing protocols such as OSPF (Open Shortest Path First) or BGP (Border Gateway Protocol) for efficient data routing.

Configure Quality of Service (QoS) parameters to prioritize critical network traffic based on predefined criteria.

Installation and Deployment:

Physically install (80) data switches at designated locations within the organization's premises.

Ensure proper cable management and labeling to facilitate maintenance and troubleshooting.

18.A

Conduct thorough testing and verification to ensure the functionality and performance of each switch.

Provide on-site support and assistance during the installation process to address any issues or concerns.

Documentation and Training:

Prepare comprehensive documentation, including network diagrams, configurations, and installation records.

Conduct training sessions for IT personnel to familiarize them with the newly implemented network infrastructure.

Provide user guides and troubleshooting resources to support ongoing maintenance and operation.

Timeline:

The project is expected to be completed within [Insert Timeline], subject to any unforeseen delays or challenges encountered during implementation.

Resources:

Project Manager: Aaron Betts
Network Engineers: David Garcia, Charles Henigan
Installation Technicians: David Garcia, David Joyce, James Hunt Acceptance Criteria:

Successful programming and configuration of (80) data switches as per specifications.

Implementation of VLANs, routing protocols, and QoS policies in accordance with network requirements.

Completion of installation and deployment activities within the specified timeline.

Provision of comprehensive documentation and training materials to support ongoing maintenance and operation.

This scope of work outlines the key tasks, deliverables, and expectations for the programming and installation of (80) data switches with routing, VLAN, and QoS design. By adhering to these guidelines, we aim to ensure the successful implementation of a robust and efficient network infrastructure to meet the organization's evolving needs. Page 94 of 108

18.A

T
echnical Recommendation – Intelesys
recommedns the Aruba switch line based on
manufacturer industry presence, support of
the products in the field, network throughput
ratings, product quality ratings, and third
party analysts reviews
Th
ank you for your consideration, please
contact us for any questions or clarifications.

In
telesys | Ontario, CA | (888) 546-8353 | www.it4ps.com

18.A

5/8/2024 www.Com-Strat.com 1 of 13 ©
Proposal for Technology Consulting Services

For

City of Hemet
Presented to:

Scott Underwood
Supervisor, Information Technology
By

Chuck Vondra
Sr. Consultant, Managing Principal
(707) 963-5418
[email protected]

Brian Hodges
Sr. Consultant
(623) 399-3643
[email protected]

18.A

5/8/2024 www.Com-Strat.com 2 of 13 ©
PROJECT OVERVIEW:

Communication Strategies has completed Phase 1 through Phase 3 of the proposed technology consulting services. The City of Hemet has decided to move forward with the project and wishes to retain the services of Com-Strat for the following additional phase:

• Phase 4 Implementation Support and Project Oversight was reflected in the Task list included below.

Additionally, Com-Strat has provided a second agreement below to address additional hours Com-Strat provided in the earlier phases . Com-Strat exceeded the approved dollar amount on the RFP/Evaluation phases of this project. The primary reasons are:

1. Significant project delays added management tasks

2. Creation of specifications addressing data networking components (Not in original scope) Com-Strat elected to perform the above tasks understanding that the fees incurred were “at risk”, as we did not have city authorization. Com-Strat felt this step necessary for the success of the project, given the existing timeline constraints.

To the degree that any of the Implementation Support and Project Oversight Tasks identified below can be completed by the City of Hemet they will be deleted from our Scope of Work as the project proceeds.

We will invoice only for actual hours worked.

Further Com-Strat has not included on site work or travel as the majority of our Public Sector clients over the past few years have worked with us remotely.

18.A

5/8/2024 www.Com-Strat.com 3 of 13 ©
COMMUNICATION STRATEGIES CORPORATE OVERVIEW:

Communication Strategies is a premier technology consulting company specializing in enterprise technology and infrastructure. Established in 1987, we have become a recognized leader serving clients' domestic and global requirements. Because we are independent consultants, our clients receive value from wide industry experience, objective expertise, unbiased recommendations, and cost -effective solutions. Our consultants have an average of 25 years’ experience in IT/IS line of business, management, and/or consulting. Communication Strategies has experience managing projects throughout the United States and abroad.

As VoIP deployments became standard and ubiquitous, emerging technologies such as Unified Communications, Cloud based options and Collaboration have become the next generation deployment prerequisite to address workflow improvement and business productivit y objectives. Over the past twenty years Communications Strategies has built an experienced professional team that assists clients in evaluating, selecting, and deploying leading technology solution to solve complex objectives.

Communication Strategies has decades of experience in a wide range of Vertical Markets. Our experience in a diverse range of markets allows Com -Strat Consultants and Project Managers to leverage our knowledge and experience gain from one industry to another.

Education
Public Sector
Healthcare
Bio-Med/Tech
Financial
Legal
Entertainment
Retail
Insurance

18.A

5/8/2024 www.Com-Strat.com 4 of 13 ©
CORE COMPETENCIES:

• Strategic Planning – Determine a short, medium, and long term plan to mitigate current issues and roadmap for future technology needs - including systems platforms, network requirements, budgets, timelines and return on investment.
• Design, Recommendation & Implementation - Conduct needs analysis, prepare budget and return on investment, develop RFP specifications, provide objective analysis, and manage successful system(s) implementation.
• Information Systems Consulting – ERP deployments, Document Management Systems, CRM evaluations/deployment/customization, Web hosting and design, and various database and enterprise software deployments
• Unified Communications and Collaboration- Design and implementation of enterprise networks and customer premise equipment involving emerging technology. • Contact Center Consulting - Manage revenue objectives, customer satisfaction and staffing expenses through effective call flow design and call center technologies. • Technology Infrastructure Consulting – Data/Telecom infrastructure design and budgeting for equipment room(s), Web hosting/Co-location, space planning, electrical & back-up power, air conditioning, fire suppression, flooring, and inside/outside cable plant design. Includes everything from initial budgets, CAD drawings, RFP generation, project management and as-built documentation.
• LAN/WAN Network Design – Develop efficient, economic and disaster resilient network design for single to multi-office national & global networks. Local, long distance, internet, point to point and virtual private networks (VPN).
• UC System Programming – Com-Strat consultants are available to provide system programming on most platform leaders in the UC marketplace such as MS Teams, RingCentral, Zoom, and 8x8. • Telephone Expense Auditing – We reduce telecommunications expenses by performing a complete telco inventory, bill analysis and contracts evaluation. Cost reductions and or refunds are identified, negotiated, and implemented.
• Project Management and Staff Augmentation – Perform project management services and responsibilities on an outsourced contract basis. This allows your busy staff to focus on the daily demands of their work while we take care of the rest.

18.A

5/8/2024 www.Com-Strat.com 5 of 13 ©
PROJECT TEAM:

Communication Strategies assigns a veteran team to work together towards successful project completion. This approach allows for single point of contact for project tasks and communications while providing subject matter expertise where needed. Each project team consists of:

• Principal in Charge – A principal of Communication Strategies who supports the Project Manager • Project Director – Manager of all projects and project managers • Project Manager – Senior consultant to act as single point of contact through all project phases • Account Manager – Maintains overall client relationship

Communication Strategies has developed an innovative approach to the Needs Assessment / Evaluation /Project Management process for technology decisions. The process represents a continuous workflow that allows each phase to easily leverage off information gathered in the previous phases. The results of this approach include:
• Efficiencies generated allow us to reduce overall project costs to Clients. • Objective rating and scoring system makes it easy to articulate and justify recommendations. • System is designed to prevent disputes and challenges from the vendor community. • System allows Clients to help develop evaluation weighting to insure the best long term solution is identified and selected.

18.A

5/8/2024 www.Com-Strat.com 6 of 13 ©
METHODOLOGY:

Communication Strategies has developed an exclusive process that traditionally includes five phases but can be customized to individual client objectives and required outcomes.

1. Strategic Planning and Budget

2. Requirements Documentation Tasks

3. Evaluation and System Selection

4. Implementation Support /Project Management

Completed Phase 1 – Strategic Planning and Budget
For some clients, prior to embarking on a formal procurement process it is often advisable to determine a total project budget spanning the initial and any subsequent phases. This budget should consider, in addition to the technology platform, any and all ancillary project costs, including infrastructure, project management, training and ongoing support. This phase can include development of a Business Requirements Document (BRD), culminating in a Strategic Roadmap Report Completed Phase 2 – Requirements Documentation Tasks
During the discovery process, we will become fluent with client’s current business operations and existing technology environment. Representative departments will be interviewed in order to identify existing and future requirements. We will inventory and document existing systems and networks. Growth planning will be identified including potential future locations. Analysis will include identifying necessary improvements to LAN/WAN and infrastructure. This process will allow us to identify and document potential areas of functional, technological, and economic improvements. These will be reviewed in depth with client. The result of this discovery will be a formal Request for Proposal (RFP) addressing system requirements. The RFP will request product information suitable to clients’ current & future requirements, and pricing. Prior to proposal submission Communication Strategies will work with client in developing a detailed evaluation criteria to be used in subsequent phases of the project.

The Requirements Documentation Tasks phase could include the following tasks:

Strategic Planning
and Budget
Requirements
Documentation
Tasks
Evaluation and
System Selection
Implementation
Support and Project
Management

18.A

5/8/2024 www.Com-Strat.com 7 of 13 ©
• Participate in voice and data technology discussions with the Client IT and Management team.
• Interview additional key Departmental staff.
• Document call flow, call coverage requirements.
• On site observation of key call answering positions and call centers, as necessary.
• Document key improvement targets and/or improved
business process objectives.
• Obtain information on any existing related hardware and telco circuits.
• Develop understanding of WAN/LAN topology
requirements.
• Identify required current and future applications.
• Conduct Workshops to review technology alternatives.
• Develop deployment strategy.
• Develop bidder trade sponsorship language and format if required. • Identify client metrics for evaluation and selection criteria. • Assemble bidder list to include major solution providers and strong business partners • Create and distribute Request for Proposal(s).

Completed Phase 3 – Vendor Evaluation & Technology Selection This phase could begin by submitting the RFP Request for Proposal to suitable vendors, conducting a bidder’s conference, and managing bidder communications. Communication Strategies will evaluate each RFP response using the criteria developed during phase 2. The criteria will cover but not be limited to technology, functionality, migration, lifecycle cost, financial stability, and independent research Information. In addition to our experience with emerging technologies, Communication Strategies maintains consultant liaison relationships with the major providers in the industry. This provides us access to libraries of information, engineering, and product management personnel as well as frequent updates. The combination of the RFP responses, direct manufacturer access , and independent research will allow us to assist our client in developing an optimum technology strategy.

The Vendor Evaluation and Selection phase could consist of the following tasks:
• Conduct bidder’s conference.
• Act as primary contact point for vendor Q&A to provide consistent researched responses back to the respondents.
• Review each proposal and prepare evaluation report with a detailed cost and capability comparison.
• Generate follow up questions for each vendor to ensure that RFP response is compliant, inclusive of all costs, complete and “apples to apples” comparable to other vendors.

18.A

5/8/2024 www.Com-Strat.com 8 of 13 ©
• Develop bidders “short list”.
• Provide recommendations, as appropriate, on vendor/solution suitability. • Co-ordinate and participate in vendor presentations. Com-Strat can provide detailed agendas to assure that key client objectives are effectively demonstrated. • Prepare detailed comparative proposal Evaluation Summary. • Provide presentation and/or presence at board or management meetings for project approval.

Proposed Phase 4 – Implementation Support and Project Oversight Once the ultimate solution has been identified, Communication Strategies is available to act as your Subject Matter Expert to insure a successful installation. This would include coordination with all vendors and client personnel. We can act as a Business Analyst liaison between IT and the Line of Business departments to ensure that the business outcomes that were envisioned for the project are achieved. Depending on the client side Project Management resources available w e can conduct weekly status meetings and prepare detailed meeting notes to be distributed to the team. In cases where our Client or the Vendor will be providing Project Management, Com - Strat can provide Program Management coordination
between the various vendor’s Project Managers, internal resources, IT management, and Client steering committees.

We will supervise all programming , configuration, and
deployment to ensure that timelines and budgets are met . We can create a detailed project plan if needed, as well as installation test plans and acceptance criteria. Communication Strategies has managed hundreds of similar projects over the years and possesses the experience, processes, and depth to ensure the project’s success.

Communication Strategies will assign one Consultant and one Principal In Charge (PIC). The Consultant will be responsible for day to day activities and all client deliverables. The PIC’s role will be to manage SOW change issues, escalation issues and to serve as a resource and backup to the Consultant.

The Implementation Support phase could include the following:
• Negotiate pricing and terms with selected vendor for initial and subsequent pricing issues. (add‐ons, maintenance, future offices).
• Review contract documentation.
• Place all Telco orders for new services.
• Manage collection of all system database issues.
• Provide system environmental requirements to appropriate parties. • Develop business continuity plan,
• Conduct periodic vendor status meetings (weekly as a minimum), • Supervise system installation,
• Develop system testing program,
• Develop Communication Plan to build support for the project among users,

18.A

5/8/2024 www.Com-Strat.com 9 of 13 ©
• Coordinate user training
• Supervise cutover coverage
• Prepare and follow up on vendor punch list
• Assist in liquidation of existing hardware

18.A

5/8/2024 www.Com-Strat.com 10 of 13 ©
ITEMIZED SCOPE OF WORK:

Phase 4 Implementation Support Tasks Quantity Hours Net Hours

4.01 Lan RFP project update 1 40 40

4.02 Vendor kickoff meeting - deployment plan, installation schedule 1 3 3

4.03 Prepare formal project plan with all vendor and Client resources accounted for, establish dependencies, update & manage
Vendor to
manage 12 TBD

4.04 Develop business continuity plan 2 4 8

4.05 Telco design, order and follow up on carrier services 1 8 8

4.06 Complex/Difficult Telco ordering process follow up Option 12 TBD

4.07 VoIP Readiness remediation PM - cabling, VLANS, power, LAN, WAN, etc. 2 4 8

4.08 LAN/QoS Design Refresh discussions 1 4 4

4.09 Telephony Design Workshops (Call coverage, template design, features, class of service, restrictions, dial plan) 2 8 16

4.10 ACD Design Workshop and follow up (call flows, reporting requirements, agent, and supervisor functionality) 1 4 4

4.11 Workshops and PM for complex Multimedia Contact Center, IVR, Database Integration, Recording Option 8 TBD

4.12 Workshop to design Advanced Unified Communications for (Teams) 2 4 8

4.13 Complete user and phone details for Vendor Workbook 1 24 24

4.14 Review final call flow documentation, and workbook prior to database freeze 1 4 4

4.15 Create and develop User Acceptance Test (UAT) plan (VoIP, failover) 2 2 4

4.16 Assist in training format, scheduling, reviewing training materials Option 1 TBD

4.17 Communication plan to end user community to improve project acceptance, and 2 communications (email, company meeting) Option 4 TBD

4.18 Review, remediate Vendor executed VoIP QoS readiness assessment 2 2 4

4.19 Participate in UAT and failover testing according to UAT test plan and minor remediation as required 2 4 8

4.20 Plan cut coverage trouble ticket response and escalation 1 4 4

4.21 System cutover 1 5 5

4.22 System cutover coverage 1 12 12

4.23 Manage post install punch list and remediation 1 8 8

4.24 Assist in liquidation of existing hardware Option 2 TBD

4.25 Project close out - manage Vendor's system acceptance process and project close-out, review as-built documentation, and final exception lists. Lessons learned meeting.
2 2 4

4.26 Participate in weekly planning meetings (per week) 24 1 24

18.A

5/8/2024 www.Com-Strat.com 11 of 13 ©

4.27 Miscellaneous emails, PM and follow up - weekly 24 2 48

4.28 Prepare weekly meeting notes Vendor to
manage 1 TBD

4.29 Travel Time (1/2 rate) Option 1 TBD
Phase 4 Total 248

PROJECT TIME LINE:

Phase 4: Installation Project Management 22- 24 weeks

Timeline above represents typical intervals based on normal client urgency and availability. Timeline can be shortened or expanded upon request.

PROJECT FEES:

Phase Scope of Work Net Hours Total
Phase 1 Strategic Planning and Budget Report 0 Completed Phase 2 Requirements Documentation and RFP 0 Completed
Phase 3 Vendor Evaluation and Selection 0 Completed
Phase 4 Implementation Support 248 $48,360.00
Travel Travel and Expenses Local Travel Option
Grand Total 248 $48,360.00
1 Project Management is an order of magnitude estimate provided before full requirements gathering. It may be reduced depending on the final project specifications, client resource availability, and which vendor is chosen to implement the solution. Phase 4 firm quote will be provided in the RFP evaluation recommendation report, when final approval for the purchase and installation of the solution is 2 Consulting Support Plan is available as an option at the end of the project.

18.A

5/8/2024 www.Com-Strat.com 12 of 13 ©
Agreement for Technology Consulting
This agreement is between Communication Strategies (Com-Strat, LLC) and City of Hemet for the purpose of technology consulting services.

SCOPE OF WORK: Phase 4 as described above
FEES: 248 Hours at $195.00 per hour for a total of $48,360.00 TERMS:

Communications Strategies will invoice monthly for actual work performed and payment is net 30 days.

Local travel and normal expenses are included in our hourly rate. Extended travel is included if defined above. Invoicing is ‘not to exceed’ the total amount above, based on the hours quoted. The hours quoted are based on information provided by the client regarding the nature and duration of the project (documented in this SoW), and our estimation of the required efforts to complete that work.

Additional effort and cost may be required due to: a) unreasonable delay or failure to deliver required information that we cannot reasonably derive through other methods within the Scope of Work defined - on the part of the Client or their 3rd party cont ractors/vendors, b) delays, alternate methodologies, or changes in scope requested by the Client that we cannot absorb within the hours quoted, c) failure to perform on behalf of: Client staff and contractors, other Client 3rd party vendors and contractors , telephone companies and/or carriers, d) failure to deliver or delays caused by the Vendors/Providers chosen by the Client through the evaluation step of this project, e) Force Majeure events that neither party has control over. Any changes in the Scope of Work or cost will be made in writing and mutually agreed upon – in the form of a change order or addendum, Client augment of existing PO/Contracts, or other method as Client may require to authorize additional funds.

ACCEPTANCE:

The City of Hemet Com-Strat, LLC
445 E. Florida Avenue 1179 Meredith Lane
Hemet, CA 92543 Chester Springs, PA 19425

Name: __________________ Name _____________________

Title: __________________ Title: _____________________

Date: __________________ Date: _____________________

18.A

5/8/2024 www.Com-Strat.com 13 of 13 ©
Agreement for Technology Consulting
This agreement is between Communication Strategies (Com-Strat, LLC) and City of Hemet for the purpose of technology consulting services.

SCOPE OF WORK: Phase 2/3 Overages

Phase 2/3 Overages Quantity Hours Net Hours

3.01 Overage from P3 1 98.25 98.25

FEES: 98.25 Hours at $195.00 per hour for a total of $19,158.75

ACCEPTANCE:

The City of Hemet Com-Strat, LLC
445 E. Florida Avenue 1179 Meredith Lane
Hemet, CA 92543 Chester Springs, PA 19425

Name: __________________ Name _____________________

Title: __________________ Title: _____________________

Date: __________________ Date: _____________________

18.A

City of Hemet
City Council Meeting

STAFF REPORT

Meeting: City Council Meeting - Jun 11 2024
Department: Public Works
Submitted by: Mark Prestwich, City Manager
Jilleen Ferris, Deputy Public Works Director/Assistant City Engineer;

☐ Receive and File ☐ Consent Calendar ☒ Business Item ☐ Public Hearing

TITLE:

A Resolution of the City Council of the City of Hemet, California, Adopting the Storm Drain and Drainage Design Manual, a Replacement of the Currently Adopted Storm Drain Development Standards, Storm Drain Criteria and Drainage Design Manual

RECOMMENDED ACTION:

It is respectfully recommended that the City Council:

Adopt a Resolution of the City Council of the City of Hemet, California, adopting the Storm Drain and Drainage Design Manual, a replacement of the currently adopted Storm Drain Development Standards, Storm Drain Criteria and Drainage Design Manual.

BACKGROUND:

In 1996, the City of Hemet adopted the Storm Drain Development Standards, Storm Drain Criteria and Drainage Design Manual. This document established drainage policy, detailed required hydrology and hydraulic criteria for preparing drainage studies and storm drain improvement plans, and included a section on erosion control.

ANALYSIS:

Several of the sections within the currently adopted manual reference outdated standards and policies. Therefore, City staff reviewed the current manual and have developed recommended revisions throughout the entirety of the currently adopted manual.

The current manual references the City’s Master Flood Control and Drainage Plan, which is essentially the Riverside County Flood Control Master Drainage Plans for the Hemet area with different naming conventions for the same systems. Therefore, the manual now references the Riverside County Flood Control & Water Conservation District (RCFC&WCD) Master Drainage Plan, as this plan has been updated and continues to have studies done in support of the design of these systems. The City can also request capital improvement plan (CIP) funding from RCFC&WCD for the

18.B

construction of the Master Drainage Plan Facilities identified in the RCFC&WCD Master Drainage Plan.

The City may also request that storm drain systems that are greater than 36” in diameter be owned and maintained by RCFC&WCD. When this request is made, RCFC&WCD requires that systems be designed and built per their standards, including their Hydrology Manual and Hydraulic Manual.

Since most of the sections included in the existing adopted manual are consistent with the RCFC&WCD Hydrology Manual and the RCFC&WCD Hydraulic Design Manual, the sections related to these topics were removed and the RCFC&WCD manuals were referenced. This also allows for any future changes to these manuals to be included in the proposed Storm Drain and Drainage Design Manual update.

Revisions to the increased runoff mitigation policy are also being recommended to be consistent with the Riverside County Interim Basin Design Criteria. This criteria requires mitigation of increased runoff of the 2-year, 5-year, and 10-year storm events for the 1-hour, 3-hour, 6-hour and 24-hour storm durations. It has been shown that when these smaller duration storm events, especially the 24- hour durations, are mitigated, the 100-year, 3-hour storm event is also mitigated. Additionally, these smaller storm events have been shown to cause more impacts related to downstream erosion than the 100-year storm events; therefore by implementing this policy, downstream erosion and increased runoff for larger storm events can both be addressed. The currently adopted City policy is for mitigation of the 100-year, 3-hour storm duration without specifics to how this is accomplished. The updated manual provides specifics required for preliminary drainage report submittals and for final drainage report submittals.

DISCUSSION:

By updating the current drainage manual, the City can ensure that facilities are designed to meet current requirements. Deferring to the RCFC&WCD Hydrology Manual and Hydraulic Design Manual ensures systems are designed consistently, and streamlines the process for facility maintenance and ownership by RCFC&WCD. The updated mitigation requirements provide detailed requirements for submittals, also but impacts, event storm large that only not policies updated and address downstream erosion from smaller storm durations. Therefore, Staff recommends that the City Council adopt the updated Storm Drain and Drainage Design Manual.

A copy of the originally adopted manual and a clean version of the revised manual have been included as Attachments. The track changes version is difficult to follow with numerous formatting issues due to the fact that the word document was created from the 1996 PDF file and was therefore not attached to this report.

PREVIOUS COUNCIL ACTION:

September 24, 1996 – City Council adopted the Storm Drain Development Standards, Storm Drain Criteria and Drainage Manual (Resolution No. 3257)

STRATEGIC PLAN INTEGRATION:

GOAL FIVE: ORGANIZATIONAL EFFECTIVENESS
To identify the work needed inside the City organization to effectively provide services to the community and ensure financial stability.

Objective 1: Operate in a financially sustainable manner.

18.B

Objective 2: Evaluate existing practices to ensure continuity with industry best practices.

Objective 3: Provide Council with policies that are consistent while lessening liabilities.

Objective 4: Increase employee retention by training and creating a positive workplace.

Objective 5: Streamline fire prevention coordination efforts.

FISCAL IMPACT:

There is no fiscal impact to the City's General Fund.

ALTERNATIVE(S):

1.Do not adopt the revisions.

2.Provide alternative direction to the City Manager.

ATTACHMENT(S):

Attachment 1: Resolution Storm Drain and Drainage Design Manual Attachment 2: Original Storm Drain Development Standards, Storm Drain Criteria and Drainage Design Manual
Attachment 3: Updated Storm Drain Criteria and Drainage Design Manual

18.B

CITY OF HEMET RESOLUTION NO. 2024-XXX 1

CITY OF HEMET

HEMET, CALIFORNIA
RESOLUTION NO. 2024-xxx

A RESOLUTION OF THE CITY COUNCIL OF THE CITY

OF HEMET, CALIFORNIA, ADOPTING THE STORM

DRAIN AND DRAINAGE DESIGN MANUAL, A

REPLACEMENT OF THE CURRENTLY ADOPTED

STORM DRAIN DEVELOPMENT STANDARDS, STORM
DRAIN CRITERIA AND DRAINAGE DESIGN MANUAL.

The City Council of the City of Hemet, California (hereafter referred to as the “City Council”) does resolve as follows:

WHEREAS, in 1996, the City of Hemet adopted the Storm Drain Development Standards, Storm Drain Criteria and Drainage Design Manual that established drainage policy for projects within the City; and
WHEREAS, several sections within the currently adopted manual include outdated standards and policy; and
WHEREAS, City staff reviewed the current manual and has developed proposed revisions throughout the currently adopted manual; and
WHEREAS, revisions to sections that include Hydrology, Hydraulics, and Retention Basin criteria are proposed in order to be consistent with RCFC&WCD criteria and to adopt more detailed policies related to increased runoff mitigation; and WHEREAS, by updating the current drainage manual, the city can ensure that facilities meet current requirements, streamline the process for RCFC&WCD maintenance and operation, and provide detailed requirements for increased runoff mitigation requirements, and;

18.B

CITY OF HEMET RESOLUTION NO. 2024-XXX 1
WHEREAS, City Staff recommends adopting the Storm Drain and Drainage Design Manual, which is a replacement of the currently adopted Storm Drain Development Standards, Storm Drain Criteria and Drainage Design Manual.

NOW, THEREFORE, THE CITY COUNCIL OF THE CITY OF HEMET FINDS, DETERMINES, ORDERS AND RESOLVES AS FOLLOWS:

SECTION 1.The above recitals are all true and correct.

SECTION 2. The City Council hereby adopts the Storm Drain and Drainage Design Manual, and replaces the Currently Adopted Storm Drain Development Standards, Storm Drain Criteria and Drainage Design Manual.

SECTION 3.This resolution shall take effect upon its adoption.

PASSED, APPROVED AND ADOPTED this 11th day of June, 2024. ____________________________
Joe Males, Mayor
ATTEST:
_____________________________
John Paul Maier, City Clerk

18.B

CITY OF HEMET RESOLUTION NO. 2024-XXX 1
State of California )
County of Riverside )
City of Hemet )
I, John Paul Maier, City Clerk of the City of Hemet, do hereby certify that the foregoing resolution was adopted by the Hemet City Council on the 11 th day of June, 2024, and was passed by the following vote:

AYES: Council Members:

NOES: Council Members:

ABSTAIN: Council Members:

ABSENT: Council Members:
_____________________________
John Paul Maier, City Clerk

18.B

StandardsCriteriaandManual
HEMET
StormDrainDevelopmentStormDrainDrainageDesign
ADOPTEDSEPTEMBER24,1996

18.B

NTENTS
SectionN0.SECTION1
SECTION2
TableContents

TABLEOFCO
DescrigtionGENERALPROVISIONS.............1.1ShortTitle...................1.2Jurisdiction...................1.3Purpose.....................1.4EnactmentAuthority...........1.5AmendmentandRevisions.......1.6EnforcementResponsibility......1.7ReviewandApproval...........1.8Interpretation.................1.9RelationshiptoOtherStandards...1.10WaiversfromtheseCriteria......1.11Abbreviations.................DRAINAGEPLANNH‘IGSUBMITTALREQUIREMENTS2.12.2

2.3 ReviewProcessPreliminaryDrainageReport..................2.2.1PreliminaryReportContents............2.2.2DrawingContents....................A.GeneralLocationMap........B. FloodplainInformation........C.DrainagePlan...............FinalDrainageReport.......................2.3.1PhaseII:FinalReportContents.........I. Narrative..................II. HydrologyCalculations........III.HydrologyMap.............IV .SystemSchematic............V .HydraulicCalculations........VI.References.................2.3.2DrawingContents..................... GeneralLocationMap........B.FloodplainInformation........C.DrainagePlan............... m
p—lp—A_| p—Ip—lp—l#INp—Ah—lp——lj—ly—A?
1-21—21-21-21-32-12-12-12-22-42-42-42-42-52-62-62-62-62-72-82-82-82-82-82-8 Page1

18.B

SectionN0.SECTION3
SECTION4
SECTION5
SECTION6
TableContents
Description mDRAH‘IAGEPOLICY................................ 3-13.1 FacilitiesPlanning.............................3-13.1.1MasterPlanning.......................3-13.1.2SpecialPlanningAreas..................3-43.1.3FloodplainManagement.................3-53.2StormRuno?°Retention........................3-53.2.1StormRunoffRetention.................3-53.2.2Multi-PurposeConcept..................3-63.2.3DesignDevelopmentCriteria.............3-7FLOODPLAINREGULATIONS4-14.1NationalFloodInsuranceProgram(NFIP) 4-1RAINFALLANDRUNOFF............................5-15.1Rainfall..................................... 5-15.2Intensity-DurationCurves......................5—25.3PointPrecipitation............................5-25.3.1DesignStormIsohyetalMaps.............5-25.3.2PrecipitationIntensityPattern.............5-35.3.3PrecipitationDepth-AreaAdjustment.......5-35.4Runo?..................................... 5-35.4.1AnalyticalMethods.....................5-35.4.2ApplicabilityofMethods.................5-35.5RationalMethod.............................5-35.5.1Assumptions..........................5-35.5.2RationalFormula......................5-35.6TimeofConcentration.........................5-35.7SyntheticUnitHydrograph......................5-45.7.1DevelopmentofSyntheticUnitHydrographs..5—45.7.2DevelopmentofFloodHydrographs........5-55.8SubmittalRequirements........................5-55.9ListofVariables..............................5-55.10References..................................5-6STREETDRAINAGE................................6-16.1StreetClassi?cation...........................6-16.2DesignCriteriaforStreets......................6-36.2.1DesignFrequency......................6-36.2.2PavementEncroachment.................6-4 Page2

18.B

SectionN0.SECTION6
SECTION7
TableContents
Description ngeNo.STREETDRAINAGE(continued)6.2.3TheoreticalCapacity..................6-46.3CatchBasins..............................6—46.4DesignCriteria.............................6-46.4.1General............................6-46.4.2Limitations.........................6-56.4.3LengthRequirements.................6-56.4.4SeriesCatchBasins...................6-56.5.5InteriorDimensions...................6-56.5.6LocalDepressions....................6-66.5.7ConnectorPipe......................6—66.5DesignProcedureforConnectorPipeand“V”Depth6-66.5.1SingleCatchBasins...................6-66.5.2CatchBasinsinSeries.................6-86.6DesignAids...............................6-106.7 Checklist.................................6-156.8ListofVariables............................6-156.9References................................6-15OPENCHANNELHYDRAULICS...........L..........7-17.1Arti?cialChannels............................7—17.1.1RouteConsiderations...................7-17.1.2ChannelSelection......................7-27.1.3DescriptionofChannelTypes.............7-27.1.4LowFlowChannels....................7-67.2DesignofArti?cialChannels....................7-67.2.1OpenChannelHydraulics................7-77.2.2DesignofRigidChannels................7—97.2.3PreliminaryDesign....................7-127.2.4FinalDesign.........................7-137.3NaturalChannels............................7-137.3.1AnalysisofNaturalChannels.............7-137.3.2RequirementsforNaturalChannels........7—147.3.3ApplicableMethodologies...............7-157.4ChannelLinings.............................7-167.4.1ConcreteLinedChannels................7-167.4.2RiprapLinedChannels.................7-177.4.3GroutedRock........................7-187.4.4ToeProtection.......................7-187.4.5GrassLinedChannels..................7-197.5 DesignProcedures...........................7-207.5.1Arti?cialChannels.....................7-207.5.2DesignExample......................7-23 Page3

18.B

SectionN0.SECTION7
SECTION8
TableContents
Description PageNo.OPENCHANNELHYDRAULICS(continued)7.6DesignAids....................7-297.7ListofVariables.................7-327.8 References.....................7-32HYDRAULICSTRUCTURES.......................... 8-18.1ChannelDropStructures.......................8-18.1.1BasicComponentsofaDropStructure......8-18.1.2DropStructureTypes...................8-18.2GeneralDesignProcedures......................8-38.2.1CrestandUpstreamHydraulics............8—58.2.2WaterSurfacePro?leAnalysis............8-58.2.3DropSelection........................8-98.3DesignGuidelinesforDropStructures............8-108.3.1Baf?eChuteDrops....................8-108.3.2VerticalHardBasinDrops..............8-168.3.3VerticalRiprapBasinDrops.............8-298.3.4SlopingConcreteDrops................8-228.3.5LowFlowCheckStructures.............8-258.4ConduitOutletStructures......................8-258.4.1RiprapProtectionatConduitOutlets.......8-258.4.2ConcreteOutletStructures..............8-278.4.3ImpactStillingBasin...................8-358.4.4Baf?eChuteEnergyDissipator...........8-378.5SpecialChannelStructure......................8-408.5.1ChannelTransitions....................8-408.5.2SupercriticalFlowStructures............8-408.6CharacteristicsoftheHydraulicJump.............8-418.6.1JumpHeight.........................8-428.6.2JumpLength.........................8-428.6.3SurfacePro?le.......................8-428.6.4JumpLocation.......................8-428.6.5UndularJump........................8-428.6.6DesignAids.........................8-438.7DesignExamples............................8-508.7.1OpenChannelDropStructures...........8-528.8ListofVariables.............................8-558.9References.................................8-56 Page4

18.B

SectionNo. mm MSECTION9 CONDUITS.........................................9-19.1 StormDrains................................9-19.1.1GeneralHydraulicCriteria................9-19.1.2HydraulicDesign......................9-29.2HeadLossinClosedConduits...................9-29.2.1FrictionLoss..........................9—39.2.2TransitionLoss........................9-39.2.3JunctionLoss.........................9-49.2.4ManholeLoss......................9-59.2.5BendLoss............................9-59.2.6AnglePointLoss.......................9-59.2.7SpecialCases.........................9-69.3DesignRequirementsforMaintenanceandAccess....9-79.3.1Manholes............................9-79.3.2MinimumSlope........................9-89.3.3MinimumPipeSize.....................9-89.3.4InletStructures........................9-89.3.5OutletStructures.......................9-89.4DesignRequirementsforJunctions................9-99.4.1InletstoMainLineDrains..... '
...........9—99.4.2AngleofCon?uence....................9-99.5Culverts....................................9-99.5.1CulvertCriteria.......................9-109.5.2Inlets...............................9-119.5.3Outlets.............................9-129.5.4DesignProcedures....................9-129.5.5CulvertRatingCurves..................9-159.5.6RoadwayOvertopping.................9-169.5.7DesignAids.........................9-179.6ListofVariables.............................9-409.7References.................................9—40SECTION10DETENTION/RETENTION10-110.1LimitationsonUseofDetention/RetentionFacilities10-110.1.1RegionalDetention/RetentionFacilities... 10-110.2DesignCriteria............................10-210.2.1CriteriaforDetention/RetentionFacilities. 10—210.2.2CriteriaforSpecialDetention/RetentionMethods..........10-510.2.3EmbankmentDesignCriteria...........10-910.3 DesignConsiderations......................10-1010.3.1Access...........................10-10 TableContents Page5

18.B

SectionNo.SECTION10
SECTION11
TableContents
Description M);DETENTION/RETENTION(continued)10.3.2SedimentRemoval..................10-1110.3.3MaintenanceofLowFlowChannelsandDrainageStructures.................10-1110.4Multiple-useConcepts......................10-1110.4.1PotentialUses......................10-1110.5 WaterQuality.............................10-1210.5.1RoleofDetention/RetentionFacilitiesinWaterQualityControl...............10—1210.6FloodRouting...........................10-1310.6.1FloodRoutingthroughDetentionFacilitiesbytheStorage—IndicationMethod......10-1310.6.2FloodRoutingSampleProblem........10-1810.6.2.1Given...........................10-1710.6.2.2Solution.........................10-1910.7ListofVariables..........................10—2410.8References..............................10-24EROSION&SEDIMENTCONTROL..................11-111.1ErosionandSedimentationProcess..............11-111.1.1FactorsIn?uencingErosion..............11-211.2StormWaterPrograms........................11-211.2.1FederalNPDESProgram...............11-311.2.2StateNPDESProgram.................11-311.2.3MunicipalNPDESProgram.............11-311.2.4OtherStateandLocalPrograms..........11-511.3StormWaterPollutionPreventionPlans...........11-511.3.1PlanningPhase.......................11-611.3.2DesignPhase.........................11-611.3.3ConstructionPhase....................11-811.4BestManagementPracticesSection.............11-1111.4.1De?neBMPObjectives................11-1211.4.2IdentifyBMPCategories...............11-1311.4.3SelectingBMPsforContractorActivities..11-1611.4.4SelectingBMPsforErosionandSedimentControl...........................11-1711.4.5SelectionofPost-ConstructionBMPs.....11-2211.5MeasuringBMPPerformance..................11-2311.5.1SiteInspections......................11-2311.5.2Certi?cationofCompliance.............11-2311.5.3BMPsMonitoring....................11-2411.5.4RecordKeeping.....................11-2611.5.5SWPPPReviewandModi?cations.......11-2611.6Worksheets...............................11-26Page6

18.B

LISTOFILLUSTRAFIGURESFigure6.1TypicalStreetCrossSections........6.2CatchBasinCapacities............6.3CatchBasinCapacities.............6.4CatchBasinCapacities.............6.5CatchBasinCapacitiesSumpCondition7.17.27.37.4CurvesforDeterminingtheNormalDepthforUniformFlowinOpenChannels.................................7.5CurvesforDeterminingtheCriticalDepthinOpenChannels8.1TypicalDropStructureComponents...8.2DropStructureTypes..............8.3TypicalVerticalDropCrest..........8.4TypicalSlopingDropCrestCon?guration8.5TypicalBaf?edChuteDropStructure..8.68.78.88.9VerticalHardBasinDrop..............8.10VerticalRiprapBasinDrop............8.11CurvesforScourDepthatVerticalDrop..8.12StillingBasinsforSlopingConcreteDrops8.13DetailsforRiprappedCulvertEnergyBasin8.148.15DimensionlessRatingCurvesfortheOutletsofCircularCulvertsonHorizontalandMildSlopes................................................8.16RelativeDepthofScourHoldVersusFroudeNumberatBrinkofCulvertwithRelativeSizeofRiprapasaThirdVariable........................

ListIllustrations
6-26-116-126-136—14
7-31
Page

18.B

Figure8.178.18GeneralDesignoftheUSBRTypeVIImpactStillingBasin..8.19DesignWidthoftheUSBRTypeVIBasin...............8.20Modi?cationstoImpactStillingBasins.................8.21Baf?eChutatConduitOutlet.........................8.22HeightofaHydraulicJumpforaHorizontalRectangularChannel...............................8.23HeightofaHydraulicJumpforaHorizontalTrapezoidalChannel.........................................8.24LengthofHydraulicJumpforRectangularChannels.......8.25LengthofaHydralicJumpforNon-retangularChannels.....8.26SurfacePro?leofaHydraulicJump....................9.19.29.3CulvertDesignForm........................................9.4OutletControlNomograph(Schematic)..........................9.5DischargeCoef?cientandSubmergenceFactorforRoadwayOvertopping...............................................9.6HeadwaterDepthforConcretePipeCulvertswithInletControl..........9.7HeadwaterDepthforCMPCulvertswithInletControl..............9.8HeadwaterDepthforCircularPipeCulvertsWithBeveledRingInletControl9.9CriticalDepthforCircularPipe................................9.10HeadforConcretePipeCulvertsFlowingFull.....................9.11HeadforStandeC.M.PipeCulvertsFlowingFull.................9.12HeadwaterDepthforBoxCulvertswithInletControl...............9.13HeadwaterDepthforaRectangularBoxCulvertwithInletControl,FlaredWingwalls(18to33.7Degreesand45DegreesandBeveledEdgeattheTopoftheInlet................9.14HeadwaterDepthforInletControlRectangularBoxCulverts90°Headwall-ChamferedorBeveledInletEdges..................9.15CriticalDepthRectangularSection..............................9.16HeadforConcreteBoxCulvertsFlowingFull.....................9.17HeadwaterDepthforOvalConcretePipeCulvertsLongAxisVerticalwithInletControl................................9.18HeadwaterDepthforOvalConcretePipeCulvertsLongAxisVerticalwithInletControl................................9.19CriticalDepthforanOvalConcretePipe—LongAxisHorizontal........9.20CriticalDepthforanOvalConcretePipe—LongAxisVertical.........

ListIllustrations
FIGURES(continued)
RelativeDepthofScourHoleVersusFroudeNumberatBrinkofCulvertwithRelativeSizeofRiprapasaThirdVariable.. m
8-328-348-368-388-398-448-458-468-478-48
9—49-199-209-209-219—229-239—249-259-269-27
9-289-299—309-319—329—339-349-35
Page2

18.B

FIGURES(continued)Figure PageNo.9.21HeadforOvalConcretePipeCulvertsLongAxisHorizontalorVertical—FlowingFull...............................9-369.22HeadwaterDepthforCM.Pipe-ArchCulvertwithInletControl9-379.23HeadforStandardC.M.Pipe-ArchCulvertsFlowingFull.... 9-3810.1FloodRouting(In?owandOut?owHydrograph).............10-310.2RectangularConcreteChannelSection.....................10-510.3DetentionFacilityOutletDetails.........................10-710.4JurisdictionalDarnDe?nition.............1‘.............10-810.5DevelopmentoftheStorage-Out?owFunctionforLevelPoolRoutingontheBasisofStorage—ElevationandElevation-Out?owCurves............................................10-1610.6Storage-Out?owFunctionforSampleProblem.............10-2110.7ComparisonofIn?owandOut?owHydrographs............10-23 ListIllustrations Page3

18.B

6.1 TABLES
Traf?candDrainageClassi?cation........6.2DesignStormFrequenciesforStreetDrainage7.1Arti?cialChannelPropertiesSimpli?edDesignProcedure7.2RequiredConcreteLiningThickness...............7.3RequiredShortcreteLiningThickness..............7.47.57.67.7ToeProtectionCut-OffDepths.............7.8Simpli?edDesignProcedureDesignChecklistforArti?cialChannels.......................7.9DesignChecklistforNaturalChannels........7.10ScourDepthsinOuterCurves..............7.11Manning'sRoughnessCoe?icients...........8.1GeneralSeepageCutoffTechniqueSuitability......8.2TypesofHydraulicJumps.....................8.3UniformFlowinCircularSectionsFlowingPartlyFull8.4CalculationsofBasinDimensions................9.1HeadLossCoefficient,CforUsewithEquation9.13......9.2EntranceLossCoef?cientsOutletControl,FullorPartlyFullEntranceHeadLoss...............................10.1EmergencySpillwayDesignCapacityRequirementsforanEmbankmentDamthatisnotregulatedbyADWR10.2SpillwayDischargeEquations....................10.3WaterSurfaceElevation-StorageRelationship........10.4Storage-Out?owRelationshipforaDetentionReservoir10.5RoutingofFlowthroughDetentionBasin...........11.1AllowableNon-StormWaterDischargesforConstructionSites11.2ExistingRegulationsforStormWaterPollutionControl......11.3BaseMap(s)ofSiteforSWPPPandOtherSitePlanning.....11-4ContentsoftheNoticeofIntent.......................11-5CategoriesofBMPsandtheBMPObjectivesMetbyEach..

ListIllustrations
7-77-167-17A-3A—4A-47-237-257-267-327—338-88-418-498-529-109—4510-1010-1510-2010-2110-2211-211-411-511-911-15 Page4

18.B

PLATES
P_lat_e PageNo.5.1RainIntensity-InchesPerHour......... .5-75.2RunoffCoef?cientCurvesSoilGroupA.. .5-85.3RunoffCoef?cientCurvesSoilGroupB.. .5-95.4RunoffCoef?cientCurvesSoilGroupC.. 5-105.5RunoffCoef?cientCurvesSoilGroupD.. 5-115.6TimeofConcentrationforInitialSubArea. 5-125.7Velocity-Discharge-SlopeRelationshipsNaturalValleyChannels5-135.8Velocity-Discharge-SlopeRelationshipsNaturalValleyChannels5-14 ListIllustrations Page5

18.B

18.B

1.1 1.2

1.3 1.4

1.5 GENERALPRO
SHORTTITLETheseregulationstogetherwithallfutureamendmentsshallbeknownasthe"CityofHemetStormDrainDevelopmentStandards,StormDrainCriteriaandDrainageDesignManual"(hereaftercalledMANUAL)beingpartofandsubjecttotheCityofHemetMunicipalCode(hereaftercalledCODE).JURISDICTIONThisMANUALshallapplytoalllandwithintheincorporatedareasoftheCity,includinganypubliclands.ThisMANUALshallapplytoallfacilitiesconstructedonCityright-of-wayeasementsdedicatedforpublicuse,andtoallprivatelyownedandmaintainedstormwaterdrainagefacilities.PURPOSEThisMANUALshallestablishtheminimumdesignandtechnicalcriteriafortheanalysisanddesignofallhydraulicstructuresandstormwaterdrainageanddetentionfacilities.Allsubdivisions,plannedunitdevelopments,buildingpermitapplicationsoranyotherproposedconstructionsubmittedforapprovalundertheprovisionsoftheCODE,shallincludeanadequatestormdrainagesystemanalysisandappropriatedrainagesystemdesign.SuchanalysisanddesignshallmeetorexceedthecriteriasetforthwithinthisMANUAL.OptionstotheprovisionsofthisMANUALmaybesuggestedbytheapplicant.TheburdenofproofthattheoptionsareequaltoorbetterthanthecriteriainthisMANUAL,istheresponsibilityoftheapplicant.Policiesandtechnicalcriterianotspeci?callyaddressedinthisdocumentshallfollowtheprovisionsspeci?edbytheCityofHemet.DrainagefacilitiesinplaceorunderconstructionshallbeacceptedwithoutregardtotheprovisionsofthisMANUAL.ENACTMENTAUTHORITYTheMANUALhasbeenadoptedpursuanttotheauthorityconferredupontheCityofHemetthroughtheCaliforniaGovernmentCode.AspartoftheauthorityprovidedtotheCitybytheStateandspeci?edwithintheCODE,thisMANUALwasadoptedbyresolutionandisconsideredpartoftheCODE.AMENDMENTANDREVISIONSThepoliciesandcriteriacontainedintheMANUALmaybeamendedasnewtechniquesaredevelopedand/orifexperienceindicatesaneedforrevision.AmendmentsandrevisionstothisMANUALshallbemadeonaperiodicbasis,asneeded,andshallbeenactedbyaresolutionoftheCityCouncil.

Provisions Page1-1

18.B

LlHaul-ml".:m-?Trnl-?'?-‘n—‘lmill-h 'I-l.

IJ lull-IF-mIIIiJ "II-l-"- En. m“?n'l'-'hh-?ul-Ildh-h?'lu -.in “In-JI- u?-I-I-I'J-I-Lehl-I .I.I. h-r‘ lI-l-III—II F. -'-I--I'I-'Ih ?ll-Flin.“
.l m-uh-I-Hh-?I-II “In-Fl
an
_Il--' *II
m

1.6 1.8

1.9 1.10
ENFORCEMENTRESPONSIBILITYItshallbetheresponsibilityoftheCityofHemetPublicWorksDirectororhisrepresentativetoenforcetheprovisionsofthisMANUAL.REVIEWANDAPPROV ALTheCityofHemetwillreviewalldrainagesubmittalsforgeneralcompliancewiththisMANUAL.ProjectapprovalbytheCityofHemetdoesnotrelievetheowner,engineer,ordesignerfromtheresponsibilityofensuringthatthecalculations,plans,speci?cations,construction,andrecordeddrawingsareincompliancewiththecriteriacontainedintheMANUAL.TheCityofHemetmayrequestotherresponsibleagenciestoreviewanyreportsorplanstodeterminetheirconsistencywiththerequirementsofthisMANUAL.INTERPRETATIONIntheinterpretationandapplicationoftheprovisionsofthisMANUAL,thefollowingprovisionsshallapply:
0Initsinterpretationandapplication,theprovisionsshallberegardedastheminimumrequirementsfortheprotectionoftheenvironmentandthepublichealth,safety,andwelfareoftheresidentsoftheCityofHemet. 0WhenevertheprovisionsofthisMANUALcon?ictwiththeCODEorotherapplicablelaw,themostrestrictivestandardsorrequirementsshallapply. 0ThisMANUALshallnotabrogateorannulanypermitsorapproveddrainagereportsorconstructionplansissuedbeforetheeffectivedateofthisMANUAL.RELATIONSHIPTOOTHERSTANDARDSIftheStateorFederalGovernmentimposesstrictercriteria,standards,orrequirements,thanthosespeci?edinthisMANUAL,thosecriteriashallbeincorporatedintotheMANUALafterappropriatedueprocessandpublichearing(s)areheld.W AIVERSFROMTHESECRITERIAWaiversfromthisMANUALwillbeconsideredonacase-by-casebasisbytheDirectorofPublicWorksorhisrepresentative.AnappealofadecisionbytheDirectorofPublicWorksshallbepreparedandprocessedconsistentwiththeprovisionsoftheCODE.

Provisions Page1-2

18.B

1.11ABBREVIATIONSAsusedinthesecriteria,thefollowingabbreviationsshallapply:CMPCorrugatedMetalPipeCMPACorrugatedMetalPipeArchFEMAFederalEmergencyManagementAgencyFIRMFloodInsuranceRateMapHERCPHorizontalEllipticalReinforcedConcretePipeLACFCLosAngelesCountyFloodControlDistrictLADOWLosAngelesCountyDepartmentofPublicWorksRCBCReinforcedConcreteBoxCulvertRCFCDRiversideCountyFloodControlandWaterConservationDistrictRCPReinforcedConcretePipeROWRight-of-WaySCS SoilConservationServiceSPP StructuralPlatePipeSPPAStructuralPlatePipeArchUSDOTUnitedStatesDepartmentofTransportationUSGSUnitedStatesGeologicalSurvey Provisions Page1-

18.B

DRAINAGESUBMITTAL

18.B

2.2 DRAINAGEPLSUBMITTALREQUIRE
REVIEWPROCESSA11subdivisions,plannedunitdevelopments,orotherdevelopmentproposalsshallsubmitdrainagereports,constructiondrawings/speci?cations,andas-builtinformationinaccordancewiththerequirementsofthissection.Three(3)copiesoftherequireddrainagereportshallbesubmittedtotheCityofHemet.OnecopywillberetainedinboththePublicWorksDepartmentandBuildingDepartment?les.TheCitywillreviewthereports,plans,andspeci?cationscontainedinthereportandprovidewrittenreviewcommentsand/orapprovalwithinthirty(30)workingdaysofthesubmittal.Photostaticcopiesofcharts,tables,nomographs,calculations,oranyotherreferencematerialshallbelegible.Blurredorunreadableportionsofthereportareunacceptableandcouldwarrantresubmittalofthereport.Thesubmittalshallincludeadeclarationofthetypeofreportsubmitted(i.e.,Preliminary0rFinal).Incompleteorabsentinformationmayresultintherejectionofthereport.TheCityofHemetwillinitiatethereviewofadevelopmentrequestuponacceptanceofacompletepreliminaryor?naldrainagereport.Staffwillmakeeveryefforttocompletethereviewandcommentwithinthetimeperiodspeci?ed.However,theCitycannotguaranteethetimeforreview,norwillanyreportbedeemedautomaticallyapprovedduetothelengthofthereviewperiod.Apre-applicationconferencewitharepresentativeofthePublicWorksDepartmentisrecommendedforallapplicantspriortosubmittalofaPreliminaryorFinalDrainageReport.Atthismeeting,generalinformationregardingdevelopmentregulations,requiredprocedures,possibledrainageproblemsandsolutions,andspeci?csubmittalrequirementsforthesubjectsitewillbediscussed.Whentheonlydevelopmentapprovalrequiredisabuildingpermit,thisconferencewillprovideinformationastowhetherornotaPreliminaryand/orFinalDrainageReportwillberequiredbythePublicWorksDepartment.PRELIMINARYDRAINAGEREPORTAPreliminaryDrainageReport(Phase1),isthe?rststepintheapprovalprocess.ApreliminaryDrainageReportisrequiredtobesubmittedaspartofanydevelopmentDrainagePlanningSubmittalRequirements Page2-

18.B

project(unlessspeci?callywaived).Astandalonezonechangeforgeneralplanamendmentapplicationshallnotberequiredtosubmitadrainagereport,unlesssuchamendmentistotheMasterFloodControlandDrainagePlan.Thisreportisintendedtodeterminethefeasibilityanddesigncharacteristicsoftheproposeddevelopment,ataconceptuallevel.However,thoseproblemsthatexiston-sitepriortodevelopmentmustbeaddressedwithinthepreliminaryreport.Allreportsshallbetypedon81/2"x11"paperandbound.Thedrawings,?gures,plates,andtableshallbeboundwiththereportorincludedinapocketattachedtothereport.ThereportshallincludeacoverletterpresentingthepreliminarydesignforreviewandshallbepreparedorsupervisedbyanengineerlicensedinCalifornia.Thereportshallcontainacerti?cationwhichshallreadasfollows:"Iherebycertifythatthisreport(plan)forthePreliminaryDrainagedesignof1NameofDevelopment)waspreparedbyme(orundermydirectsupervision)inaccordancewiththeprovisionsoftheCityofHemetStormDrainDevelopmentStandards,StormDrainCriteriaandDrainageDesignManualfortheownersthereof.IunderstandthattheCityofHemetdoesnotandwillnotassumeliabilityfordrainagefacilitiesdesignedbyothers." RegisteredProfessionalEngineerStateofCaliforniaNo(Af?xSeal)2.2.1PreliminaryReportContentsTheReportshallbeinaccordancewiththefollowingoutlineandcontaintheapplicableinformationlisted:I. NarrativeA.IntroductionB.ScopeofprojectC.Sitedescription1.Generalinformation2.Vegetativecover3.Prominentgeographicfeatures11.SystemSchematicA.ProposedSurfaceImprovements1.Streets/roadsa)centerlineb)right-of-wayc)curbandgutter2.Grading DrainagePlanningSubmittalRequirements Page2-2

18.B

a)b)C)contours/spotelevationsslopesretainingwallsBProposedFloodControlFacilitiesStormDrains1.

IVReferences
a)location/alignmentb)diameter0)?owrated)right-of—waye)outletgeometryf)manhole/junctionlocation1)diameter2)?owrateg)catchbasinlocation1)type0curbinlet0gratedinlet0riser0size(length/depth)0capacity0?ow-by0tributaryareaOpenChannelsa)location/alignmentb)crosssectionc)?owrated)velocitye)lining,ie;1)earthen2)rock3)grass4)concretef)sideinletsl)geometry2)?owrate3)right—of—way Allcriteria,masterplans,andtechnicalinformationreferencedinsupportofthedrainageconceptshallbeidenti?ed.

DrainagePlanningSubmittalRequirements Page2-3

18.B

GeneralLocationMap:Alldrawingsshallbe24"X36"insize.Amap shallbeprovidedinsuf?cientdetailtoidentifydrainage?owsentering andleavingthedevelopmentandgeneraldrainagepatterns.Themap shouldbeatascaleofl”= 200'to1"to1000'andshowthepathofall drainagefromtheupperendofanyoff—sitebasinstothenearestadequateoutletThemapshallidentifyanymajorfacilitiesfromthesubject propertyalongthe?owpathtothenearestadequateoutlet,suchas existingimprovedchannel,regionaldetentionfacilities,culverts,and stormsewersBasinsanddividesaretobeidenti?edandtopographic FloodplainInformation:Anexhibitdisplayingthelocationofthe subjectpropertyshallbeincludedwiththereportasoutlinedinSection

22.1iAllmajordrainagewayswithamapped?oodplainor?oodway
shallhavethelimitsof?oodingshownandincludedinreportdrawings. at1footminimumintervals.15%,themaximumintervalisdaminimumof100feetbeyo imate?oodinglimitsbasedonavailableinformation.tualdrainagefacilitiesincludingdetentionbasins,storm swales,riprap,andoutletstructuresinthedetailconsis-

2.2.2DrawingContentsA.
contoursaretobeincluded.

C.DrainagePlan:Map(s)oftheproposeddevelopmentatascaleof1"= 20'to1"=200'ona24"x36"drawingshallbeincluded.Theplanshallshowthefollowing:1.Existingtopographiccontours Interrainwheretheslopeexceeds 10feet.Thecontoursshallexten ndthepropertylines.2.Allexistingdrainagefacilities.3.Approx4.Concepsewers,tentwiththeproposeddevelopmentplan.5.Majordrainageboundariesandsub-boundaries.6.Anyoff-sitefeaturein?uencingdevelopment.7 Proposed?owdirectionsand,ifavailable,proposedsurfaceimprovementsand/orcontours.8.Alegendtode?nemapsymbols.9.Atitleblockinlowerrightcorner,northarrowandgraphicscale DrainagePlanningSubmittalRequirements Page2-4

18.B

2.3 10.Sealandsignatureofaprofessionalengineer.FINALDRAINAGEREPORTThepurposeoftheFinal(PhaseII)DrainageReportistoupdatetheconcepts,analysis,anddesigndetailsdiscussedinthePreliminary(PhaseI)DrainageReport.Also,anysigni?cantchangetothePreliminaryconceptmustbenotedintheFinalReport.TheFinalDrainageReportshallbesubmittedwithanapplicationfor?naldevelopmentapproval.TheFinalDrainageReportmustbereviewedandacceptedbythePublicWorksDepartmentpriortoacceptingthe?naldevelopmentapplicationforapprovalorrecordation.Allreportsshallbetypedon81/2"x11"paperandbound.Thedrawings,?gures,charts,platesand/ortablesshallbeboundwiththereportorincludedinafolder/pocketattachedatthebackofthereport.Thereportshallincludeacoverletterpresentingthe?naldesignforreviewandshallbepreparedbyorunderthedirectionofanengineerlicensedinCaliforniaandcerti?edasshownaboveinSection2.2,PreliminaryDrainageReport.Thereportshallalsocontainadevelopercerti?cationsheetasfollows:"(NameofDeveloper)herebycerti?esthatthedrainagefacilitiesfor(?ameofDevelopment)shallbeconstructedaccordingtothedesignpresentedinthisreport.IunderstandthattheCityofHemetdoesnotandwillnotassumeliabilityforthedrainagefacilitiesdesignedand/orcerti?edbymyengineer.IunderstandthattheCityofHemetreviewsdrainageplansbutcannot,onbehalfof1NameofDevelopment),guaranteethat?naldrainagedesignreviewwillabsolve“?ameofDeveloper)and/ortheirsuccessorsand/orassignsoffutureliabilityofimproperdesign.Ifurtherunderstandthatapprovalofthe?naldevelopmentapplicationand/or?naldevelopmentplandoesnotimplyapprovalofmyengineer'sdrainagedesign." NameofDeveloper
AuthorizedSignatureTheFinalDrainageReportshallbepreparedinaccordancewiththefollowingoutlineandincludethematerialcompletedaspartofthePreliminary(PhaseI)DrainageReport.

DrainagePlanningSubmittalRequirements Page2-

18.B

2.3.1PhaseII:FinalReportContentsI. NarrativeA.IntroductionB.ScopeofprojectC.Sitedescription1.Generalinformation2.Vegetativecover3.ProminentgeographicfeaturesD.MethodologyUsedEConclusions/RecommendationsII.HydrologyCalculationsA.SoilsmapB.Rainfalldata1.RationalMethod3)b)C) d)
TimeofconcentrationRunoffcoef?cientsInitialsubarea1)Area310acres2)Length31000feet

2.SyntheticUnitHydrographa)
g)III.HydrologyMapLegendTitleblock
com?
3)ChangeinelevationTravelTime1)Street?owcalculations2)Pipe?owcalculations3)Channel?owcalculationsLagtime1)Lengthoflongestwatercourse2)Lengthtothecentroidofthearea3)Averageroughnesscoef?cient4)SlopealonglongestwatercourseUnittime(25%to40%oflag)Drainage3300acresAreaadjustmentRunoffindex1)VegetativecoverLowlossratecalculationStormpattern Barscale/northarrow
Watershedidenti?cation1.Sub-areadelineation
DrainagePlanningSubmittalRequirements Page2-6

18.B

2.Sub-areainacres3.Flowpath4.Centroid(hydrographonly)5.Incremental?owE.Soilsgroupidenti?cationF.LanduseG.Proposedonsiteimprovements1.Streets2.GradingH.Storm?ows1.Enteringproject2.Leavingproject3.MajorintersectionsIVSystemSchematicA.BarScale/NorthArrowB.LegendC.TitleBlockD.ProposedSurfaceImprovements1. Streets/roadsa)centerlineb)right-of—wayc)curbandgutter2.Gradinga)contours/spotelevationsb)slopesc)retainingwallsE.ProposedFloodControlFacilities1.Stormdrainsa)location/alignmentb)diameterc)?owrated)right-of—way6)outletgeometryf)manhole/junctionlocation1)diameter2)?owrateg)catchbasinlocation1)type0curbinlet0gratedinlet0riser0size(length/depth)0capacity0?ow—by DrainagePlanningSubmittalRequirements Page2-

18.B

Otributaryarea2 OpenChannelsa)location/alignmentb)cross-sectionc)?owrated)velocitye)liningie:1)earthen2)rock3)grass4)concrete5)sideinlets:0geometry0?owrate0right-of—wayVHydraulicCalculationsStreetFlowCatchBasinCapacityStormDrainsCulvertsCapacityOpenChannelInletCapacity meOWP
VI.ReferencesAllcriteria,masterplans,andtechnicalinformationreferencedinsupportofthedrainageplanshallbeidenti?ed.2.3.2DrawingcontentsA.GeneralLocationMap(SeeSection2.2.2):B.FloodplainInformation(SectionSection2.2.2):C.DrainagePlan;Map(s)oftheproposeddevelopmentatascaleof1"=20"tol"=200'ona24"x36"drawingshallbeincluded.Theplanshallshowthefollowing:1 Existingandproposedcontoursat1footmaximumintervals.Thecontoursshallextendaminimumof100feetbeyondthepropertylines.ThecontourintervalmaybeincreasedatthediscretionoftheCityEngineer.

DrainagePlanningSubmittalRequirements Page2‘8

18.B

10. ll.
12 13
DrainagePlanningSubmittalRequirements
Propertylinesandeasementswiththeirintendeduseshallbenoted.Streets,indicatingright-of-waywidth,?owlinewidth,curbtype,andapproximateslopes.Existingdrainagefacilitiesandstructures,includ-ingirrigationditches,roadsideditches,crosspans,drainageways,andculverts.A11pertinentinfor-mationsuchasmaterial,size,shape,slope,andlocationshallalsobeincluded.Overalldrainageareaboundaryanddrainagesub-areaboundaries.Proposedtypeofstreet?ow,suchasverticalorcombinationcurbandgutter,roadsideditch,gutter,slopeand?owdirections,andcrosspans.Proposedstormsewersandopendrainageways,includingoutlets,manholes,culverts,andotherappurtenances,includingriprapprotection.Proposedoutfallpointforrunofffromthedevelopedareaandfacilitiestoconvey?owstothe?naloutfallpointwithoutdamagetodownstreamproperties.Routingandaccumulationof?owsatvariouscriticalpointsfortheinitialstormrunofflistedonthedrawing.V olumesandreleaseratesforretentionordeten-tionstoragefacilitiesandinformationonoutletworks.Thelocationandelevations,ifavailable,ofallexisting?oodplainsaffectingtheproperty.Routingofoffsitedrainage?owthroughthedevelopment.Thede?nitionof?owpathleavingthedevelop-mentthroughthedownstreampropertiesendingatamajordrainagewayorfacility.

Page2-9

18.B

14.Alegendtode?nemapsymbols.15.Atitleblockinlowerrighthandcorner.AmylarreproducibleoftheapprovedFinalDrainagePlanshallbesubmittedtotheCityofHemetforsignatureandretentionintheir?les.Acopyoftheapprovedplanwillbereturnedtotheapplicant.

DrainagePlanningSubmittalRequirements Page2-

18.B

18.B

OLICYDRAINAGEP
Floodingisasigni?cantconcernwhichaffectstheuseofproperty,theprovisionofpublicservicesandthehealthofCityresidents.Provisionforadequatedrainageinurbanareasisnecessarytopreserveandpromotethegeneralhealth,welfareandeconomicwell-beingoftheregion.Drainageisaregionalfeaturethataffectsallgovernmentalagenciesandallparcelsofland,makingitnecessarytoformulateaprogramthatbalancesbothpublicandprivateinterests.TheCityofHemethasexpendedasigni?cantamountofresourcestoplananddevelopadrainagesystemthatprovidesconsiderablebene?ttothepublic.Thelong-termgoaloftheCityistocompletetheimprovementsspeci?edintheCity'sMasterFloodControlandDrainagePlanoranyupdatethereto.Toachievethisgoal,thefollowingobjectiveshavebeenestablished:
0 Reducethehazardstoindividualsandpropertycausedbyundertakingbothshort-andlong-tennimprovementstoprotectthehealth,safetyandwelfareofarearesidents. 0 Improvevehicularandpedestriancirculation.
0 Improvetheabilityofemergencyservicestoprovidetimelyandnecessaryassistance 0 Controlthequalityofwaterthatiseitherreleasedontodownstreampropertiesorallowedtopercolateintogroundwaterbasins.0 Ensuredownstreampropertiesarenotadverselyaffectedbyupstreamimprovements.Theseobjectivescanbemadeoperationalthroughasetofpolicystatements.Theapplicationofthepolicyisinturnfacilitatedbytechnicalcriteriaanddata.Thefollowingsectionspresentpolicystatementstobeenactedaspartofthemanual.Eachstatementisprecededbyabriefdiscussionoftherequirementsorbasisforthepolicy,followedbytheactualpolicystatement.3.1FACILITIESPLANNING3.1.1MasterPlanningAstheCityofHemetcontinuestogrow,drainageand?oodingwillremainsigni?cantconcerns.Theplanningofdrainagefacilitiesmustbeincludedintheurbanizationprocess.The?rststepistoincludedrainageplanningwithallregionalandlocaldevelopmentmasterplans.

DrainagePolicy Page3-1

18.B

b-.-.| nun-L-I- “Id.-I_#-&L*.th-n'r-I-I--I
u'd-Iu—r'ir-T'Jh-hh-LI-I.“F-I-I-PI r—L-II.?u.- -Jl_l. '1Eu.“ -'--I.'l-.-l “III-.—f-_'-—_'_-l Jun—t. :L??m
El.“-
H H h--
--.Ih h‘hr-?- F-Era—r?-—.rh-u.?.'-I‘#E" :T-‘Hu—n542......“E...?aw:

Ih It l-L'hll h 'l-hi-ill'l'r-I'III— h I‘d-H5—..-
I'. 'f-‘l'fi'lll—I'?l'I-‘?-‘dIIHF
II.P?r?r?ri?-r?—.I. *J'l --I-l'-‘I—h-lhlul-'-'I'I
Stormwatermanagementfacilities,suchasstormdrainsandchannelsprovidebothaconveyanceandstoragefunction.Whenachannelisplannedasaconveyancefeature,itrequiresanoutletaswellasdownstreamstoragespace.Whenthespacerequirementsareconsidered,theprovisionforadequatedrainagebecomesacompetinguseforspacealongwithotherlanduses.Ifadequateprovisionisnotmadeinalanduseplanfordrainagerequirements,stormwaterrunoffwillcon?ictwitheitherlandusesandwillresultinstormwaterdamage,andwillimpairorevendisrupttheabilityofotherinfrastructuresystemstofunction.ThepolicyoftheCityshallbetorequirestormdrainageplanning,includingallocationofspacefordrainagefacilities,foralldevelopmentandredevelopment.Inrecognitionthatdrainageboundariesarenon-jurisdictional,theCityhaspreparedaCity-wideMasterFloodControlandDrainagePlanthatde?nesmajorfacilities.TheCitywillalsoencourageandparticipateinfuturemasterplansontheregionalandlocallevel.ThepolicyoftheCityshallbetoencouragethedevelopment,andperiodicupdate,ofdetailedregionaldrainagemasterplanswhichsetforthrequirementsfornewdevelopmentandidentifytherequiredpublicimprovements.Asaresultoftheplanningprocessafeestructureshallbedevelopedtoprovidefundingforthepublicimprovements.Thefeeswillbebasedonthetotalcostoftherequiredpublicimprovementswithinanareaofbene?t;theareaofbene?tbeingde?nedasadrainagebasin.Asfeesarecollected,theywillbeappliedtotheconstructionofmasterplannedfacilities,ortheacquisitionoffacilities,onaprioritybasis.ThepolicyoftheCityshallbetoapplyfeescollectedfortheinstallationofmasterplanneddrainagefacilitiestowardthoselocationsorprojectswhichexhibitthefollowingcharacteristics:A.Theconstructionorpurchaseofdownstreamfacilities/propertiesdeemedtobeofthehighestimportance.B.Projectswhichareneededtoalleviateasafetyhazard.C.Projectswiththemaximumbene?tforthecostofimprovements.D.Thepurchaseofvacantdownstreampropertywhichdoesnothaveastronglikelihoodfordevelopmentandhasbeenidenti?edasimportanttothecompletionthemasterplannedsystem.

DrainagePolicy Page3-2

18.B

1 r=='-~r;r="m:.I-l-HI'I-lh—I a—Ih'l'l-h-I-rl-Il-F-u-l-?H. h "'l'-|'l'.l' I'h-*I'I'I—IHI -II--r-???l'F—IF‘ 'I-H-H-—-_—_. umlr-I 11-m“. n.'I'f-IHI'II'F III-l:"11“"
mm H._--- —-—.-—.—.l-I-I-II-I"I--?"l' -l-.I'l'h'l'blkhh-hd klq-a- l-—-I-III-"_—-'-'-'l'l Hid —-_—L——r———
I. ”bk ? f-H—Hru rh-T-I-II-—-'J--— I.—j.....—.—_—l'—f——+" tin-am
EE'EEL-r:*L?_-Il—-_._.-.-—_Iu
WWWJ-ln-
WEE--h Illa—nu...“
“ -..IIDrainagePolicy
E.Theconstructionofstormwater/drainagefacilitieswithinexistingstreetorroadrights-of-way.F.Theconstructionofstormwater/drainagefacilitiesonlandwhichhasbeendedicatedtotheCityforuseaspartofthemasterplannedsystemandwhichisadjacenttooralogicalextensionofanexistingmasterplannedfacility.G.Theconstructionofstormwater/drainagefacilitiesonlandwhichhasbeendedicatedtotheCity,butisnotalogicalextensionofanexistingmasterplannedfacility.Recognizingthatthecosttoconstructdrainagefacilitiesisgenerallyhighandthatdrainagefeesonaper-acrebasisareslowtoaccrue,itwillbenecessaryfortheCitytorelyondevelopmenttocarryitsfairshareofthecostburdenoftheconstructionofmasterplannedfacilities.ThepolicyoftheCityshallbetorequirealldevelopmentprojectsadjacenttomasterplannedfacilitiestoconstructsaidfacilities.Developmentprojectsshallbearthetotalcostofconstructingamasterplannedfacilityexcludinglandcosts.Thiscostshallbecreditedagainstthetotalamountofdrainageimpactfeesdueontheproject.Dependentupontheareaandthebenefitprovided,theCitymayusearecaptureorreimbursementagreementtoappropriatelyallocateconstructioncostsbasedonbene?treceived.Masterplannedfacilitiesconstructedfordevelopmentprojectsshallalso:A.Providefortheretentionoftheincrementalincreaseinstormwaterrunofftotheextentregionalretentionbasinsareaddedtothemasterplan.B.Provideaninletfortributaryupstreamrunoffandamethodofmeteringthedownstreamdischarge.Realizingthatamasterplanisadocumentusedtoguidethedevelopmentofanadequatedrainagesystem,provisionsmustbemadefortheintroductionofalternatemethodsofcontrollingstormwater.Theremustbeenough?exibilityintheplanthatthecreativityoftheengineersandplannerspreparingdevelopmentmasterplansisnotsti?ed.ItshallbethepolicyoftheCitytoallowfortheinstallationofdrainagefacilitieswhichdifferfromthedesigncharacteristicscontainedintheCity'sMasterFloodControlandDrainagePlan,providedsuchfacilitieshavethesamedesigncapacity,functionandpurpose.Inaddition,thetypeoffacilityproposedshallbeconsistentwiththetypesoffacilitiesorimprovementswhichexistinthearea.

Page3-3

18.B

'I'l'ibi-u---—-.q--I.-—.H-. -ma-dull-F'-'l b-.--u..-.I_?i. all min-:35;?er-m‘:Ill-F'- q-L-J.

I hhmeH-r-‘l-IIJI-.'-|I-|-I:-m "I.
'- ---Im *l-l—?—I-IIIIII'-L--ul
'- I'm-Funk
I PWWI. h- a“. —-r—-—
I. nan-*—— —
Had—I hn—m-'-—-::-IITTH-r—F‘r?ah-I'Iii—l'hIi-IIH—lu-
‘- nh‘l‘h'J-I‘LH-hh-II“Fl—m—
'- ”hr-hm
'l lam-?...-
a a—-I—-II.-H.I+I.|f_n
I—I—lulf- In-

3.1.2 DrainagePolicy
SpecialPlanningAreasCurrently,thereareareasintheCitywheresigni?cantdrainageproblemsexist.Anynewdevelopmentorredevelopmentintheseareasmaycompoundtheexistingdrainageproblems.ThepolicyoftheCitywillbetoconditiondevelopmentprojectstoconstructthedrainagefacilitiesnecessarytomeettheneedsandmitigatetheimpactscreatedbyeachdevelopmentproposal.Aprojectwhichisphasedorconstructedinanincrementalmannershalleitherbedesignedtoaccommodate,orhaveinplace,amechanismtoensurethateachportionoftheprojectbearsitsproportionatecostoftheprojectimprovements.Inadditiontotheseareas,thereareareasintheCitywherepresentlynoadequateoutletexistsfordrainagebygravity.Ingeneral,therearenomajordrainagefacilitiesornaturalwatercoursesintheseareas.ThepolicyoftheCityshallbetorequiredevelopmentprojectstoconstructadditionaldrainagefacilitiestomeetoneormoreofthefollowingneeds:A.Adevelopmentprojectexacerbatesexistingdrainageproblems.B.Adevelopmentprojectcreatesdrainageproblemsdownstream.C.Facilitiesarenecessarytoprotectdownstreampropertiesfromstormwaterrunoffcausedbydevelopment.D.Facilitiesarenecessarytomitigateidentifiedenvironmentalimpactscausedbydevelopment.Therealsoexistdevelopmentprojectswhichdonotproduceasigni?cantimpactontheenvironment.Inthesecases,itmaybenotnecessarytoprovideahighlevelofanalysistoarriveatmeasureswhichwilladequatelyremovestormwaterfromtheprojectsite.ItshallbethepolicyoftheCitytorequireahydrologystudyforalldevelopmentprojects,exceptthefollowing:A.Singlefamilyhomeconstructiononexistinglots.B.Subdivisionsthatcreatemorethantwo(2)separateparcels.C.Commercialandindustrialdevelopmentonlessthanone-half(1/2)acre.

Page3-4

18.B

I '-I--l-I-'-l-l-I'Id'I—r'-.”J's.“—IML-H-I-.1!“-lI-I-Iq-I-I-‘I—‘I‘I-l-IFH W-Hh?nrih?
'= ”ta-.2“:Emmi-2W;Emmm?m?“Fm-“mar“..-'—.II.-.I.I.l
'-II-

3.1.3FloodplainManagementTheCityhasadopteda?oodplainordinancewhichsetsforthregulationsforthedevelopmentofmapped?oodplains.Theordinancehasbeenwritteninamannerwhichenforcesfederalregulationsrelatedtothedevelopmentof?oodplains.Theordinancehasbeenreproducedandincludedforinformationintheappendixofthismanual.ThedesignerisreferredtotheCity'sordinanceforguidanceduringtheplanningphaseofdevelopmentprojectsin?ood-proneareas.ItshallbethepolicyoftheCitytohaveadevelopmentreviewprocessconsistentwithFEMAguidelinesthatincludesthe?lingofthefollowingdocumentationbytheapplicant:A.AdevelopmentpermitconsistentwithFEMAcriteria.B.Certi?cationofthelowestfloorelevationbyanengineerand/orarchitectdependinguponthelocationofthepropertyanditsrelationshiptothefloodplain.Duringdesigndevelopmentofaproject,instancesmayarisewheretherequirementsofthe?oodplainordinancecannotbemet.Inthisinstance,itmaybeprudentforavariancetobegranted.Ifthisoptionistobeadvanced,afullreportofthecircumstancesrequiringthisapproachshouldbepreparedbythedeveloperandsubmittedforreview.Variancesfor?oodplaindevelopmentshallbereviewedandapprovedbytheCityCouncil.3.2STORMRUNOFFRETENTION3.2.1 DrainagePolicy
StormRunoffRetentionThevalueofstormrunoffretentionaspartofamasterplanhasbeenexploredbymanyindividuals,agenciesandprofessionalsocieties.Retentionisconsideredaviablemethodtoreducethecostsassociatedwiththedevelopmentofadrainagesystem.Temporarilyretainingafewacre-feetofruno?‘cansigni?cantlyreducedownstream?oodhazardsaswellasdownstreamfacilityrequirements.Storagealsoprovidesforsedimentanddebriscollectionwhichhelpsmaintainthequalityofwaterinstreamsandrivers.Thus,publichealthbene?tsmayaccruefromstorageofstormrunoff.However,allbene?tscanonlybeobtainedthroughconsistentadministrationoftheretentionpolicy.ThegoaloftheCityistorequiretheinstallationofon-siteretentionfacilities,orifapplicable,thepaymentofin-lieufeesfortheconstructionofsuchfacilities.Therealizationofthisgoalwillallowforthedevelopmentoflandwhileproducingnonetincreaseinstormrunoff.

Page3-5

18.B

Z'._._'-7'_='£'_" 32—12:;uni-ulna.—
im-
J H—HIHHH‘T—-.--_—q
I'. wm‘?h
i-l-I'_-I-.-.F-
[Hr-1H
—_-I-r—I.r-.r--q-—-hl—
Fi?Lima“Ear—“q...m
“rhl'I-rI-Il-I—nJ-I-HHb-I -_-'-l-'-'-"_-l"-'-l Hall-II“H ‘- -—-— “WI-bar!I I.-.I.
‘W?3-.
min u — ?hhm‘:Elia-W“;

3.2.2 DrainagePolicy
ThepolicyoftheCityrequiresalldevelopmentprojectstoprovidefortheon-siteretentionofstormwaterrunoff.Inthosecaseswhereprojectsarenotlocatedadjacenttoamasterplanneddrainagefacilityandarelessthanone-half(1/2)acreinsize,theCityPublicWorksDirector,orhisrepresentative,shallhavetheoptionofeither:A.Requiringthedevelopmentofonsiteretention,or;B.Allowingthepaymentofaretentionfeeinlieuofprovidingafacility,ifadverseaffectsarenotcauseddownstream,or;C.RequiringtheinstallationofdrainagefacilitieswhichconnecttoMasterPlanorotherfacilities.Asretentionfacilitiesincreaseinsize,itmaybecomereasonabletoincorporatethemintotheexistingmasterdrainageplan.Multi—PurposeConceptDesigndevelopmentofretentionfacilitiesshouldnotonlyconsidertheirprimaryfunction.Duringtheearlystagesofdesigndevelopmentconsiderationshouldbegiventoadditionalusesforthesefacilities.Considerableeffortshouldbeexpendedtodevelopafacilitythatcanbeusedasapark,orintegratedintothedevelopmentsuchthatadditionalusescanbeidenti?edandplanned.Thisisnottosaythattheprimarypurposeofthefacilityshouldbeoverlooked;however,wheneverpossiblethesefacilitiesshouldservemultiplepurposestothecommunity.ThepolicyoftheCityshallrequireallretentionfacilitiestobedesignedasusableopenspaceorformalparksites.Toimplementthispolicythefollowingshallapply:A.Allfacilitiesshallhaveappropriatepedestrianaccess,landscapingandirrigationsystems.B.Parkdevelopmentimpactfeesmaybeappliedtothosefacilitieswhicharespeci?callydesignedasparksitesconsistentwiththeCity'sGeneralPlan.Inadditiontothoseconsiderationsnotedabove,thoughtshouldbegiventothedevelopmentpatternsinthearea.Ifdevelopmentpatternsandtimingaresuchthatagroupofdevelopmentscanutilizeanappropriatelylocatedretentionfacility,everyeffortshouldbetodevelopasiteagreeabletoallconcerns.TheseeffortswillhelpreducethenumberofminimallysizedretentionbasinswhilerespectingtheintentoftheCity'spolicydecision.

Page3-6

18.B

iii-rifI-ILI'II-I-hd-h-h-F-I-l—I-“H'I'I' '-- I'l'l'li-II- hIMhr'l-Ill-H‘l
H'Hr?I “- III-‘m—--m“kw—"I—II him-“-I'H'I-III'I'IHI'II. u—T-I-Irl- ?ll-?n ?rth-WI.m "Ir-r1:-
' rh-

3.2.3 DrainagePolicy
ItshallbethepolicyoftheCitytoencouragepropertyownerswhoareseekingtodevelopadjacentparcelstojointogethertoconstructasingleretentionfacilitythatwillbeofmutualbene?t.TheCitywillassistinprovidingamechanismtoequitablydistributethefacility'sdevelopmentcoststoallpropertyownersbene?tingfromsuchanagreement.Suchamechanismcouldinclude:A.Thereductionoreliminationofdevelopmentimpactfees.B.Arecaptureorreimbursementagreement.C.Amemorandumofunderstanding.D.Acombinationofalltheabove.Asretentionfacilitiesincreaseinsize,theareabene?tingfromtheconstructionofthefacilitiesalsoincreases.Therefore,duringthedesigndevelopmentphase,notonlylocalconcerns,butregionalconcernsshouldbeconsideredwhenlocatinganddevelopinglargeretentionbasins.Ingeneral,retentionfacilitiesone-half(1/2)acreinsizeorgreatershouldbeconsideredforpermanentinclusioninthemasterplanstormdrainsystem.ItshallbethepolicyoftheCitytoconsiderretentionfacilitiesofone-half(1/2)acreorgreaterinsizeforincorporationintotheMasterPlansystemasapermanentfeature.ConsiderationforinclusionintheMasterPlansystemshouldbebasedonthefollowingcriteria,inorderofpriority:A.Thefacilitywillnothaveanadverseaffectuponthehealthorsafetyandwelfareofadjoiningproperties.B.Thefacilityshallbesitedsuchthaton—siteactivitiescanbeproperlypolicedthroughvisualsurveillance.C.Thefacilityshallincludeappropriateandsafeaccessforvehiclesandpedestriansusingthesite.D.Thefacilityshallprovideasafeenvironmentforparkuserswhichisfreefromadverseaffectsofadjoiningusesoractivities.DesignDevelopmentCriteriaPreviousdiscussionhascenteredontheusefulnessofretentionfacilitiesaspartofanoveralldrainagesystem,thegoalsofCity,andgeneralguidelinestobeconsideredduringdesigndevelopmentofretentionfacilities.Tofurtherclarifythedesigndevelopmentprocess,certaingeneralcriteriamustbede?ned.

Page3-7

18.B

DrainagePolicy
ThepolicyoftheCityrequireson-siteretentionfacilitiestomeetthefollowingcriteria:A.Thefacilityshallbeintegratedintotheproject'sdesignusingoneofthemethodslistedbelow,whichmayrendercertainportionsofthepropertyunusableforshortperiodsaftereachstorm.Ifthetypeoffacilityusedisintendedprimarilytoretainstormwaterrunoff,thenamethodshallbeemployedtometerthedischargeandensureallwaterisremovedwithin72hoursafterthestorm.1 FacilitiesforsinglefamilysubdivisionsshallbeconstructedanddeededtotheCityononeormoreparcels.ThesizeofthepropertytobedeededshallbeinconformancewiththeCitydevelopmentstandardsandsubdividedconsistentwiththeexistingsubdivisionpattern.Uponcompletionofthenecessarydownstreamdrainagesystem,thepropertycanbesoldbytheCityforconversiontoresidentialuses.2.Facilitiesformultiplefamilyprojectsshallbeintegratedintoon-sitelandscaping,parkingorrecreationareas.3.Facilitiesforcommercialorindustrialprojectsshallbeintegratedintoparkingand/orlandscapeareas.Allfacilitiesshallbeconstructedinaccordancewiththerequirementsofthismanual.Allretentionfacilitiesshallhaveaninletfortributaryrunoffandamethodofensuringthebasindischargeismeteredtodrainthebasinwithin72hours.Thecharacteristicsofsuchfacilitiesshallbedeterminedbaseduponthefollowinggeneralcriteria,inorderofpriority:1.ThefacilityshallbeconsistentwiththeneedsoftheCity’sMasterFloodControlandDrainagePlan.2.Thefacilitywillnothaveadverseaffectsuponthehealth,safetyorwelfareofarearesidents.3.Thefacilityshallprovidefordualuse,suchasopenspaceorparkfacilities.

Page3-8

18.B

FLOODPLAINRE

18.B

FLOODPLAINREGULA
Theregulationof?oodplainsisnecessarytopreservepublicsafetyandgeneralhealthandwelfareandtopromotetheeconomicwellbeingoftheregion.Thegeneralintentofcurrent?oodplainregulationsissummarizedbelow:- Toreducethehazardof?oodstolifeandproperty;- Topreservethehydrauliccharacteristicsofwatercoursesusedforconveyanceof?oodwaters;and 0 Toprotectthepublicfromexcessive?nancialexpendituresforthedevelopmentof?oodcontrolfacilities.AcopyoftheCityofHemet’s?oodplainordinanceisprovidedforinformationintheappendixofthismanual.ItistheEngineer’sresponsibilitytoutilizethemostcurrentadopted?oodplainordinancesandregulations.4.1NATIONALFLOODINSURANCEPROGRAM(NFIP)TheCityisaparticipantintheNationalFloodInsuranceProgramwhichisadministeredbytheFederalEmergencyManagementAgency(FEMA).Thisprogram’sbasicfunctionistodesignate?ood-proneareasthroughouttheCityofHemet,andtheCountyofRiverside,andsubsequentlymakeavailabletothegeneralpublicvaryingdegreesof?oodinsurance.FEMAdevelopscertain?oodplaindesignationsby?rstcompletingaFloodInsuranceStudyandlateridenti?esthesedesignationsonrelatedFloodInsuranceRateMaps.AFloodInsuranceStudyfortheCityofHemetwasoriginallycompletedinSeptember,1977,andlaterrevisedinAugust,1988andmostrecentlyinSeptember,1990.Inaddition,theassociatedFloodInsuranceRateMapswerealsorevisedinSeptember,1990.EachofthereviseddocumentsareavailableforreviewatthepubliccounterinthePublicWorksDepartment.IssuesinvolvingFEMAshouldbeidenti?edandaddressedduringtheconceptualdevelopmentandinthePreliminaryDrainageReport.Itisconsideredtheresponsibilityofthedeveloper,orthedeveloper’srepresentative,toful?llallofFEMA’srulesandregulationsandtoprepareanyappealsorrevisionsthatmayberequiredasaresultofaproposeddevelopment.IfaLetterofMapRevision(LOMR)oraLetterofMapAmendment(LOMA)isrequiredbyFEMApriortotheremovalofaspecial?oodhazard FloodplainRegulations Page4-1

18.B

zone(lOO-year?oodplain),itwillbetheresponsibilityofthedevelopertoobtainanyandallsuchdocumentspriorto?nalacceptanceofthedevelopmentapplication.

FloodplainRegulations Page4-2

18.B

18.B

RUNOFFRAINFALLAND
ThepurposeofthissectionofthismanualistofamiliarizetheuserwithavailablerainfalldataandtodocumentdesignhydrologymethodscurrentlyinuseintheCityofHemetandRiversideCounty.ThematerialscontainedinthissectionareintendedfortheuseofbothCitystaffandengineerssubmittinghydrologiccomputationstotheCity.Themethodspresentedareconsideredtoproducehydrologicdesignparametersacceptableforuseduringtheplanninganddesignofundergroundstormdrains,openchannels,retentionanddetentionfacilitiesanddebrisbasins,aswellassubdivisionrevisionand?oodplainmapping.Priortocontinuingwiththissection,theengineershouldbecomethoroughlyfamiliarwiththeRiversideCountyFloodControlandWaterConservationDistrictHydrologyManual.5.1RAINFALLThethreetypesofstormswhichcanoccurovertheHemet-SanJacintoValleyincludegeneralwinterstorms,generalsummerstormsandhighintensitythunderstorms.Mostprecipitationresults?'omthegeneralwinterstormswhichnormallyoccurinthelatefallorwintermonthsandmayhavedurationsofseveraldays.Generalwinterstormsoccurwhenwarmmoisture-ladenPaci?cairmassesmoveinlandoverSouthernCalifornia.OrographicliftingandcoolingoftheairmassesresultsinincreasingprecipitationastheymoveeastwardoverthecoastalplainandSantaAnaMountains.Precipitationratesdecreaseoverinlandvalleys,butastheairmassesaresubjectedtomoreextensiveliltinguponrisingovermajorinteriormountainranges,suchastheSanJacintoRange,highratesofprecipitationagainoccur.Asthestormcontinuestomoveeastwardbeyondthemountainslittlemoistureremains,andprecipitationdecreasesrapidlyoverthedesertareas.Althoughsimilarinnaturetothegeneralwinterstorm,generalsummerstormsarerareandnormallyoccurduringthemonthsofJulythroughSeptember.Thegeneralsummerstormistheresultofanin?uxoftropical,moisture-ladenairoriginatingovertheGulfofMexicoortheSouthPaci?cOcean.Althoughthistypeofstormisuncommon,itcanresultinlargeamountsofprecipitationandhavedurationsofseveraldays.Morecommonthanthegeneralsummerstormisthehighintensitythunderstorm.AlthoughmostprecipitationovertheCityresultsfromgeneralwinterstorms,thunderstormscanoccuratanytimeoftheyearcausingextremelyhighratesofprecipitationforrelativelyshortdurations.Thunderstormscanoccureitherduringgeneralstorms,orasanisolatedRainfalland Page5-1

18.B

p—Hi?i?h "Ir—i*m“ I... a
ILIHHHII—F—‘h-‘h-‘l—#?u-mh—‘n-l- '— ‘—
F'-
E“:---r----.I .- III-HH-'hl-Ir-I-II-I' hfI'I-I-I'u 5-.— _ I :q-H “mp-Hill.- 'I-r
—_.h.h.-.-h.I-.'H'I Hl—I
Eh IllFE- "-
IF:— I- I Frl-r'rph-J-I-lI-II-Il:I" ?rm-hI"
F—l—I..—
H ail-III""' ?aw-??t'??'”m3 I—l—Iu-u
”Hull-I'm-'-II
_'.| ‘—I
.?r Tm5 ?.- mh-IIIF‘HHJJIJHH
'
r
uhin
up‘EEEF3%?- :=I.
.l'
#h-u-f-I-I-HH—rd-
phenomena,butaremostcommonfromJulythroughSeptemberwhenmoistunstableairsubjecttoconvectiveliftingmaycovertheSouthernCaliforniaarea.Fordesignhydrology,the3-and6-hourdurationstormsaretakenasrepresentativeoflocalthunderstorms,whilethe24-hourstormismorecharacteristicofgeneralstorms.5.2INTENSITY-DURATIONCURVESIntensity-durationdataisrequiredforusewiththerationalmethod.Thisdataisgenerallypresentedintheformofcurvesofrainfallintensityininchesperhourversusstormdurationinminutes.Intensity-durationdatafordurationsunderthreehourstendtoplotinastraightlineonlog-logpaper,andthecurvesforvariousreturnperiodstendtorunparalleltooneanother.Standardintensity-durationcurveshavebeenpublishedinmasterplanstudiesformanyareasofRiversideCounty.Inareaswherethesecurvesarestillapplicabletheyshouldbeusedintheinterestofconsistency.Atabularpresentationofcurrentintensity-durationdataforthepopulationcentersofHemet,SanJacintoandIdyllwildispresentedonPlate5.1.Theengineershouldbeawarethathydrologicvariationscausedbyterrainandotherfactorsrequirecautionintransposingthesecurvesontoadjacentareaswithoutclearlydeterminingtheirapplicability.5.3RUNOFFTheanalysisofstormrunoff,thatis,thehydrologicaspectofurbandrainageincludingdeterminationofpeakrunoffrate,volumeandtimedistributionof?ow,isthatpartoftheengineer'sworkwhichhasthegreatesteffectonthesuccessorfailureofhiseffort.Thestormruno?‘peak,volumeandtimingprovidethebasisforallplanning,designandconstructionofdrainagefacilities.5.3.1AnalyticalMethodsReviewofcurrentpracticesshowsthattwobasicapproachesprovidereasonableresultsintheHemet-SanJacintoValley.TheyaretheRationalMethodandthemethodoftransposingrainfall-runo?‘datafromgaugeddrainagebasinstoungaugedbasinsknownastheSyntheticUnitHydrograph.5.3.2ApplicabilityofMethodsTheRationalMethod,inwidespreaduseinRiversideCounty,willcontinuetobeutilizedforthesizingofundergroundstormdrainsandthedeterminationoftheimpactsofproposedsubdivisions.Inaddition,theRationalMethodwillbeusedwhendeterminingtherunoffmagnitudefromareaswithnodevelopeddrainagesystem. and Page5—

18.B

5.4RATIONALMETHODForbasinsthatarenotcomplexandhavegenerally500acresorless,itisacceptablethatthedesignstormrunoffbeanalyzedbytheRationalMethod.Eventhoughthismethodhasfrequentlycomeunderacademiccriticismforitssimplicity,nootherpracticaldrainagedesignmethodhasevolvedtosuchalevelofgeneralacceptancebythepracticingengineer.5.4.1AssumptionsThebasicassumptionsthatareoftenmadewhentheRationalMethodisappliedare:A.Thecomputedmaximumrateofrunofftothedesignpointisa?mctionoftheaveragerainfallrateduringthetimeofconcentrationtothatpoint.BThemaximumrateofrainfalloccursduringthetimeofconcentration,andthedesignrainfalldepthduringthetimeofconcentrationisconvertedtotheaveragerainfallintensityforthetimeofconcentration.C.Themaximumrunoffrateoccurswhentheentireareaiscontributing?ow5.4.2RationalFormulaTheRationalMethodisbasedonthefollowingequation:Q=CIA.Qisde?nedasthemaximumrateofrunoffincubicfeetpersecond.Actually,Qhasunitsofinchesperacreperhour;however,therateofinches/acre-hourdiffersfromcubicfeetpersecondbylessthanonepercentand,therefore,themorecommonunitsofcubicfeetpersecondareused.Thecoef?cientofrunoff,C,istheratiobetweenthemaximumrateofrunofffromanareaandtheaveragerateofrainfallintensityoveradurationequaltothetimeofconcentrationforthearea.ValuesforCwillbedeterminedusingPlates5.2through5.5.Theintensity,I,istheaverageintensityofrainfallininchesperhourforadurationequaltothetimeofconcentration.Thetimeofconcentrationistypicallyde?nedasthetimerequiredforwaterto?owfromthemostremotepointoftheareatothepointbeinginvestigated.5.5TIMEOFCONCENTRATIONIfrainweretofallcontinuouslyataconstantrateandbeuniformlydistributedoveranimpervioussurface,therateofrunofffromthatsurfacewouldreachamaximumrateequivalenttotherateofrainfall.Thismaximumwouldoccurwhenallpartsofthesurfacewerecontributingruno?‘totheconcentrationpoint.Thetimerequiredtoreachthemaximumorequilibriumruno?'rateisde?nedasthetimeofconcentration. and Page5-3

18.B

H
at: I'l- IHHIJEEM :I'I::l-Irin“ In.-
l-l'u-I
II-I-I-l-I-rhI-I—l-Iin“ “In I?“—
II'l—I'I—‘TIHk-lnhhhl '
.BEL—"mmum IrrrI—J-?—?a---i?v????’iW4 .-.--.--l-—?"-I *1.w-—— '— W.... I'I'l-l-‘I'II'-_.|.'I. ?
Thetimeofconcentrationisa?anctionofmanyvariablesincludingthelengthofthe?owpathfromthemostremotepointofanareatotheconcentrationpoint,theslopeandothercharacteristicsofnaturalandimprovedchannelsinthearea,thein?ltrationcharacteristicsofthesoil,andthedegreeandtypeofdevelopment.Toavoiddistortionoftraveltime,largesubareasshouldbeavoided.Whereextremelylargesubareasareused,peak?owenteringatravelreachmaybemuchlowerthanthe?owleavingthatreach.Velocitynormallyincreaseswithdischarge;therefore,traveltimecomputedusingtheaverage?owoverareachmaybesigni?cantlylowerthantraveltimecomputedusingin?owtothereach.Sincerainfallintensityisinverselyproportionaltotime,?owrateswouldbeconsistentlyunderestimatedbytheuseoflargesubareas.Thefollowingcriteriashallgoverntheestimationofinitialtimeofconcentrationandtheoveralllengthofdownstreamsubareas. 0 Theminimumtimeofconcentrationforanyinitialsubareashallbe10minutes.- Nosubareashallhaveanoveralllengthgreaterthan1,320feet.Forrationalmethodtabling,thetimeofconcentrationforaninitialsubareacanbeestimatedusingthenomographonPlate5.6.Thetimeofconcentrationforthenextdownstreamsubareaiscomputedbyaddingtotheinitialtime,thetimerequiredforthecomputedpeak?owtotraveltothenextconcentrationpoint.Timeofconcentrationiscomputedforeachsubsequentsubareabycomputingtraveltimebetweensubareasandaddingthecumulativesum.TraveltimefornaturalvalleyandmountainchannelsmaybeestimatedusingPlates5.7through5.8.TraveltimeforstreetsandroadsmaybeestimatedusingmethodsdevelopedinSection6ofthismanual.5.7SYNTHETICUNITHYDROGRAPHBasicunithydrographtheoryfordeterminingtherainfall—runo?‘relationshipofagagedbasinwasdevelopedbyL.K.Shermanin1932.In1938,RF.Snyderdevelopedthesyntheticunithydrographprinciplemakingitpossibletotransposerainfall-runo?‘datafromgaugeddrainagebasinstoungaugedbasins,onthebasisofdi?‘erencesinphysicalbasincharacteristicssuchasshape,area,slopeandsoon.Themethodspresentedhereinshouldbeusedforstudiesonallwatershedsinexcessof500acres.Forcompletediscussionofthemethodologyandprocessesrelatedtothedevelopmentofunithydrographics,theEngineershouldconsulttheRiversideCountyFloodControlandWaterConservationDistrictHydrologyManual.5.7.1DevelopmentofSyntheticUnitHydrographsAunithydrograph,orunitgraph,foragivenconcentrationpointwithinadrainageareaisacurverepresentingthetimedistributionofrunoffoccurringattheconcentra-tionpointfromaunitstormeffectiverainfalloverthedrainageareaabovethepoint.Aunitstormisde?nedasastormproducinge?‘ectiverainfallatarateofoneinchper andRuno? Page5-4

18.B

-I_I.I.II--.I-— h-H?dl??.‘prim-u a;
h:mag..-.--..-."I"'J"""""'..-——.-hi. ml.—
:"Tlll=lul-HFL'rh-l-ulllql
h _ 'I- mIuml?h?-l'?'F'—_.-...blip-—- --.I.'|.I-I.lWP HILL...- :HIw-‘E?g}.arm—i.L
LI'I- Hi ——HI -.'-rI-IH I'l-I-F-I I. hlH'I'l'ul-li"Eh
W’M'HE-
1M
I
Ll"m."'H-H-LI
I,
I'-
I
mmI'll?'l'll'l'rr- .---.l—J. - I'l-I'I'i
I. 'I *u'u.‘
?ail-I‘llI -- laid-mm
—'-I—'I—r H1

5.8 5.7.2
hourforaunittimeduration.Effectiverainisthatpartofthetotalrainfallwhichappearsattheconcentrationpointassurfacerunoff.Basically,thesyntheticunithydrographmethodtransposesthecharacteristictimedistributionofruno?‘fromdrainageareasforwhichrunoffdataareasavailable,tonearbyareasforwhichdataarenotavailable.Becausenotwobasinshavethesamephysicalcharacteristics,itisnecessarytoadjustforthedifferences.ThisisaccomplishedbyusingS-graphsappropriatefortheterrainandafactorcalledlag.AnS-graph,orsummationhydrograph,foranareaisahydrographofrunoffthatwouldresultfromthecontinuousgenerationofunitstormeffectiverainfalloverthearea.Foraunitstormeffectiverainfallrateofoneinchperhour,theultimatedischargeis645cfspersquaremileofdrainagearea.Lagforadrainageareaisde?nedastheelapsedtimeinhoursfromthebeginningofuniteffectiverainfalltotheinstantthatthesummationhydrographfortheconcentra-tionofanareareaches50percentofultimatedischarge.LagtimeisusedtorelateanS-graphtoaparticularbasinforthepurposeofderivingasyntheticunitgraphforthatbasin.DevelopmentofFloodHydrographsA?oodhydrographforagivenconcentrationpointofadrainageareaisacurverepresentingthetimedistributionofrunoffthatwouldresultatthatpointfromadesignstormrainfalloverthedrainagearea.Todevelopa?oodhydrographfromaunitgraph,itis?rstnecessarytodeterminethetotale?'ectiverainfalloverthedrainageareaandthetimedistribution,orpattern,ofthisrainfallduringthestormperiod.Thetotaleffectiverainfalltobeappliedtotheunithydrographisavariabledependentuponthefrequencyofstormforwhichcontrolisdesired,thedurationandpatternofthestorm,andthelossratecharacteristicsofthedrainagearea.SUBMITTALREQUIREMENTSDevelopmentprojectsundertakenwithinthejurisdictionoftheCityofHemetwillrequirethesubmittalandsubsequentapprovalofahydrologystudypreparedby,orunderthedirectionof,aregisteredcivilengineer.LISTOFV ARIABLESA= AreainacresC = Coe?icientofrunoffI = IntensityininchesperhourQ= Rateofrunoffincubicfeetpersecond andRuno? Page5-5

18.B

T Timeofconcentrationinminutes0

5.10REFERENCESRiversideCountyFloodControlandWaterConservationDistrict,April1978HydrologyManual RainfallandRunoff Page5-6

18.B

DurationMinutes
Rainfalland 03¢quO
11 1’2141516171810’202274762820’1’)3436‘12404550s4606570758085 Frequency10Year7842587277,08208
178171164158
1441401’16129
1121141101061031009794898480767370686563Shane=530
100Year440
368343323105290777'7652552467287,30223717711201192
170165159155
146137130174118113100105
98 PLATE5.1
Page5-
400
1,24
1,50

18.B

1 ‘RFMF.O
.mT
EC
«mm/1%
|+
WITI
-1-va"
|.O
;1I|rl“ .8

FFICIENTOFRUNOFF
VI
2RUNOFFCOEFFICIENTCURVESSOILGROUPACOVERTYPE—XSEAIILANDSCAPING(RUNOFFINDEXNUMBER32) RAINFALLINTENSITYININCHESPERHOUR2 3 4 5 6 52

18.B

‘ ‘
‘L'AND‘déé
¢H
LO
'7‘]

OEFFICIENTOFRUNOFF
2RUNOFFCOEFFICIENTCURVESSOILGROUP-BCOVERTYPE—URBANLANDSCAPINGAMC-II(RUNOFFINDEXNUMBER56) RAINFALLINTENSITYININCHESPERHOUR2 3 4 5 6 53
+_
+4-

18.B

HIHI++
‘I‘Ul'él
IXI'‘LUII
ll
-r-lb
ml
RAINFALL2INTENSITY3 COEFFICIENTOFRUNOFF

RUNOFFCOEFFICIENTCURVES
IN
SOILGROUP-CCOVERTYPE-URBANLANDSCAPINGAMC-II(RUNOFFINDEXNUMBER69) INCHESPERHOUR4 5
LC
2

18.B

;ANj2 Efqn’o‘VELOPIME
‘,xll
iI
4H_{}
‘L'IC
HiHRAINFALL2INTENSITYCOEFFICIENTOFRUNOFF
RUNOFFCOEFFICIENTCURVESSOILGROUP-DCOVERTYPE-URBANLANDSCAPINGAMC-II(RUNOFFINDEXNUMBER75)

ININCHESPERHOUR
LO
2 AIAl_1I.\V/I‘
W —_7.

TI'IV
[‘1']
——.—.—}l1IIi
\.

18.B

Tcl LIMITATIONSZL '09I.Maximumlength=looo'TcI00090 2.Maximumarea=I0Acres 590080 5;1’H 6a70 o——_ b800 :2t:g2% 2*' a3300 ¢60 0'2 >700 .EE_ 200 7v g50 NgE'83? 3E L _ .—
6°°e .2o 28 8Ec 0 0 40 gE8'33° 0° - I: 20 9OOC500_ au‘” A~ 835 C38o 8 g3 °- 3 u.* “’ KAl. II400~ 30 ’,2 Undeveloped.- l2- GoodCover3.:2U u)235°#325 Undeveloped,5Leo 8° ,5 FairCover:5 I4«— s E 1.3 mE300c 20 Undeveloped: :3 I52E ._ I9 PoorCover2_2 [6E“a I;'3 SingleFamilyE I7E A 250t '7 “/4Acre)2’: l8.5:1 l6 95 g:3Commercia8 2'0.3:O5200E-l3 :1? g—' O 2 o-8'2 r: g8II D S25ou- :2:° KEY 8'50g9 L-H-Tc-’K-'Tc''3l:8 so0EXAMPLE: E7 (I)L=550',H=5.o',l<=5ingleFamilyll/4Ac.)35Development,Tc=I2.6min..00 6 (2)L=550',H=5.o',K=Commercial40Developmenl,To=9.7fnin.5 4 Reference:BraphyitemNo.35.CITYOFHEMETTIMEFC ANSTORMDIEAAIRIADEvErh%PMENTSTANDARDS.0ONCENTRTIOSTDRARITEFIIAANDDRAINAGEDESIGNMANUALFORINITIALSUBAREA

18.B

w:_m_ZZ<IO>m_.j<>n_<mD._.<Zw&_IwZO_._.<._m_mm_n_Ou_w-mOm<IOmE->._._OO._m_> a _a._.___=8
mmhwnVOZOowmmumhme
4<DZ<2205mm.m0<z_<moDZ<SmwtmoZEN—OSE95.wom<oz<._.w._.Zm_>_n_O._m_>m_DZ_<IDEEOHm._..n.=>_m_I”.0>._._O o_mDoz.mom<10m?0v
ommhwmv ‘QQH‘D.“'2V .AlIOOWEA1333NI83dGNOOBS
7 2'122yssen2xlv
lliiIi};H
NNNNEW9
m:
«a:
'iéY-i
20 .II'V‘IUNele)l-OEEe1aslopoo

18.B

mI_m_ZZ<IO>m._n_<>._<m_3._.<2wn:_._m20_._.<n_wm ._<DZ<_2205mmm0<z_<mn_OZ<Sam—EEOZ_<r_n_SEOFm.wom<oz<._.w._.Zm=>_n_O._w>mn_Z_<En_SEOFmwn_O._m-MOE<IOw5->._._OO._m_> 0200mmmumhum“.05:0z_8
:

HMSEI“.0>._._O
momdxom?o.
—m.m.r~.w,n.00)th no
ON
CV
00O»onOm
AllDOWBAl33$NI83dGNOOBS
IIHii ll

18.B

18.B

6STREETDRAINAGE
Urbanstreetswithcurbandgutterserveanimportantandnecessarydrainageservice,eventhoughtheirprimary?mctionisforthemovementoftraf?c.Trafficanddrainageusesarecompatibleuptoapoint,beyondwhichdrainageis,andmustbe,subservienttotrafficneeds.Gutter?owinstreetsisnecessarytotransportrunoffwatertostormdraincatchbasinsandtomajordrainagechannels.Goodstreetplanningcansubstantiallyhelpinreducingthesizeof,andsometimeseliminatetheneedfor,astormdrainsysteminnewlyurbanizedareas.Drainagedesignforthecollectionandconveyanceofstormwateronpublicstreetsisbasedonareasonablefrequencyandmagnitudeoftraf?cinterference.Thatis,dependingonthecharacterofthestreet,certaintrafficlanescanbefullyinundatedonceduringthedesignstormreturnperiod.However,duringlessintensestorms,runoffwillinundatetraf?clanesbuttoalesserdegree.Therefore,oneoftheprimary?mctionsofstreetsistoconveynuisance?owsquicklyande?icientlytoastormdrainorotherdrainagefacilitywithoutobstructingtraf?cmovement.Duringamajorstormevent,thefunctionofstreetsistoprovideanemergencyescapefor?ood?owswithminimaldamagetourbanenvironment.6.1STREETCLASSIFICATIONThestreetsintheCityareclassi?edfordrainagepurposesasLocal,CollectororArterialaccordingtotheaveragedailytraf?c(ADT)forwhichthestreetisdesigned.ThelargertheADT,themorerestrictivetheallowabledrainageencroachmentintodrivinglanes.Traf?cclassi?cationsandtypicalcrosssectionsofthethreedrainageclassi?cationsarepresentedinTable6.1andFigure6.1,respectively.TABLE6.1TRAFFICANDDRAINAGECLASSIFICATIONTRAFFICSTANDARDDRADV'AGEQQLASSIFIS:ATIQNDRAWINQNQ.QLASSIFIQATIQ2NArterialHighwayST-lOOArterialArterialHighwayST-100A ArterialMajorHighwayST-lOli CollectorSecondaryHighwayST-102CollectorLocalStreet ST-103LocalGeneralLocalStreetST-lO4LocalRestrictedLocalStreetST-lO6LocalStreetDrainage Page6-1

18.B

R.O.W R.O.W
(a)LOCAL
R.O.W. R.O.W.
7% L77.
(b)COLLECTOR
R.O.W. R.O.W.

Figure6.1StreetDrainageTypicalStreetCrossSections(Source:PHW A,1984) 6555
45'-57'
|8~22'
52'-66'
80'~IOO'
8-22'
10'
36'— 655
*|.5% *l.57.

VERTICALCURBTYPE“A"0R"STD.NO'SC—2ooORC-20I

5.5'6.5' 64'-76' 6.5'5.5'32'v38 32'-38'
VERTICALCURB(ALTERNATIVE)TYPE"B"STD.NO.C-20I
||O'—l34'IO' 90'-l|4'—>I
[.77. I.7z
VERTICALCURB-TYPE"B”(c)ARTERIALSTD.NO.C—20I9KFORLOCALSTREETSWITH52'RIGHT-OF—W AY ,CROSSSLOPESSHALLBE2% Page6-2

18.B

FREQ

6.2DESIGNCRITERIAFORSTREETS6.2.1DesignFrequencyStormdrainagewithinastreetsystemservestwoprimaryobjectives1 Removesnuisance?owsfrompavementduringfrequentreturnperiodstormstomaintainsafeandefficientmovementoftraf?c.2.Protectsadjacentpropertiesfromdamagecausedbylarge,infrequentstorms.Thefunctionofremovingstorm?owsfrompavementisbasedonprovidingstormdraincatchbasinsatpointswheremaximumdepthordrivinglaneinundationcriteriaarereached.Stormdrainsystemdesignisgenerallybasedontheconceptofadesignstorm.Thedesignstormisthestormassociatedwiththegoverningreturnperiodforlongitudinalstreet?ow?omTable6.2.Insomelocations,alongLocalandCollectorstreets,physicalimprovementsmayprohibitthewatersurfacefromspreadingtothebuildingsetbackline,suchasastreetlinedwithblockwallsconstructedattheright-of—wayline.Inthissituation,thedepthof?owatthecenterlineofthestreet,assuming?oodwatersarespreadbetweenthebuildingsetbacklines,willde?nethedesignstorm.Intheupperreachesofasystemthe10-yearcriteriawillgovern.Fartherdownstreaminthesystem,thestormdrainsystemdesignforthe10-yeareventmaynotmeetthestreet?owcriteriastatedforthelOO-yearstorm.Inthiscase,thestormdrainwillneedtobeupsizedtomeettheappropriatecriteria.Bothreturnperiodsneedtobecheckedtodeterminewhichconditiongoverns.Inotherwords,thegreateststormconditiongoverningdesignatanypointisthedesignstorm.

TABLE6.2DESIGNSTORMFREQUENCIESFORSTREETDRAINAGEDRAINAGELIlVIITSOFLONGITUDINALSTREETFLOWCLASSIFICATIONBYDESIGNSTORMUENCY10-YEARlOO-YEARFlowspreadtocrownofLocal . .street.nocurbovertopmng.Flow6inchesdeepatcen-FlowspreadtocrownofterlineCollector -street,nocurbovertoppingOne12—footdrivinglaneinFlowcontainedbetweenArterialeachdirection,nocurbright-of—waylines.overtopping.

StreetDrainage Page6-3

18.B

Fl... I'H
aw
1'lI-Ilmm: IHI'?-?—F-I'n?__??-'fl.--'In*-l—I-—
?:._.£m::“.
i
'
I'""--I-I-'P'I-I:

I
~
mmm?g
' '
Wink—ri-
lul'F-IIJI-I- l—I-II- I-h-II'I'l'l'
I
'I-'Ful?l-1I Ea????
-
:r-_-|==u:-.--_..-._._..:-.--=-l
'I.I:-_
I
‘1ma?a“-- .h-I—J'H"'"E—11%

6.2.2 6.2.3
PavementEncroachmentThefollowingsectionspresentspeci?cdesignrequirementsforstormdrainageonurbanstreetsforthedesignstorm.DeterminationofstreetcarryingcapacityforthedesignstormshallbebasedupontherequirementsoutlinedinTable6.2:Thestormdrainsystemshouldbeginatorpriortothepointwherethemaximumencroachmentand/ordepthisreached,andshouldbedesignedonthebasisofthedesignstorm.The?naldesignmustmeetboththe10-yearandlOO—yearcriteriaestablishedinTable6.2.TheoreticalCapacityWhentheallowablepavementencroachmenthasbeendetermined,thetheoreticalguttercapacityshallbecomputedusingManning'sformulafor?owinauniformopenchannel.

IS7 (6.1)
TypicalguttercrosssectionsusedintheCitymaybefoundintheCityofStandardSpecificationsforPublicWorksConstructiondatedSeptember1989.AdditionalinformationrelatedtotheoreticalcapacityofstreetscanbeobtainedfromtheCountyofLosAngelesRoadDepartment,HighwayDesignManualofInstructions,datedJanuary,1992.An"n"valueof0.15shallbeusedforstreetflowunlessspecialconsiderationsexists.

6.3CATCHBASINSPropersurfacedrainageofstreetsandhighwaysmayrequireinterceptingexcess?owswithstormwatercatchbasins.Themostupstreamcatchbasininthesystemshouldbeplacedasfardownstreamaspossible,becauseassoonastherunoffentersthepipesystem,itiscarriedrapidlydownstreamwhichtendstoreducethetimeofconcentration.Locatingcatchbasinsisdictatedbyencroachmentintothetraveledwayand?owdepthcriteria(seeTable1.1).6.4DESIGNCRITERIA6.4.1 StreetDrainage
GeneralCatchbasinsshallbelocatedwithinstreetrightsofwayunlessotherwiseapprovedbytheCityEngineer.Allcatchbasinswhichmustbelocatedoutsidestreetrightofwaylinesinordertointerceptstormwatersunderexistingconditionsareacceptableonlywhenotherprovisionscannotbemadetointerceptthese?ows.Rightofway Page6-4

18.B

?r Ill-WH-lawmm--r?'HI'I-I'I'I'I:-.=l-I Hui—h.“-
IHH
=1—r-1l'l'I-Ill'ri'm-u:h?lib- hi "--'H'"“—-u I... I.
u. '?-? Iii-1".“'1—.Lhu:-—-I_I.?.? d“.I—H'I'I i'I-I'I
immmm
L-rI-bI-I-HH-'-'I'--'-'I.l--'If I—I-I-HII—I-L-l'h H?—?lf-J'I?H mil_-J I.rIrI-h-II'rI-?-“—m-I-q-I-n-I-mug—HHMIJJ-?
I"? -I

6.4.2 6.4.3

6.4.4 6.4.5
StreetDrainage
forsuchcatchbasins,orinlets,willbeofferedfordedicationonthetractorparcelmapfortheprojectoracquiredpriorto?nalapprovalofthestormdrainsystem.Catchbasinstobeconstructedo?‘thepavedportionoftheroadwaybutwithinthestreetrightofwaylinesshallbemadeoperablebygradingtheroadwaytopermitstormwaterto?owtothebasin.Streetremodelingofthisnatureshallbeperformedassoonaspossibleafterconstructionofthedrainagefacilities.Localdepressionsmaybeomittedforcatchbasinstobeconstructedoffthepavedportionoftheroadway.Itisexpectedthatthelocaldepressionswillbeconstructedconcurrentlywiththeultimatestreetimprovements.Nevertheless,gradingtomakesuchcatchbasinsoperablemustbedonebythejurisdictionalagencyandsigni?edbytheabovenoteontheprojectdrawings.If,duringthedesignoftheproject,itisdeterminedthatstormwatercannotbeadequatelycollectedbyacatchbasintobeconstructedoffthepavedportionoftheroadway,thedesignershouldconsiderusingalternatemethodsofcollectingstormruno?‘.AlternativesandrecommendationsshallbereviewedandapprovedbytheCityEngineerpriortopreparationof?nalconstructiondrawings.LimitationsGratedcatchbasinsshallbeusedwherestreetslopesare?vepercentorgreater,gratedbasinsshouldgenerallynotbeusedinsumpconditionsbecauseofthepossibilityofdebriscloggingthegrates.Additionally,duetothepossibilityofclogginggratedcatcharenotrecommendedforsumpconditions.Sideopeningbasinsgenerallyshouldbeusedwherestreetslopesarelessthan5percentorwheresumpconditionsexist.LengthRequirementsTheconstructionofcatchbasinsover28feetinlengthshouldbeavoided.Inlieuthereof,twoshorterequivalentlengthbasinsshouldbedesignated.Figures1.2through1.3,inSection1.6DesignAids,areprovidedtoassistthedesignerwiththedeterminationoftherequiredcatchbasinlengthortotalnumberofgratesrequired.SeriesCatchBasinsThenumberofcatchbasinstobeconnectedinaseriesshouldnormallynotexceedtwo.Iftheconnectionofmorethantwocatchbasinsinaseriesisunavoidable,considerationshouldbegiventodesigningalateraldrain.AdditionalcriteriaforthedesignofseriescatchbasinsispresentedinSection1.5.InteriorDimensionsTheinsidefront-to-backdimensionofacatchbasinmaybereducedtoavoidcon?ictswithstructuresorutilities.Thenecessaryreductionintheinternaldimensionshallbe Page6-5

18.B

”’1‘;hHHr-II I'I'I'I'I'I'I'M'I'hld'l-u-h
?ux—J; I
aim-LEW
Lh?q-FJ'H-r'l—r-f-I'I-I'I'I'III-Ff-l-?'l
*--_-—.a-_L-=+_-',.%:m*:m
“idly—PH“ Hiri-
m 3E”:-.'._"-.—.a—..n."'"u-.-.“'"‘"
I hh-Wln‘m
I -— div-h...Hm
I m_ ——-—
a uni—Eh.Ian'- ”I..T__.E=.._._u.-_..
r w— “hug—ed.-MMHFF-rr?-I
ll H-l-H-ll—HI'IHI-II'H-I-erlm‘I-l-r
I." ha...—h‘n'! II'I-I'r-r'I'I'l-I-I:"lull-“uh?an-51.-- ".1:-L ?rm hill- IIIH

6.4.6 6.4.7
determinedbythedesigner,butinnocaseshallthedimensionbelessthan30inches.Ifreductionoftheinteriordimensiontotheminimumspeci?edhereinisnotsu?icienttoavoidthecon?ict,refertoLosAngelesCountyFloodControlDistrictStandardDrawingNo.2—D461forotherpossiblesolutions.LocalDepressionsTheLocalDepressionusuallyhasadropof4inchesandproducesacurbfaceatthecatchbasinopeningequaltotheexistingcurbfaceplus4inches,unlessotherwiseshownonthegeneralplan.ThisLocalDepressionshallbeusedonresidentialstreetsandonotherstreetswithlightvehiculartraf?c.ALocalDepressionof2inchescanbeusedwithsideinletorcombinationcatchbasins.Ingeneral,a2inchLocalDepressionshallbeusedonmajorstreetscarryingarterialtra?ic,onanyotherheavilytraveledstreet,andinanysituationwherevehiclesmaybetravelingintraf?clanesadjacenttocurbsatrelativelyhighspeeds.If,atanytimeduringdesign,aLocalDepressionischanged,thelengthofopeningofthecorrespondingcatchbasinshallbecheckedinsizeandchanged,ifnecessary.ConnectorPipe0 Theminimumdiameterofconnectorpipeshallbe18inches 0 Thehorizontalalignmentofconnectorpipesshallcontainnoanglepointsorbends,unlessapprovedbytheCityEngineer. 0 Theminimumlengthofconnectorpipetobeinstalledbetweencatchbasinsinaseriesshallbe12feet,unlesspreventedby?eldconditions. 0 Catchbasinconnectorpipesshalloutletatthedownstreamendofthecatchbasins,unlesspreventedby?eldconditions.Downstream,inthisparagraph,referstothedirectionofthegutterslopeatthecatchbasininquestion. 0 Wherefeasible,connectorpipesshouldbelocatedsoastoavoid,asmuchaspossible,cuttingintoexistingcrossguttersandspandrels.

6.5DESIGNPROCEDUREFORCONNECTORPIPESAND"V"DEPTH6.5.1
StreetDrainage
SingleCatchBasinsConnectorPipe:Giventheavailablehead(H),where"H"isde?nedasthedifferencebetweenthemainlinehydraulicgradelineandthefreewatersurfaceinthecatchbasin,therequiredconnectorpipesizecanbedeterminedfromculvertequations,suchasthosegiveninKing&Brater,"HandbookofHydraulics", Page6-6

18.B

Frytbnord
CF.

StreetDrainage
SectionFour,?fthedition.FigureNo.1.8canbeusedforanomographicsolutionofaculvertequationforculverts?owingfull.DepthTheminimumcatchbasindepth,Vshallbedeterminebyequation1.2:
2V=C.F.+0.5+1.21+2gCos5
WhereV
S
d (Ln
Depthofthecatchbasin,or”V"depth,measuredinfeetfromtheinvertoftheconnec-torpipetothetopofthecurb.Verticaldimensionofthecurbfaceatthecatchbasinopening,infeet.Averagevelocityof?owintheconnectorpipe,infeetpersec-ond,assuminga?ll]pipesec-tion.Diameterofconnectorpipe,infeet.Slopeofconnectorpipe.Theterm1.2v2/2gincludesanentrancelossof.2ofthevelocityhead.Inadditiontotheenergyrequiredtoachievethevelocityintheoutletpipe.Assumingacurbfaceatthecatchbasinopeningof10inches,whichisthevaluenormallyusedbymostagencies,andCosS=1,theaboveequation1.3maybesimpli?edtothefollowing:Figure1.9providesagraphicalsolutiontoEquation1.4forcurbfacesof10inches 2V2133+i23L+d22 (L»
Page6-

0.5'
#5for 7‘70wDram
CF.

18.B

6.5.2CatchBasinsinSeries
A 0'C‘F/ 0.5’M/nFretboard\ \ C.F20.5’Frccboaro’\ V/AZ 14/ V? V2 A/.252.2 Hz25' H.aFor.r/my57‘0rmOra/n A, EEQVtA2 ‘3'
ConnectorPipe:Selectaconnectorpipesizeforeachcatchbasin,anddeter-minetherelatedheadloss(H1,H2)bymeansofaculvertequation,orbyFigure1.8.Thesumofheadlossesintheseriesshallnotexceedtheavailableheadasshownbytherelationship:H1+H2+......+Hn<H(1,4) Theminimumcatchbasindepths,V ,andV2,shallbedeterminedinthefollowingmanner:1 The?rstcatchbasindepth,V ,,shallbecalculatedasforasinglecatchbasinusingEquation1.4.2 ThesecondcatchbasindepthV2shallbedeterminedusingEquation1.6:2 dV2=C.F.+0.5+H1+1.212——+2 — 2gCos$2 (1.5)
AssumingagainthatCE=0.83andCos52=1,thenEquation1.5canbesimpli?edto:

StreetDrainage Page6-8

18.B

V22V=1.33+H+1.2—+d—G (1.6)
3 Thefreeboardprovidedforthesecondcatchbasingenerallyshallnotbelessthan0.5feetandshallbecheckedbyEquation1.7:FB-Vd212V2CF2‘2cosS2 '
2_g
' '2 (1.7)
IfC.F.2=0.83andCosS2=1,thenEquation1.7becomes
V2F32V2d2—1.2—2—0.83(L8)2g
Whereespecially"tight"conditionsprevail,the0.5feetfreeboardrequirementreferredtoabovemaybeomitted.Insuchcasesthedifferencebetweenthegutterelevationandthehydraulicgradelineelevationofthemainlinewillbeacceptedastheavailablehead.4 Connectorpipesbetweencatchbasinsinseriesshallbecheckedforadverseslopebythefollowingrelationship:V2 —

0.5>V1—G (1.9)
The?gureof0.5shownaboveisthestandard6-inchcrossslopeofthecatchbasin?oors.

StreetDrainage Page6-9

18.B

?at "Fm—I'll.-III-I'I-IH6.6DESIGNAIDSFigures6.2through6.5areprovidedtoassistthedesignerduringthedevelopmentofcatchbasinandconnectorpipedesign.

StreetDrainage Page6-10

18.B

[////I////,,//
”0/ my 99/ PageG72215
[2.5
IO7.5
W=3'6" 25V-°/4:?
20 \ |7.5
()1
.n 2 3 .4Q;.5 s .7 9 «.0ofW=710n0g=flowin[/2ofstreetOi:inletflow8=streetslopeFigure6.2CatchBasinCapacitiesStreetDrainageLosAngelesCountyFloodControlDistrict Page6-11 '//
0/

18.B

35 3O
25 \ 20k "
l5
l2.5
IO

7.5 g01Qt=flowinI/2ofstreetQ'i=inle1flowS=streetslope
Figure6.3CatchBasinCapacityStreetDrainageLosAngelesCountyFloodControlDistrict Page6-12

18.B

, \.\!1
r r. \
r 1 ..

I
My X4_Ny, / ,Iuor
l. a
,4 L; V
‘_.—.
:2 s :9.° :3 9 D-\ \ )</—\ \’/x /X)/\:9‘7’\/ /\ /(\x, /- \ 9/\/ /O‘X\\’/\9 / /a'38.\/\- / \ \ \ V A \ \\\\\\°/\\ \\\\\ \\ \ \
In 0 to C3-0 In «2ol0 n N N _ 95_
g \\ 1 n\l / /._ \ /Nll \3 \\"'\ \k\ \\ \\ \ ,I\ \ \\Y\ \\ \'9\ \ Figure6.4CatchBasinCapacitiesStreetDrainageLosAngelesCountyFloodControlDistrictLO Page6-13 c'slo
die
5=streetslopeinletflowflowin[/2ofstreet0:

18.B

SUMPFORMULAQ=4.3ADO'6(COMPLETESUBMERGENCE)A:AREAOFOPENING(Wx0.656).w:LENGTH(FEET)OFCATCHBASIN °°°OPENINGD=DEPTH(FEET)OFFLOWABOVE 3°°NORMALGUTTERGRADE8"NORMALCE9"C.F.ATGB 200 IOO9080E 702 60m 50I.9 40<0g 30
{5'_LL:_ 205:20
I09876.3 A.a.e.7.s.9Lo2 3 4aD=DEPTHOFFLOW(FT)ABOVENORMALGUTTERGRADE Figure6.5CatchBasinCapacitiesSumpConditionStreetDrainageLosAngelesCountyFloodControlDistrict Page6-14

18.B

6.7CHECKLISTToassisttheengineer,designerorreviewer,thefollowingchecklisthasbeenprepared.Thislistincludestheminimuminformationthatshouldbeinvestigatedwhenevaluatingstreetdrainage.Usethe?atteststreetslopetocalculateallowableguttercapacity.Determinestreetclassi?cationpriortocalculationof?owdepthandguttercapacity.Evaluatenon-symmetricalstreetsections,withspecialemphasisontheeffectsofstreet?owonadjacent,existingdwellings.ElStormdrainsarerequiredwhentheguttercapacityorvelocitycriteriaareexceeded.6.8LISTOFV ARIABLESE = Ef?ciencyofcatchbasinF = ReductionfactorL = CurbopeninglengthforpartialinterceptioninfeetLT= Curbopeninglengthfortotalinterceptioninfeet 11= Manning'sroughnesscoef?cient
Q,= AllowablecapacityincubicfeetpersecondQt= TheoreticalcapacityincubicfeetpersecondS = LongitudinalstreetslopeinfeetperfootSx= CrossslopeofroadwayinfeetperfootT = FloodedwidthY= Depthof?owinfeetZ = Reciprocalofthepavementcross-slopeinfeetperfoot6.9REFERENCESUS.DepartmentofTransportationFederalHighwayAdministration,March1984HydraulicEngineeringCircularNo.12,DrainageofHighwayPavementsLosAngelesCountyFloodControlDistrict,HydraulicDesignManualStreetDrainage Page6-15

18.B

18.B

RAULICSOPENCHANNELHYD
Anopenchannelisaconveyanceinwhichwater?owswithafreesurface.Thistypeofconveyancemaybeeithernaturalorman-made.Naturalchannelsusuallyconsistofamainstream,orlow?ow,channelandtheassociated?oodplains.Forthepurposesofthisdiscussion,thetermopenchannelwillincludethe?oodplainsandthemainstreamchannel.Thehydraulicdesignprocessforopenchannelsconsistsofestablishingcriteria,developingandevaluatingalternativesandselectingthealternativewhichbestsatis?estheestablishedcriteria.Elementsthatshouldbeconsideredinthedesignprocessincludecapitalinvestmentandprobablefuturecosts,suchasmaintenanceand?ooddamagestoproperties;traf?crequirements;andimpactsonthestreamand?oodplainenvironment.Openchannelhydraulicscanbecomplex,requiringbothspeci?ceducationandextensiveexperience;however,whenprovidedwithspeci?cproceduresandcriteriamanyurbanapplicationscanbesuccessfullydesignedbyengineerswithsubstantiallylessexperience.Thissectionexamineschanneldesignforcommonurbanapplicationsincludingroadsidechannels,channelswithindevelopments,andexistingchannelsinurbanareasorgrowthareasthatcanbeanalyzedas"rigid".Toassistthedesigner,checklistsoutliningtherequirementsandresourcestobeusedformorecomplexchanneldesignsareincludedinSection7.1.7.1ARTIFICIALCHANNELSArti?cialopenchannelsareusedindrainageofawidevarietyofapplications.Theapplicationsvaryinscalefrommodestroadsideditchesandonsitedrainagetolargecon-veyancestructuresthatcanbeseveralhundredfeetwide.Thissectionwillexploreopenchanneldesignapplicationsmorecommonlyencounteredbycivilengineers.Applicationsinvolvingriversandlargewashesorchannelsconsideredtobe"non-rigid"requirespecialdesignconsiderations.Thedesignofthesechannelsshouldnotbeattemptedwiththedesigntechniquesdevelopedinthismanual.Rigidgradecontrolisarequirementforusingthissection.7.1.1RouteConsiderationsNaturalchannelsareinaconstantstateofchange.Smallchangesresultingfromperiodsoflow?owandadditionalchangesrelatedtoperiodsofrelativelyhigh?owareconsideredanequilibriumcondition.Theidealarti?cialchannelisonethatapproximatesanaturalchannelinequilibrium.ThesechannelsdonothaveOpenChannelHydraulics Page7-

18.B

excessivevelocitiesandarewithoutclosely-spaced,sharpandreversecurvaturesLargernaturalchannelshavelow?owchannelscontainedwithinthebottomwidth.Toprovidelowcostmaintenance,thearti?cialopenchannelsshouldbestablefortherangeof?owsexpected.Considerationofafullrangeof?owsmayrequiretheevaluationoflow?owchannelstopreventtheaccumulationofsiltandtheresultantreductioninchannelcapacity.Theselectedrouteshouldpermittheuseofuniform,stablechannelsideslopes;permitthemaintenanceofsubcn'tical?ow;andmaintainconstantchannelpropertiessuchaswidth,sideslopes,anddepth.7.1.2ChannelSelectionTheselectionofchannelpropertiesdependsuponsoundhydraulicpractice,structuralconsiderations,environmentalconcerns,basicprojectrequirements,recognitionofriskandmaintenance.However,fromapracticalstandpoint,thebasicchoicetobemadeinitiallyiswhetherornotthechannelliningisconcrete,rock,grassorearth.Theactualchoicemustbemadeuponavarietyofmulti-disciplinaryfactorsandcomplexconsiderationswhichinclude:HydraulicSlopeofthalwegRight-of-wayStreambedcontrols-bedstabilityCapacityneededBasinsedimentyieldandchanneltransportcapacityAbilitytodrainadjacentlandsGeotechnicalGroundwaterlevelsandgroundwaterrechargeStructural0 Costs0 Availabilityofmaterial0 Areasforexcavationmaterials(spoilsites)Environmental0 Neighborhoodcharacter0 Neighborhoodaestheticrequirements0 Needforopenspaceconservation0 Streetandtraf?cpatterns0 MunicipalorFloodControlDistrictpolicies/ordinances7.1.3DescriptionofChannelTypesArti?cialchanneltypescanvarywiththeshapeofthesectionandwiththeliningusedforthechannelbottomandbanks.Thetypeofliningslistedabovecanbe OpenChannelHydraulics Page7-

18.B

usedaloneorincombinationwithotherlinings.TypicalliningsandsectionsareshowninFigure7.1andarediscussedindetailinSection7.4.Concretelinedchannels:Concretelinedchannelsareusedprimarilywhereright-of-wayislimited.Thechannelsmaybedesignedforeithersubcriticalorsupercritical?owandgenerallyhavesteepsideslopesbecauseofright-of—waylimitations.Supercritical?owspresentgreaterproblemsduringactualchanneldesignandthedesignofappurtenancessuchasbridgesandchanneljunctions.Channelswithsupercritical?owrequirespecialattentiontochannelfreeboard,changesinchannelalignment,transitionsandattheinterfacewithotherhydraulicstructures.Useofconcretelinedchannelsisdiscouragedinresidentialandrecreationareas.If;becauseofright-of-wayorotherspacelimitations,concretelinedchannelsareneededintheseareas,fencingwillberequiredtopreventaccess.Incomecases,concretelinedchannelsrequirereinforcingsteelandminimumconcretethicknessdictatedbyanticipatedstructuralloadsandclearancerequirementsforreinforcingsteel.Inaddition,concretelinedchannelsrequireweepholesand/orsubdrainstopreventupliftdamages.Figure7.2illustratestwooptionsavailableto"key"concreteliningintoadjacentground.Thechannelliningmustbetiedtotheadjacentgroundtopreventerosioncausedby?owsenteringthechannellaterally,erodingthesoilsbehindtheconcretecausingdamagetothechannellining.RockLinedChannels:Themostcommontypeofliningisthisclassiscommonriprap.Ingeneral,thistypeofliningrequiresplacementofagravel?lterlayerand/or?lterfabricbetweentherocklayerandtheground.Ripraplinedchannelsaregenerallydiscouragedandshallbepermittedonlyinareasofexistingdevelopmentwhereright-of—wayislimitedandsuchlimitationexcludestheuseofotherchanneltypes.Theadvantageofrockliningisthatamuchsteeperchannelgradecanbemaintainedduetotheincreaseinroughnessassociatedwiththerock.Inaddition,thepermissiblesideslopes(3horizontal:1vertical)aresteeperthanthoseallowedforeithergrasslinedorearthenchannels.Whereriprapisadvantageousisinthedesignandconstructionofcombinationchannelsections.Rockliningsarepermittedasameansofcontrollingerosioninnaturalchannelsandforuseasslopeandtoeprotectioninasoft-bottomchannel.Thedesignofthistypeofchannelshouldincorporatecertainnon-rigiddesigntechniques.Forinstance,theripraptoeprotectionshouldbedesignedtoprotectedagainstanticipatedscour.GrassLinedChannels:Grasslinedchannelsarethemostdesirablechannelswhennoright-of-waylimitationorotherrestrictionsexistintheareaunder OpenChannelHydraulics Page7-3

18.B

r‘ ‘
1:515”wars: - —
. ”Ema- M/NYZWEALTESS
WEEP
mayF
_—
MEL-7565155W ALL/NED[7er

FENCING
com-2575ravenmm mmammo ”DI-55
C'O‘VCEETE-TRAPEZO/D
mazewas?HOLES Foss/5L5FENCINGAHA/7W6!accessBeau/£50
0:47amLOWFLOWCHANNELmrezmVEETL'ALM/ALL
wart}?
MWLLow 7::MmsemFLMCHANNELmy09ms-TRAPEZOIDW ATER
M4755/41
0P770AMLWMW[MA/MELRmCHANNEL
OpenChannelHydraulicsFigure7-1 Page7-4

18.B

GROUNDSURFACEII .4—IZmm.—' #1:4-ame.24"0-6
BANKPROTECTION(CONCRETE. 24min
KEYIN
4—42"min.——-GROUNDSURFACE
24"min.BANKPROTECTIONSHOTUHETE,
KEYIN
OpenChannelHydraulicsFigure7-2 Page75

18.B

"III-EH"-n—Jh lri-H-rh-I‘EI.I'Il-I-H—lr‘f—Imh”at"h-J- "_‘-'- l—I'd-l-I
'nI-T—un-II-II-II:up. -.I.
f?Wdff'rh—l.
h!-

7.2 7.1.4
consideration.Thedevelopmentofgrasslinedchannelsisencouragedwherethedesigncanbeintegratedintolandscapedoropenspaceareasoraspartoflocalorregionalparkswheremulti-useactivitiesareincluded.Thesechannelshavesimilarpropertiestoearthenchannelswithpermissiblesideslopesbeingnogreaterthan4horizontal:1vertical.Inaddition,grassinchannelscreatesturbulencewhichresultsinthelossofenergyandincreased?owretardance.Therefore,thedesignershouldconsiderthepotentialforsedimentdepositionaswellasthepossibilityofscour.Becauseofthehighprobabilitythatanon-irrigated,grasslinedchannelwillreverttoanearthenchannel,allreferencestograsslinedchannelswillbeforirrigatedgrass.Inaddition,whereverpossiblereclaimedwatershouldbeusedasthesourceofirrigationwater.EarthlinedChannels:Thecategoryincludesbothbareearthchannelsandnaturallyvegetatedchannels.Earthlinedchannelsshouldbedesignedforsubcritical?ow.Thewidthtodepthratiosarelarge,thesideslopesare?atterthan4horizontalrlvertical,andgradecontrolisarequirementforthedesign.Thesmallersizerangeofthesetypesofchannelsdoesnotrequirelow?owchannels;however,forlargersizedchannelsandchannelsusedforpedestriancorridors,anarmoredlow?owchannelmaybeusedtoachieveeffective,lowmaintenancechannels.LowFlowChannelsThemajorityofstormeventswillbelessthanthedesignstorm,resultinginfrequentlow?owconditions.Low?owsinearthorgrasslinedchannelswilldepositsedimentanddeveloptheirownpilotchannelwhichwillbemeanderingandcoulddirectlow?owsintochannelbankscausingbankerosion.Designoflow?owchannelswillpreventmeanderingandwilldirectlow?owsinacontrolledmanner.Roundingthechannelbottomtoapproximateaparabolicshapewillcausethecenterlineofthechanneltoactasalow?owchannel.Alternatively,thechannelbottomcouldbegradedintoashallowv-shapetolowerthecenterline.DESIGNOFARTIFICIALCHANNELSThismanualprovidestheSimplifiedDesignProcedurefornormallyencountereddesignproblemsinopenchannelsthatcanbeappliedtodischargesupto2,500cubicfeetpersecond.Whenaconditionisencounteredthatisbeyondthescopeofthissimpli?edprocedure,anincreaseinthedetailofanalysisisrequired.Forcommon,controlledconditionstherearesimpli?edapproachestodesignthatcanbeused;however,whenaconditionoccursthatrequiresahigherleveloftechnicalanalysis,thedesignproceduresrequireengineersquali?edinmorecomplexopenchanneldesignprocedures.

OpenChannelHydraulics Page7

18.B

InSection7.5.1thedesignerwill?ndachecklistoutliningthesimpli?edprocedureforthedesignofarti?cialchannels.Thechecklistisintendedtoidentifytheprobableimportantfactorsthedesignershouldaddress.Theinformationcontainedinthissectionshouldbeusedasthedesignerproceedsthroughthechecklistitems.Asoftennoted,theintentistoprovidedesignapproachesandsupportforthemostcommonlyencounteredconditions.7.2.1OpenChannelHydraulicsForrelativelylong,straightanduniformchannelsnormaldepthcalculationscanbeusedtodeterminethedischargecapacityatvaryingdepthsforaconstantcross—sectionalarea.Table7.1containspropertiesofchannelcrosssectionstobeusedbydesignersofopenchannelsusingtheSimplifiedDesignProcedure.Thesepropertiesshouldbeusedasguidelinevalueswhendesigningoranalyzinguniform?owindrainagechannels.Table7.1Arti?cialChannelPropertiesSimpli?edDesignProcedure TypeofChannelLin-MaximumAllowableSiMaximumVelocitym2 deSlopes,H:VConcreteVertical15Rip-Rap3:1 9.0Grass 4:1 2.5to8.0(1) Earth 4:1 2.5to6.0Grouted-Rock3:1 9.0
‘1)Dependentuponthetypeofgrassproposed.Uniform?ow:Ifachannelisuniformandresistanceandgravityforcesareinexactbalance,thewatersurfacewillbeparalleltothebottomofthechannel.Thisistheconditionofuniform?ow;however,uniform?owismoreoftenatheoreticalabstractionthananactuality.Thedepthassociatedwithuniform?owiscommonlyknownasnormaldepth.Normaldepthinchannelsiscomputedsofrequentlythatitisconvenienttousedesignaidsforvarioustypesofcrosssectionstoeliminatethetime-consumingprocessoftrialanderrorsolutionstovariousequationsde?ningopenchannel?ow.Equations7.1through7.11arepresentedtoaidinthedeterminationofthe?mdamentalpropertiesofopenchannel?owsuchasnormalandcriticaldepth,speci?cenergy,minimumfreeboardandradiusofcurvature.

OpenChannelHydraulics Page7-7

18.B

(2:0)"
Generally,itisnecessarytoapplyManning'sEquation,Equation7.1,tosectionsofthechannelwhichhavesimilarproperties:1.486nV=()R'67S'5(7.1)Multiplyingvelocitybythecrosssectionalareaof?owyieldsEquations7.2,thecontinuityequation:Q=V A (72)Becauseofvariablechannelcrosssectionsandchannelproperties,uniform?owcomputationsarerarelyusedsolelyasthebasisforopenchanneldesign.Normallythesevalueswillbeusedforconceptualleveldecisions.Decisionsrelativetopreliminaryand?naldesignrequirementsshouldbemadethroughbackwateranalyses.CriticalFlow:Critical?owinanopenchannelorclosedconduitwithafreewatersurfaceischaracterizedbyseveralconditions,suchas:

O Thespeci?cenergyisaminimumforagivendischarge.
0 Thedischargeisamaximumforagivenspeci?cenergy.
0 TheFroudenumberisequalto1.0.Withthepresenceofafreesurfaceinanopenchannel,theforceofgravityhasaneffectonthestateof?ow.Theeffectofgravityonopenchannel?owisrepresentedbytheratioofinertialforcestogravitationalforces.ThisratioisknownastheFroudeNumber(F)andiscomputedbyEquation7.3:
(7.3)
Forsubcriticalandsupercritical?owsF<1andF>1,respectively.Duetoerosion,scourandconcernswithexcessivelyhighvelocities,therecom-mendedupperlimitofFis2.0Inthesubcriticalregime,asFincreasestoward1.0,velocityof?owincreasesandthedepthof?owdecreases.AslongasthevelocitydoesnotincreasepastthepermissiblevelocityshowninTable7.1,short-livedinstabilityofnearcritical?owisacceptable.However,nearcritical?owsinthesupercriticalregimemaycausehydraulicjumpswithminorchangesincrosssection,?owrate,channelroughnessor OpenChannelHydraulics Page7-

18.B

slope.Thistypeof?owisundesirableforanyduration,thereforesupercritical?owwillbepermittedonlyifthe?owisestablishedinthesupercritical?owregime.ThelimitoftheFroudeNumberforrock,groutedrock,grassandearthlinedchannelsisF<=0.86.Forconcrete,shotcreteormortarlinedchannels,theadditionallimit1.13<=F<=2.0isallowed.TheFroudeNumbershouldnotfallbetween0.86and1.13.Sincecritical?owistobeavoided,itisimportanttobeabletocalculatecriticaldepth.ThegeneralequationforthedeterminationofcriticaldepthisgivenasEquation7.4:
= (7.4)
Equation7.4issolvedbysuccessiveapproximation,andwillonlybesatis?edforcritical?owforthegivendischargeandcrosssection.WhenapplyingEquation7.4andsolvingforFinEquation7.3,ifthedepthisfoundtobeatornearcritical,theshapeofthecrosssectionortheslopeofthechannelshouldbechangedtoachievegreaterhydraulicstability.RoughnessCoe?icient:Roughnesscoef?cients(n)foruseinManning'sequationvaryconsiderablyaccordingtotypeofmaterial,depthof?owandqualityofworkmanship.Table7.11listsvariousroughnesscoe?icientsforpipes,earthenandnaturalchannelsandforvariousarti?cialchannels.7.2.2DesignofRigidChannelsThedesignparametersde?nedinthefollowingsectionsshouldbeusedinsituationswherethedesigndischargeislessthan2,500cubicfeetpersecond.Inaddition,thechannelmustbeconsidered"rigid".Tobeconsideredrigid,boththebanksandthechannelbottommustbestable.Stabilityisgenerallytheresultofthechannellayoutandgradecontrol.Layout:Ingeneral,channellayoutshouldfollowexistingwashes,swalesordepressions.Unlessspecialexceptionismade,allarti?cialchannelsshallbeginandendwhererunoffhasoccurredhistoricallyThisrequirementappliesbothtothepointwherewaterbecomeschannelizedandthepointwhererunoffleavesthechannel.Careshouldbetakennottochooserouteswhichlengthenthechannelsuf?cientlytoreducechannelslopesbelowthatwhichwillcausesedimentdepositionduringlow?ows.

OpenChannelHydraulics Page7-

18.B

GradeControl:GradecontrolmustbeestablishedasaconditionoftheSimpli?edDesignProcedure.Initsbasicform,gradecontrolcanbeanynaturalorman-madesectionofchannelthatdoesnotpermitchanneldegradationoraggradation.Gradecontrolismostoftenthoughtofascausingcriticaldepth;however,thisconditionisnotrequiredtoestablishgradecontrol.Gradecontrolandchannelslopeareinterrelated.Itdoeslittlegoodtoestablishgradecontrolwithinaspeci?creachwhenthechanneldownstreamisheadcuttingorundergoingrapiddeposition.Whendesigningarti?cialchannels,thedesignerneedstoassessthestabilityofthesection(s)immediatelydownstreamofthereachbeingconsidered.Ifthereisevidenceofongoingdownstreamdegradation,agradecontrolstructureshouldbeconsidered.Thestructuredepthshouldbesufficienttoprecludefurtherheadcuttinginthechannel.Foreachalternativeinvestigated,theselectedchannelslopeshouldresultinastablechannel,particularlyforearth-linedchannels.Withinareachofarti?cialchannel,gradecontrolstructuresshouldbeusedasnecessarytomeettherequirementslistedinTable7.1.ControllingWaterSurfaceElevation:Thefollowingaregenerallyconsideredcontrolpointsforthecalculationofthewatersurfacepro?le:
0 Wherethechannelslopechangesfrommildtosteeporcritical,thedepthatthegradebreakiscriticaldepth. 0 Wherethechannelslopechangesfromcriticaltosteep,thedepthatthegradebreakiscriticaldepth. 0 Whereadischargingoroutlettingchannelorconduitisonamildslope,thewatersurfaceisgenerallycontrolledbytheoutlet.AdditionalcriteriaforthedeterminationofthecontrollingwatersurfaceelevationcanbefoundintheLosAngelesCountyFloodControlDistrict'sHydraulicDesignManual,SectionC—2.2.Oncethecontrollingwatersurfaceisdetermined,calculationsshallproceedupstreamwhenthedepthof?owisgreaterthancriticaldepthandshallproceeddownstreamwhenthedepthof?owislessthancriticaldepth.ChannelCurvatureForchannelswithFroudeNumberslessthan0.86,theratioofthechannelradius(atcenterline)tothedesignwidthofthewatersurfaceshallbegreaterthan3.0.

OpenChannelHydraulics Page7-10

18.B

12M],
NoteforFroudeNumbersgreaterthan0.85,theradiusofcurvaturewillcomputedfromtheequation:r (15) Curvesinachannelcausethemaximum?owvelocitytoshi?towardtheoutsideofthebend.Tominimizetheeffectduetochannelbends,channelcurvatureshouldbeusedonlywheretopographicorotherconditionsnecessitatetheiruse.Alongtheoutsideofthecurve,thedepthof?owisatamaximum.Superelevationisthemaximumriseinwatersurfaceattheouterwallabovethemeandepthof?owinanequivalentstraightreach,causedbycentrifugalforceinacurvingalignment. 0 Rectangular{QhannelszForsubcriticalandsupercriticalvelocitythesuperelevation(S)canbecalculatedfromEquation7.6:
(16)
0 Trapezoidalghannels:Forsubcriticalvelocity,thesuperelevationcanbecalculatedfromEquation7.7,andincludesa15percentfactorofsafety.

V2(b+ZZD)5;=1.15287 (17)
Where2=cotangentofthebankslope.Forsupercriticalvelocity,thedisturbancecausedbyabendinthechannelpersistsdownstream.Therefore,adetailedhydraulicstudyutilizingspecialdesigncriteriamustbeconductedtodeterminetheeffectsofchannelcurvature.Freeboard:Freeboardistheadditionalwallheightappliedtoacalculatedwatersurface.Theminimumfreeboardvalueforrigidchannelsshallbe1footforsubcriticaland2feetforsupercritical?ows.Additionalrequirementsforfreeboardmaybecalledforinspeci?ccasesofcurvedalignments,highvelocitiesandsupercritical?ow.

OpenChannelHydraulics Page7-

18.B

Had.

I ?l—? :;H*humI'-
I I'm-I“ III-II13:51"H=--—--
I E:-{?nk—Fain
?—Mh‘?-?-
I hh?hl‘m?—-Il-_——.
' Wtum.f?
I L -'_'I-ll'-I-'-
H-HH-
I_-.-.III.III MRI-?ll-. PFPI'I'II'I'I lull-II.-
:? "1-—
W”“—-
I‘W Hill-i'I'. '-.-I-I-I-‘h?i1.I h— PHHq-ir-l-m
H '-I-
Rc1rhnnels
O Forcurvedalignments,add2.0feetor1footabovethesuperelevatedwatersurface,whicheverisgreater. 0 Foraverage?owvelocitiesgreaterthan35fps,add3.0feet.Forcurvedalignmentsadd3.0feet,or2.0feetabovethesuperelevatedwatersurface,whicheverisgreater. 0 Forsupercritical?owwherethedepthfallsbetweencriticaldepthand80%ofcriticaldepth,thewallheightshallbeequaltothesequentdepth,butnotlessthantheheightsrequiredabove.Foradiscussionofsequentdepth,refertoHandbookofHydraulics(KingandBrater1976).Trzihnnel O Forcurvedalignments,add2.5feetor1.0footabovethesuperelevatedwatersurface,whicheverisgreater. 0 Foraverage?owvelocitiesgreaterthan35f.p.s.,add3.5feet.Forcurvedalignments,add3.5feet,or2.0feetabovethesuperelevatedwatersurface,whicheverisgreater. 0 Forsupercritical?owwherethespeci?cenergyisequaltoorlessthan105%oftheminimumspeci?cenergy,thewallheightshallbeequaltothesequentdepth,butnotlessthantheheightsrequiredabove.SupercriticalFlow:Inasupercriticalchannel,thereshallbenochangeofcross-sectionalshapeorareaatbridgesorculverts.Bridgesorotherstructurescrossingthechannelmustbeanchoredsatisfactorilytowithstandthefulldynamicloadwhichmightbeimposeduponthestructureintheeventofmajordebrisplugging.Concreteliningsmustbeprotectedfromhydrostaticupli?forceswhichareoftencreatedbyahighwatertableormomentaryin?owbehindtheliningfromlocalized?ooding.Fulldevelopmentofdesignproceduresforsupercritical?owinchannelsisbeyondthescopeofthismanual;refertoHandbookofHydraulics(KingandBrater1976)andOpenChannelHydraulics(Chow1959).7.2.3PreliminaryDesignItisimportantthatmajordesignissuesbeidenti?edanddecisionsaboutthemmadebeforeproceedinginto?naldesign.Inadditiontothemasterplanconsiderationoftheinitialalignment,downstreamcontrolandchanneltype,thereareanumberof OpenChannelHydraulics Page7-12

18.B

7.3 technicalitemsthatmustbeevaluatedpriortocommencing?naldesign.Sometheseissuesare 0 Measurestocontrol?owatthebeginningandendofachannelreachtopreventdamagetoexistingchannels. 0 Minimizetheuseofalignmentde?ectioninsupercriticalchannels. 0 Thedegreetowhichlocal?owsaffectchannelstabilityandmaintenanceshouldbere?ectedinthechosenchannelcrosssection. 0 Planforpossiblesecondaryusesthatcanreduceurbancostsbyprovidingotherbene?ts 0 Determinetheneedforfreeboardrequirements.7.2.4FinalDesignWatersurfacepro?lesmustbecomputedforallchannelsduring?naldesignandclearlyshownonthe?naldrawings.Computationofthewatersurfacepro?leshouldusestandardbackwatermethods,takingintoconsiderationalllossesduetochangesinvelocity,drops,bridgeopeningsandotherobstructions.Itisnecessarytoshowtheenergygradientonallpreliminarydrawingstohelpinsureagainsterrors.Whetherornottheenergygradientlineisshownonthe?naldrawingsisoptional.NaturalChannelsNaturalchannelstendtobeinasteadystateofchange.Mountainousstreamscanberigid,yet,inageologicframework,areinaconstantstateofheadcutting.Inthemorecommonalluvialcases,naturalchannelstendtodepositsedimentandmeanderduringlow?owperiodsandtoerodeandstraightenchannelalignmentsduringrareevents.Generallyifalluvialmaterialexiststhenthereissomepotentialforastreamtoreoccupythealluvialareasresultingfromaperiodofhigh?ows.Therefore,itisnecessarytoacknowledgethepotentialforanaturalchanneltobe'non-rigid'.7.3.1AnalysisofNaturalChannelsTheinvestigationsnecessarytoinsurethatanaturalchannelwillbeadequatearedif-ferentforeverywaterway.Supercritical?owcannotalwaysoccurinnaturalchannelsandfrequentchecksshouldbemadeduringthecourseofthebackwatercomputationstoinsurethatthecomputationsdonotre?ectsupercritical?ow.Wherenaturalchannelsareused,theusualrulesforfreeboarddepth,curvatureandotherdesignparametersapplicabletoarti?cialchannelsdonotapply.Usingnaturalchannelsrequiresthatprimaryattentionbegiventoerosivetendenciesandcarryingcapacity.The?oodplainofthewaterwaymustbede?nedsothatadequatezoningcantakeplacetoprotectthewaterwayfromencroachmenttomaintainitscapacityandstoragepotential.

OpenChannelHydraulics Page7—

18.B

Section7.5containsachecklistoftechnicalissuesthatneedtobeaddressedwhenanalyzingwaterwaysinthevicinityofbridgesandculverts.Ageneralapproachforanalyzingtheeffectivenessofnaturalchannelsincludesseveraltasks:
0 Preparecross-sectionsofthechannelforthemajordesignruno?‘. 0 Investigatethebedandbankmaterialastotheparticlesizeclassi?cation. 0 Studythestabilityofthechannelunderfutureconditionsof?ow 0 Examinechannelandoverbankcapacitytodetermineadequacyfor100-yearrunoff. 0 De?newatersurfacelimitssothatthe?oodplaincanbeappropriatelyzoned. 0 Useroughnessfactorswhicharerepresentativeofnon-maintainedchannelconditions. 0 Dividethechannelcrosssectionsintounitsofsimilarpropertiesfordetermi-nationofwatersurfacepro?les. 0 Specifytheuseofdropsorcheckdamstocontrolwatersurfacepro?leslope,particularlyformorefrequentlyoccurringstormrunoff. 0 Prepareplansandpro?lesofthe?oodplain.Makeappropriateallowancesfor?iturebridgeswhichwillraisethewatersurfacepro?leandcausethe?oodplaintobeextended. 0 Evaluatethefreeboardwithreferencetoproposednon-drainagestructures.Fillingthe?oodfringereducesvaluablestoragecapacityandtendstoincreasedownstreamrunoffpeaks.Fillingshouldnotbeusedinurbanareaswherehydrographstendtoriseandfallsharply.7.3.2RequirementsforNaturalChannelsWasheswhichtraverselanddesignatedforaproposeddevelopmentmaybeleftintheirnaturalstateprovidedthatdoingsowouldnotbeincon?ictwithanapprovedmasterdrainageplanforthearea-ifoneexists-andprovidedthatthedevelopmentisadequatelyprotectedfrom?oodinganderosion.DuringthecourseoftheMasterPlanningprocess,the100-yearrunoffwillbeusedtodelineatea?oodplainformajorchannelswithdischargesofmorethan1,000cfs.

OpenChannelHydraulics Page7-14

18.B

I'.I.-.l.--“119:3.-I'll
uth-II-Hi?n'lltW“???-u-—.nI-- ml-I-III'III-
m=..-._-'-‘§"..-"""""““"':w-H?a?mark-mmFl'l'III-I-I-I-I-Ir-'-.'"-i “Hi-1":r H'— .—|-|-r-|—II-n -I--|-—n- lie-ill:Jam-Em L .Eu... —'
=L'T.
—_ _—.T-h.._mm
~*-
'7';th-i IL:?”
l-l—H -I-I-
Onemethodofdevelopinginthevicinityofanaturalwashistokeepallstructuresoutofits100-year?oodplain,aswellasitsattendanterosionhazardareas.Anotherpossiblemethodistousepartofthe?oodplainfordevelopment,whileleavingthechannelinitsnaturalstate.However,thisapproachwouldinvolvedemonstratingthat:1)theencroachmentwouldnotadverselyeffectadjacentproperties;and2)thedevelopmentwouldbelocatedoutsideanyerosionhazardareaswhichborderthenaturalwash.EncroachmentsintothefloodplainofanaturalwasharetobeanalyzedaccordingtotheFEMArequirements.Themaximumriseinwatersurfaceshallnotexceedthoselisted,generally1.0foot.Aswithall?oodplainencroachments,thedevelopmentmustbeadequatelyprotectedfrom?oodinganderosion,andmustnotviolaterestrictionsimposedbymasterdrainageplans.7.3.3ApplicableMethodologiesNormalDepthandVelocity:Ifthedepthanddirectionof?owinanopenchannelarenearlyconstant,the?owregimeissaidtobe"normal",andhydrauliccharacteristicsofthechannelcanbeevaluatedbyusingManningsEquationEquation7.1).Whendelineatingnatural?oodplainsusingManning'sequation,itisimportanttoensurethattheenergygradeline(EGL),slopescontinuouslyinthedownhilldirection,Theenergygradelineisde?nedasalineconnectingtopointsofknowntotalheadortotalspeci?cenergy.Inthosecaseswheretheslopeoftheenegrygradelinedoesnotnearlyequalthechannelbedslope,thenitisnotreasonabletouseauniform?owapproach,andbackwatercalculationsmustbemade.BackwaterProcedure:Theprevioussectioncontainedabriefdiscussiononcomputingnormaldepth,whichassumesthatchangesindischarge,bedslope,andcross-sectionalareaandformoccurrelativelygradually,however,suddenchangeswillproduceadditionalturbulentenergylosseswhicharenotaccountedforintheManning'sequation.Thismaybeparticularlytrueincasesofsuddencontractionsandexpansionsofthechannelcrosssection.Inthoseinstanceswhereanupstreamordownstreamhydrauliccontrolexists,theStandardStepMethodshouldbeusedforevaluatingwatersurfacepro?les.TheprocedureformakingStandardStepcalculationsisgiveninseveraleasilyobtainabletextbooksorreferences.Computerfacilitiesareavailable,andtheengineershouldperformtheStandardStepcalculationsbyusingthereadilyavailableandwell-documentedcomputerprogramHEC-2,writtenanddistributedbytheUS.ArmyCorp'sofEngineers.

OpenChannelHydraulics Page7-