Pico Rivera City Council
January 28, 2025

26 CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L 27 Summary Memorandum
Our team will develop an event summary for
each event. Those will be submitted after
each event and compiled in a final summary
memorandum. This will be a more efficient
approach and ensure summaries are done after
events and effectively capture community input.

Additional considerations and suggestions for
outreach from the Fehr & Peers team include:
› As shown in the schedule, we propose
four phases of outreach to inform content
development, what we will ask of the
community, and how we will use that input
› The phases are:
• Project introduction through
December 2024 with a ligh touch
including a biking tour and pop-ups
• Existing conditions and project
goals: January 2025 through
March 2025 will be the time to share
initial data findings and obtain input
regarding local goals and aspirations
• Toolbox, strategy, project, and
ATMP development: From April
2025 through November 2025, this
will be the focus of the ATMP and
engagement process and would
share the progression of the plan and
project development to receive input
on plan development
• Plan delivery: Expecting that
December 2025 would not have
meetings due to holidays, the plan
delivery meetings, including adoption
hearings would take place January
through February 2026.
• Our schedule shows how we plan
to distribute the meeting activities
including quarterly SAG and TAG
meetings, quarterly webpage
updates, town hall meetings, and
pop-ups.

If funding permits Day One will develop a brief
public opinion survey that will be administered
to a minimum of 300 Pico Rivera residents.

We have budgeted direct cost budget to
purchase refreshments, giveaways, branded
items, tactical urbanism materials, and
translation services for the engagement
activities.

Fehr & Peers staff and/or subconsultants will
participate in each event. Materials, supplies,
refreshments, giveaways, and printing for events
will be coordinated with the City of Pico Rivera.

TASK 3 DELIVERABLES
› Graphic design and materials
› Project committee meetings (Five SAG and
five TAG meetings)
› Website and digital engagement updates
› Four walking or bicycling tours
› Four town hall meetings
› Up to 10 pop-ups
› Up to three tactical urbanism events
› Summary memorandum
TASK 4
Safety Education and
Encouragement Programs
Our team, with Day One in the lead, will organize
five community bicycle rides designed to
explore city facilities and promote greater
bicycle use among residents. These rides will
offer participants the opportunity to experience
the city’s infrastructure firsthand, with some
rides extending to surrounding cities that
already have supportive infrastructure in place.

By highlighting safe and accessible routes,
these rides aim to encourage more residents
to consider bicycling as a viable and enjoyable
mode of transportation.

TASK 4 DELIVERABLES
› Five community bike rides and photos
TASK 5
Facility Analysis, Selection
and Plan Development
Develop Plan Goals and Objectives
Fehr & Peers will collaborate with the City and
project stakeholders to create a comprehensive
list of goals and objectives for the Plan. These
goals will be established through input from the
Project Committee and Town Hall Meetings
and community feedback from the Community
Pop-Up Booths and Bicycle Rides. Once the
City is satisfied that the goals and objectives
have been finalized, the project team will begin
matching them with existing and recommended
future policies to ensure that the goals and
objectives are achieved.

Fehr & Peers will work with the City to
ensure that goals and objectives are clear
and measurable. We will consider specific
performance metrics utilized by other local and
regional jurisdictions, and identify data sources,
and any necessary calculations or formula to
track progress.

Identify and Refine Pedestrian and Bicycle
Facilities/Improvements
The existing conditions analyses from Task 2
and the public and stakeholder input from Task
3 will be the starting point for identifying and
refining pedestrian and bicycle improvements
and developing the active transportation
network. Fehr & Peers will work collaboratively
to develop an integrated list of active
transportation projects, developed using a
complete streets approach to increase benefits
for the community and diversity funding options.

We anticipate that many projects will include
elements that fall under multiple improvement
categories. These include:
• Bicycle improvements: Bicycle
improvements include gap closures and
extensions of existing and planned facilities.

There will be an emphasis on improvements
that support commuting and improve the
mobility and safety of populations with limited
mobility options. Some improvements may
be focused on transit access and others may
include safety improvements for bicyclists at
intersections.
• Pedestrian improvements: Pedestrian
improvements involve enhancing sidewalks,
crossings, and pedestrian pathways to create
safer more accessible environments.
• ADA improvements: ADA improvements
focus on enhancing accessibility for all users,
particularly those with disabilities. These
improvements include upgrading curb ramps,
ensuring compliant sidewalk widths and
slopes, installing detectable warning surfaces,
and enhancing accessible pedestrian signals
and actuation at intersections.

Fehr & Peers will also develop an ATP toolbox
that is inclusive of recent advancements
in active transportation design guidance
including NACTO and the introduction of new
bikeway classifications and design treatments
into more traditional design standards and
Avoid Paralysis by Analysis
Many goals and objectives set by
public agencies are intentionally
“squishy” or unmeasurable. Another
problem arises with expansive lists
of detailed metrics to track progress.

This leads to “paralysis by analysis”
where the effort and cost of tracking
progress becomes an obstacle to
making progress. Fehr & Peers has
helped various clients including
SANDAG and LADOT find efficient
ways to measure progress against
ambitious goals and objectives.

28 CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L 29 manuals such as the California Highway Design
Manual and California Manual on Uniform
Traffic Control Devices. While the global ATP
toolbox has grown exponentially, it is important
that the treatments included are relevant and
appropriate to the physical infrastructure, land
use patterns, and demand.

Operational Analysis #2
Fehr & Peers will build upon the work of
the initial operational analysis in Task 2 by
conducting an updated evaluation to assess
how proposed pedestrian and bicycle
improvements impact the operational conditions
for motorists, bicyclists, and pedestrians.

Performing the bicycle LTS, pedestrian LOC,
and LOS analysis on the proposed network of
improvements is an integral component of the
Plan for several reasons:
• Data-Driven: this analysis provides the City
with clear, data-backed insights into how
proposed improvements impact traffic flow,
safety, and accessibility for all roadway users.
• Community Confidence: demonstrating
a commitment to ongoing analysis and
adjustment reassures the community that
the City is actively working to improve active
transportation conditions.
• Compliance and Funding: many
funding sources require evidence that
proposed changes will lead to measurable
improvements. A reanalysis provides the
necessary documentation to meet these
requirements.

By comparing the results with the baseline
established in the initial operational analysis,
we will provide insights into how proposed
improvements enhance or alter the safety,
comfort, and efficiency of travel for all modes.

This analysis will guide further refinement of the
proposed project designs and exhibits, ensuring
they meet the project’s goals of improving
multimodal transportation options for residents
and visitors of the City.

Project Prioritization
Prioritization processes can be complex and
require multiple iterations. The primary purpose
of this task will be to identify the top projects
that will be developed at the end of this task.

Fehr & Peers has experimented with various
prioritization strategies including:
• Grassroots: community surveys and ranking
exercises at public meetings
• Quantitative: complex algorithms using
key variables to reflect project goals and
objectives
• Opportunistic: based on funding availability,
maintenance schedules or other planned
projects
• Political: elected officials weigh in on the
projects in their area and report back
We typically end up with a process that blends
the above strategies with other nuanced local
considerations. Fortunately, the previous work
(Tasks 2 and 3) will already be in place to inform
the grassroots and quantitative elements. Using
data, feedback, and information from these
tasks, our team will first develop an exhaustive
set of prioritization criteria designed to evaluate
and rank potential active transportation
improvements. This set of criteria will be crafted
to ensure a systemic approach, reflecting critical
factors such as high-collision history locations,
community input and feedback, connectivity of
proposed improvements to local and regional
pedestrian, bicycle, and transit networks, and
the overall cost-effectiveness of each project.

Additional factors related to the socio-economic
and demographic makeup of communities
served, proximity to trip generators such as
schools and parks, and SCAG’s Neighborhood
Mobility Areas (NMAs) definition will also be
considered. Once reviewed by the City and
advisory committees, Fehr & Peers will apply
the prioritization criteria to the recommended
active transportation network, resulting in a
prioritized list of network improvements.

Our team’s project prioritization will facilitate
a fluid implementation strategy, ensuring that
previously adopted planning documents and
the City’s Capital Infrastructure Program (CIP)
are considered in the prioritized project list.

A significant amount of professional judgement
will be required to prioritize projects in a way
that will make sense to City leadership and the
community. In the end, the prioritized list of
projects must make intuitive sense and provide
a good story for each of the most highly ranked
projects.

Preliminary Project Design Exhibits and
Figures
Fehr & Peers will develop detailed project
design exhibits will be prepared for the top 10
projects identified through feedback from Task
3 and the project prioritization methodology.

Each project will include a detailed project
description, a summary of the benefits for grant
applications (e.g., crash reduction applications
for HSIP), detailed section and plan view
conceptual drawings, key issues that the
project intends to address, itemized planninglevel project construction and maintenance estimates, estimated demand, and other
project-related statistics. This task assumes one
round of comments and feedback from City
staff.

TASK 5 DELIVERABLES
› Plan Goals and Objectives
› Proposed Active Transportation Network
and Improvements and ATP Toolbox
› Updated Operational Analysis for Active
Transportation Proposed Network
› Prioritized Project List
› Project Exhibits with Descriptions,
Conceptual Drawings, and Project Statistics
TASK 6
Advanced Conceptual Designs for
Class IV Bikeway on Rosemead
Boulevard in Coordination with
Rosemead/Lakewood Boulevard
Complete Corridor Projects
Task 6 presents an opportunity to lead
regional coordination by example and build
off ideas discussed at the San Gabriel Valley
and Gateway City Councils of Government
(GCCOG, SGVCOG). One idea that has been
put forth for a complete street corridor on
Rosemead/Lakewood Boulevards is a bus rapid
transit route. This roughly 25-mile corridor,
between the Long Beach Traffic Circle and
Interstate 210, is a key north-south corridor that
serves regional and local traffic and numerous
key destinations such as schools, parks, retail
centers, bus stops, and connections to other
bikeways.

Within Pico Rivera alone, Rosemead Boulevard
is just over 4.25 miles and has several geometric
and built environment contexts that will be
critical to effectively developing feasible options
with community input:
› Curb to curb street widths vary
significantly
• 104 feet north of Beverly Boulevard,
with a raised median with multiple
trees
• 64-86 feet between Whittier
Boulevard and Olympic Way with a
raised median of varying widths
• 80-82 feet south of Whittier
Boulevard, with a raised median and
frontage roads along some segments
• South of Danbridge Street the
corridor narrows to just over 70 feet
with a raised median
• Approaching the southern end of the
segment, the width again varies and
widens again to 78-80 feet curb-tocurb

30 CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L 31 › Roadway geometry also varies
• Most of the corridor provides at least
four travel lanes
• Some segments provide six travel
lanes
• The variable width of the raised
median and landscaping would also
be factored into feasibility review and
cost estimates for this task
› Changes in grade
• There is a grade separation of railroad
tracks north of Whittier Boulevard
and the depressed roadway is lower
than the residences and local streets
next to Rosemead Boulevard
• There is another grade separation
between Slauson Avenue and Rex
Road that results in constrained
pinch points with adjacent land uses
elevated above the roadway
• Due to the grades, this is likely to be
one of the most constrained sections
of the corridor
› Streetscape/quality of experience:
• The corridor lacks shade and tree
canopy, which are important to
provide shade for people walking,
biking, or accessing a bus stop
• The City has some utility boxes
painted by local artists and increasing
public art is an opportunity to create
placemaking by local artists
• Wayfinding can help travelers
understand what destinations they
are nearby and how far away in terms
of distance or travel time
• From our work on the HWBSP, we
noted that most bus stops along
Whittier Boulevard provide seating,
shade, trash cans and signage.

The City should strive to continue
providing bus stops with these
features, at a minimum, and consider
enhancements such as wayfinding,
real time transit information, lighting,
and additional shade
› Land uses and destinations
• Key intersections and destinations
will help inform priority areas, such as:
• Rosemead Boulevard & Whittier
Boulevard: Proximate to
community destinations such
as the IdeaLab, Brewjeria, future
Speedway Alley improvements,
the PAD park, and numerous
retail destinations
• Rosemead Boulevard &
Mines Avenue: Three of the
four corners have pedestrian
generators with the Pico Rivera
Library, Smith Park, and La
Monarca Bakery & Cafe. This
intersection provides an eastwest connection to the Rio Hondo Spreading Grounds and
the San Gabriel River and is likely
to receive pedestrian traffic from
Ruban Salazar and El Rancho
High Schools.
• Rosemead Boulevard &
Washington Boulevard: This
is the future location of a lightrail station that will result in hundreds or thousands of
people circulating in the City
without a vehicle and provides
access to retail and residential
land uses
• Single-family, multi-family, and retail
destinations predominantly line the
corridor, with less frequent land uses
including parks, industrial, medical,
and senior housing uses.

Within the City of Pico Rivera Rosemead
Boulevard plays an important role as the only
north-south arterial with regional connectivity,
other than San Gabriel River Parkway and
Interstate 605, and developing alternatives and
cross sections during this phase will consider
the items above for feasibility and suitability,
along with existing conditions data analysis and
input from the community and City staff. Given
the variation in cross-sections, widths, land use,
and grades we propose to develop two or three
alternative cross-sections and plan views for
three segments of Rosemead Boulevard. We
will also develop intersection lane configuration
diagrams for five key intersections to help
compare how the different alternatives impact
intersection geometry for LOS analysis.

This scope includes cost estimates, the
development of up to three alternatives, traffic
and safety analysis for locations identified in
Task 2, and coordination of alternatives and
community input with Rosemead/Lakewood
Boulevard Project. This scope anticipates
high-level conceptual design given the need to
coordinate with the team leading the Rosemead
Boulevard effort.

TASK 6 DELIVERABLES
› Cross-sections and plan views for selected
segments for up to three alternatives
› Alternative selection
› Planning level cost estimates
› Traffic and safety impact analysis
› Coordination of public input with
Rosemead/Lakewood Boulevard Project
TASK 7
Master Plan and Adoption
Our team will work with City staff to develop
a report outline. In addition to the sections
described in the outline we propose including a
description of how equity was incorporated in to
the data collection, engagement, and network
development process. We would also suggest
including an intersection design primer given
the prevalence of collisions at intersections and
crossings.

The plan will also include an implementation
strategy that will describe funding sources, City
responsibilities, and short, mid, or long-term
phasing of the network implementation. Cost
estimates will be included in the implementation
plan to further inform prioritization and potential
funding sources. This will be documented in a
draft and final plan. Fehr & Peers will develop
maps, figures, and a PowerPoint presentation.

Per the RFP we have scoped one adoption
meeting for the City Council.

TASK 7 DELIVERABLES
› Plan outline, draft plan, and final plan with
implementation strategy and cost estimates
› Materials and attendance for City Council
Adoption

32 CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L 33 Proposed Work Schedule
2024 2025 2026
SEPT
OCT
NOV
DEC
JAN
FEB
MAR
APR
MAY
JUN
JUL
AUG
SEPT
OCT
NOV
DEC
JAN
FEB
1 Project Management Plan and
Team Meetings

MMMMMMMMMMMMMM M MMM
Project Management Plan D
2 Existing Conditions Data
Collection and Analysis
Research & Analysis Memorandum DD
3 Community Outreach
Stakeholder Outreach &
Engagement Plan DD
Stakeholder Advisory Group/Blue
Ribbon Committee EEEE E
Technical Advisory Committee E E E EE
Project Webpage & Digital Platforms DDDDD D
Walking/Biking Tours E EEE
Town Hall Meetings MM MM
Pop-ups E E E E E E E E E/M
Open Streets/Tactical Urbanism
Demonstrations E E E
4 Safety Education and
Encouragement Programs
Five Community Bicycle Rides EEEEE
5 Engagement Plan
Goals & Objectives DD
Identify and Refine Pedestrian and
Bicycle Projects DD
Operational Analysis DD
Project Prioritization DD
Project Design Exhibits and Figures DD
6 Advanced Conceptual Designs
for Class IV Bikeway on
Rosemead in Coordination with
Rosemead/Lakewood Corridor
Project
DD
7 Master Plan and Adoption
Master Plan DD
Adoption D
Project
Introduction
Existing
Conditions &
Goals
Toolbox, Strategy, Project, and Plan
Development
Plan
Delivery/
Sharing
Timescale
D Key Draft & Final Deliverables
M Monthly PM Meetings
E Engagement Activities/Meetings
TASKS
F. Client References

CITY OF COVINA ACTIVE STREETS AND

MULTIMODAL CONNECTIVITY PLAN
Daniella Andrade
Planning Division Management Analyst
(626) 384-5445
[email protected]
125 E College Street, Covina, CA 91723
Fehr & Peers has served as a consultant for the City
of Covina since 2017. We recently completed the
Covina Active Streets & Multimodal Connectivity
Plan.

SAN BERNARDINO COUNTY

TRANSPORTATION AUTHORITY
Ginger Koblasz
Data and Analytics Program Manager
(909) 884-8276
[email protected]
1170 W 3rd Street, San Bernardino, CA 92410 US
Fehr & Peers has served as a consultant for San
Bernardino County Transportation Authority
since 2015. We are currently leading the Active
Transportation Plan Prioritization effort.

CITY OF LOS ANGELES (LADOT)
Christopher Rider
Senior Transportation Engineer
(213) 972-8406
[email protected]
100 S. Main Street, Los Angeles, CA 90012
Fehr & Peers has served as an on-call traffic
engineering consultant for LADOT for several cycles,
including the LADOT Vision Zero Conceptual Design.

34 CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L 35 G. Rights to Materials
Fehr & Peers acknowledges that all responses, inquiries, and correspondence relating to this RFP and all reports, charts, displays, schedules, exhibits, and other documentation produced by Fehr & Peers that are submitted as part of the Proposal and not withdrawn shall, upon receipt by the City of Pico Rivera, become property of the City of Pico Rivera.

Per RFP requirement, our fee proposal is submitted in a separate, sealed envelope.

H. Fee Proposal
Appendix A - Required Forms
The following Appendix is not included in the page limit.

LA COUNTY DEPT. OF PUBLIC HEALTH
Alexis Lantz
Senior Policy Strategist
(213) 922-7413
[email protected]
313 N Figueroa St, Los Angeles, CA 90012
Day One partnered with 5 San Gabriel Valley
communities (the Cities of Baldwin Park, Monterey
Park, El Monte, South El Monte, and San Gabriel),
BikeSGV, and Alta Planning to secure funding to
develop and implement a Regional Bicycle Master
Plan for these communities which lacked Caltransapproved plans and suffer from high rates of childhood obesity.

LA METRO
Jim de la Loza
former Metro Chief Planning Officer
(213) 922-3050
1 Gateway Plaza, Los Angeles, CA 90012
The LA River Path Project ($500M, DBBs) is a new
bicycle and pedestrian path along an approximately
eight-mile stretch of the Los Angeles River (River)
from Elysian Valley through Downtown Los Angeles
to the City of Maywood. D’Leon is responsible
for utilities (basemapping, conflict identification,
plan production, relocation design) and third-party
coordination, particularly with LADWP transimission.

36 CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L 37 

$33(1',;&
121ဨ&2//86,21$)),'$9,7
7KHXQGHUVLJQHGGHFODUHVVWDWHVDQGFHUWLILHVWKDW


1. 7KLV3URSRVDOLVQRWPDGHLQWKHLQWHUHVWRIRURQEHKDOIRIDQ\XQGLVFORVHGSHUVRQ SDUWQHUVKLSFRPSDQ\DVVRFLDWLRQRUJDQL]DWLRQRUFRUSRUDWLRQ7KLV3URSRVDOLVJHQXLQH DQGQRWFROOXVLYHRUVKDP

2. ,KDYHQRWGLUHFWO\RULQGLUHFWO\LQGXFHGRUVROLFLWHGDQ\RWKHU3URSRVHUWRSXWLQDIDOVH RUVKDPSURSRVDODQG,KDYHQRWGLUHFWO\RULQGLUHFWO\FROOXGHGFRQVSLUHGFRQQLYHGRU DJUHHGZLWKDQ\RWKHU3URSRVHURUDQ\RQHHOVHWRSXWLQVKDPSURSRVDORUWRUHIUDLQIURP VXEPLWWLQJWRWKLV5)3

3. ,KDYHQRWLQDQ\PDQQHUGLUHFWO\RULQGLUHFWO\VRXJKWE\DJUHHPHQWFRPPXQLFDWLRQ RUFRQIHUHQFHZLWKDQ\RQHWRIL[WKHSURSRVDOSULFHRUWRIL[DQ\RYHUKHDGSURILWRUFRVW HOHPHQWRIWKHSURSRVDOSULFHRUWRVHFXUHDQ\DGYDQWDJHDJDLQVWWKH&LW\RI3LFR5LYHUD RURIDQ\RQHLQWHUHVWHGLQWKHSURSRVHGFRQWUDFW

4. $OOVWDWHPHQWVFRQWDLQHGLQWKH3URSRVDODQGUHODWHGGRFXPHQWVDUHWUXH

5. ,KDYHQRWGLUHFWO\RULQGLUHFWO\VXEPLWWHGWKHSURSRVDOSULFHRUDQ\EUHDNGRZQWKHUHRI RUWKHFRQWHQWVWKHUHRIRUGLYXOJHGLQIRUPDWLRQRUGDWDUHODWLYHWKHUHWRRUSDLGDQGZLOO QRW SD\ DQ\ IHH WR DQ\ SHUVRQ FRUSRUDWLRQ SDUWQHUVKLS FRPSDQ\ DVVRFLDWLRQ RUJDQL]DWLRQ5)3GHSRVLWRU\RUWRDQ\PHPEHURUDJHQWWKHUHRIWRHIIHFWXDWHDFROOXVLYH RUVKDPSURSRVDO

6. ,KDYHQRWHQWHUHGLQWRDQ\DUUDQJHPHQWRUDJUHHPHQWZLWKDQ\&LW\RI3LFR5LYHUD SXEOLFRIILFHULQFRQQHFWLRQZLWKWKLVSURSRVDO

7. ,XQGHUVWDQGFROOXVLYHELGGLQJLVDYLRODWLRQRI6WDWHDQG)HGHUDOODZDQGFDQUHVXOWLQ ILQHVSULVRQVHQWHQFHVDQGFLYLOGDPDJHDZDUGV
6LJQDWXUHRI$XWKRUL]HG5HSUHVHQWDWLYH
1DPHRI$XWKRUL]HG5HSUHVHQWDWLYH 7LWOHRI$XWKRUL]HG5HSUHVHQWDWLYH -HUHP\.ORS$,&3 3ULQFLSDOLQFKDUJH


(;+,%,74',6&/2685(2)/2%%<,1*$&7,9,7,(6
COMPLETE THIS FORM TO DISCLOSE LOBBYING ACTIVITIES PURSUANT TO 31 U.S.C. 1352

1. Type of Federal Action: 2. Status of Federal Action: 3. Report Type:
տ a. contract տ a. bid/offer/application տ a. initial
տ b. grant տ b. initial award տ b. material change
տ c. cooperative agreement տ c. post-award
տ d. loan For Material Change Only:
տ e. loan guarantee year ____ quarter _________
տ f. loan insurance date of last report ___________

4. Name and Address of Reporting Entity 5. If Reporting Entity in No. 4 is Subawardee, Enter Name and Address of Prime:
տ Prime տ Subawardee
Tier _______ , if known
Congressional District, if known Congressional District, if known

6. Federal Department/Agency: 7. Federal Program Name/Description:

CFDA Number, if applicable ____________________

8. Federal Action Number, if known: 9. Award Amount, if known:

10. Name and Address of Lobby Entity 11. Individuals Performing Services (If individual, last name, first name, MI) (including address if different from No. 10) (last name, first name, MI)
(attach Continuation Sheet(s) if necessary)

12. Amount of Payment (check all that apply) 14. Type of Payment (check all that apply) $ _____________ տ actual տ planned տa. retainer
տb. one-time fee

13. Form of Payment (check all that apply): տc. commission տ a. cash տd. contingent fee
տ b. in-kind; specify: nature _____________ տe. deferred Value_____________ տf. other, specify _______________________

15. Brief Description of Services Performed or to be performed and Date(s) of Service, including officer(s), employee(s), or member(s) contacted, for Payment Indicated in Item 12:
(attach Continuation Sheet(s) if necessary)

16. Continuation Sheet(s) attached: տ Yes տNo

17. Information requested through this form is authorized by Title 31 U.S.C. Section 1352. This disclosure of lobbying reliance was placed by the tier above when his transaction was made or entered into. This disclosure is required pursuant to 31 U.S.C. 1352. This information will be reported to Congress semiannually and will be available for public inspection. Any person who fails to file the required disclosure shall be subject to a civil penalty of not less than $10,000 and not more than $100,000 for each such failure.

Signature: _________________________________________
Print Name: _______________________________________
Title: ____________________________________________
Telephone No.: ____________________ Date: ___________

Authorized for Local Reproduction
Federal Use Only: Standard Form - LLL
Standard Form LLL Rev. 04-28-06
Distribution: Orig- Local Agency Project Files 
N/A
(213) 261-3063 8/16/2024
Jeremy Klop, AICP
Principal-in-charge

38 CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L 39 &HUWL¿FDWLRQRI,QGLUHFW&RVWVDQG)LQDQFLDO0DQDJHPHQW6\VWHP,QGHSHQGHQW2I¿FHRI$XGLWVDQG,QYHVWLJDWLRQV5HYLVHG 
Inspector General
California Department of Transportation
Certification of Indirect Costs and Financial Management System (Note: If a Safe Harbor Indirect Cost Rate is approved, this form is not required) Consultant’s Full Legal Name:

Important: Consultant means the individual or consultant providing engineering and design related services as a party of a contract with a recipient or sub-recipient of Federal assistance. Therefore, the Indirect Cost Rate(s) shall not be combined with its parent company or subsidiaries.

Indirect Cost Rate (ICR):

Combined Rate: Or
+RPH2ႈFH5DWH
DQG)LHOG2ႈFH5DWH
LIDSSOLFDEOH

Facilities Capital Cost of Money (if applicable):

Fiscal Period:*
* Fiscal period is annual one year applicable accounting period that the ICR was developed (not the contract period). The ICR is based on the FRQVXOWDQW¶VRQH\HDUDSSOLFDEOHDFFRXQWLQJSHULRGIRUZKLFKILQDQFLDOVWDWHPHQWVDUHUHJXODUO\SUHSDUHGE\WKHFRQVXOWDQW ,KDYHUHYLHZHGWKHSURSRVDOWRHVWDEOLVKDQ,&5
V
IRUWKHILVFDOSHULRGDVVSHFLILHGDERYHDQGKDYHGHWHUPLQHG to the best of my knowledge and belief that:
• All costs included in the cost proposal to establish the ICR(s) are allowable in accordance with the cost principles of the Federal Acquisition Regulation (FAR) 48, Code of Federal Regulations (CFR), Chapter 1, Part 31 (48 CFR Part 31)
• The cost proposal does not include any costs which are expressly unallowable under the cost principles of 48 CFR Part 31
• The accounting treatment and billing of prevailing wage delta costs are consistent with our prevailing wage policy as either direct labor, indirect costs, or other direct costs on all federally-funded A&E Consultant Contracts.
• $OONQRZQPDWHULDOWUDQVDFWLRQVRUHYHQWVWKDWKDYHRFFXUUHGVXEVHTXHQWWR\HDUHQGDIIHFWLQJWKHFRQVXOWDQW¶V RZQHUVKLSRUJDQL]DWLRQDQGLQGLUHFWFRVWUDWHVKDYHEHHQGLVFORVHGDVRIWKHGDWHRIWKLVFHUWLILFDWLRQ I am providing the required and applicable documents as instructed on the Financial Document Review Request form.

Financial Management System:
2XUODERUFKDUJLQJMREFRVWLQJDQGDFFRXQWLQJV\VWHPVPHHWWKHVWDQGDUGVIRU¿QDQFLDOUHSRUWLQJDFFRXQWLQJ records, and internal control adequate to demonstrate that costs claimed have been incurred, appropriately accounted for, are allocable to the contract, and comply with the federal requirements as set forth in Title 23 United States Code (U.S.C.) Section 112(b)(2); 48 CFR Part 31.201-2(d); 23 CFR, Chapter 1, Part 172.11(a)(2); and all applicable state and federal rules and regulations. 2XU¿QDQFLDOPDQDJHPHQWV\VWHPKDVWKHIROORZLQJDWWULEXWHV

• Account numbers identifying allowable direct, indirect, and unallowable cost accounts; • Ability to accumulate and segregate allowable direct, indirect, and unallowable costs into separate cost accounts;
1 Fehr & Peers
183.52
01/01/2022 - 12/31/2022
&HUWL¿FDWLRQRI,QGLUHFW&RVWVDQG)LQDQFLDO0DQDJHPHQW6\VWHP,QGHSHQGHQW2I¿FHRI$XGLWVDQG,QYHVWLJDWLRQV5HYLVHG 
• Ability to accumulate and segregate allowable direct costs by project, contract and type of cost; • ,QWHUQDOFRQWUROVWRPDLQWDLQLQWHJULW\RIILQDQFLDOPDQDJHPHQWV\VWHP

• Ability to account and record costs consistently and to ensure costs billed are in compliance with FAR; • Ability to ensure and demonstrate costs billed reconcile to general ledgers and job costing system; and • Ability to ensure costs are in compliance with contract terms and federal and state requirementV Cost Reimbursements on Contracts:

I also understand that failure to comply with 48 CFR Part 16.301-3 or knowingly charge unallowable costs to Federal-Aid Highway Program (FAHP) contracts may result in possible penalties and sanctions as provided by the following:
• Sanctions and Penalties - 23 CFR Part 172.11(c)(4)
• False Claims Act - Title 31 U.S.C. Sections 3729-3733 • Statements or entries generally - Title 18 U.S.C. Section 1001 • Major Fraud Act - Title 18 U.S.C. Section 1031
All A&E Contract Information:
• Total participation amount ___________________ on all State and FAHP contracts for Architectural & (QJLQHHULQJVHUYLFHVWKDWWKHFRQVXOWDQWUHFHLYHGLQWKHODVWWKUHHILVFDOSHULRGV • The number of states in which the consultant does business is • Years of consultant’s experience with 48 CFR Part 31 is • ,GHQWLI\WKHW\SHRIDXGLWVOLVWHGEHORZWKDWWKHFRQVXOWDQWKDVKDGSHUIRUPHG LIDSSOLFDEOH

Cognizant ICR Audit Local Govt ICR Audit
Caltrans ICR Audit
CPA ICR Audit Federal Govt ICR Audit
I, the undersigned, certify all of the above to the best of my knowledge and belief and that I have reviewed the ICR Schedule to determine that any costs which are expressly unallowable under the Federal cost principles have been removed and comply with Title 23 U.S.C. Section 112(b)(2), 48 CFR Part 31, 23 CFR Part 172, and all applicable state and federal rules and regulations. I also certify that I understand that all documentation of compliance must be retained by the consultant. I hereby acknowledge that costs that are noncompliant with the federal and state requirements are not eligible for reimbursement and must be returned to Caltrans.

Name
** Title**:

Signature: Date:

Phone**: Email**:

$QLQGLYLGXDOH[HFXWLYHRU¿QDQFLDORႈFHURIWKHFRQVXOWDQW¶VRUVXEFRQVXOWDQW¶VRUJDQL]DWLRQDWDOHYHOQRORZHUWKDQD 9LFH3UHVLGHQWD&KLHI)LQDQFLDO2ႈFHURUHTXLYDOHQWZKRKDVDXWKRULW\WRUHSUHVHQWWKH¿QDQFLDOLQIRUPDWLRQXVHGWR establish the indirect cost rate.

Note: Both prime and subconsultants as parties of a contract must complete their own forms. Caltrans will not SURFHVVORFDODJHQF\¶VLQYRLFHVXQWLODFRPSOHWHIRUPLVDFFHSWHGDQGDSSURYHGE\WKH,QGHSHQGHQW2ႈFHRI Audits and Investigations.
2 103,000,000.00
34 38
Lysa Wollard
✔
Chief Financial Officer
Lysa Wollard Digitally signed by Lysa Wollard
Date: 2024.01.30 08:38:21 -08'00'
(925) 977-3211 [email protected]
01/30/2024

40 CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L 41 Appendix B - Resumes
The following Appendix is not included in the page limit.

Jeremy Klop, AICP
Principal-in-charge

EDUCATION
Master of Regional Planning
University of North Carolina, 1999
Bachelor of Science, Biology
Calvin College, 1994

REGISTRATIONS
American Institute of Certified Planners
(018596)

AFFILIATIONS
• American Planning Association (APA)
• Institute of Transportation Engineers (ITE)

EXPERTISE
• Complete Streets
• Transit-Oriented Development
• Safety
• Climate Change

CLIENT COMMENDATIONS
“Working with Fehr & Peers was a
great experience. The seamless
manner in which they communicated
and worked with our team is a model
I encourage other consultant teams to
follow.” Glen Becerra, Deputy Executive
Officer, LA Metro, on working with
Jeremy & team on the LA Metro Quality
of Life Study, 2018.

ABOUT
Jeremy is a principal at Fehr & Peers with over 20 years of experience managing complex transportation studies. Since joining Fehr & Peers in 2002, Jeremy has served on or led several Metro efforts, including the Union Station Master Plan, Active Transportation Strategic Plan, Complete Streets Training, Gender Action Plan, Quality of Life Study, and the Measure M Assessment & Equity Report. Jeremy’s project work often includes complex transportation equity analysis. Fehr & Peers uses comprehensive outreach strategies and specialized data visualization tools to understand community needs and communicate effectively across historic barriers.

PROJECT EXPERIENCE
LA Metro Complete Streets Training & Education (Los Angeles, CA) Principal-in-Charge. Metro invested in a new Complete Streets training curriculum to assist local communities and advance their implementation of Complete Streets projects. Building upon similar work developed by Fehr & Peers for statewide Caltrans district engineer training, Fehr & Peers customized a 2-day course agenda, developed new interactive activities, and prepared annotated training presentations and printed materials for the effort.

Vision Zero Technical Analysis, Action Plan, Assessments & Engagement (Los Angeles, CA)
Principal-in-Charge. Fehr & Peers has been working with LADOT since 2016 to implement Mayor Garcetti’s Executive Directive 10: Vision Zero. As part of these processes, Fehr & Peers conducted extensive peer city reviews, interviewed practitioners across the country and led robust, data-driven efforts to identify the driving causes of traffic injuries and match efficient and cost-effective engineering countermeasures to address the safety challenges. He has been responsible for quality assurance on all materials, conducting and interpreting peer city interviews, and guiding the data analysis process. Jeremy worked with the team that developed the first Vision Zero Action Plan to effectively translate the data analysis findings into an actionable strategy for the Department of Transportation. He has continued working on LADOT’s Vision Zero efforts through the initial implementation of Vision Zero projects along 12 high-priority corridors, recent Transportation Assessments, and through the 2018, 2019, and 2020 Education and Engagement initiatives.

LA Metro Union Station Master Plan & PEIR (Los Angeles, CA)
Project Manager. As part of the team selected by Metro to prepare the LAUSMP, Fehr

42 CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L 43 PROJECT EXPERIENCE (CONT.)
& Peers provided expertise in all aspects of surface transportation and the relationship between transportation and land use. Our multimodal approach includes the relationship and interface between people arriving and connecting via all modes of travel and is focused on the experience and connection to both the history and the future of this iconic station. Fehr & Peers worked closely with staff and the team to provide a management plan for parking as it relates to the station and supports new
development. Our expertise informed the project from early testing of concept alternatives through development of the final master plan. Specific areas of our involvement included transit (rail and bus), pedestrian and bicycle access enhancements, development trip generation analysis, and supporting alternatives development and evaluation for high-speed rail integration.

Analysis also included developing estimates of curb space and circulation needs for emerging technologies like transportation network companies (Uber, Lyft) and autonomous vehicles.

LA Metro Bike-Bus Interface Study
(Los Angeles County, CA)
Principal-in-Charge. Fehr & Peers evaluated bus and bike interactions to understand the safety and operational effects of sharing the road, and the user perspective on such experiences.

We analyzed 15 corridors in the county that contain varying design solutions to accommodate buses alongside bicycles. The data analysis was bolstered by extensive interviews and focus groups with municipal planning staff, bus operators, and cyclists.

The outreach component of this study combined with the
empirical data analysis informed recommendations for roadway design guidance, bicycle safety education, and bus operator training that is broadly applicable throughout Southern California.

LA Metro Quality of Life Survey (Los Angeles, CA)
Principal-in-Charge. Fehr & Peers led the preparation of the Metro Quality of Life study, which evaluated Metro’s investments from 2008, when Measure R was passed, until 2015. The Fehr & Peers team created a new communications tool and developed a framework of key metrics necessary to assess overall
performance. The Fehr & Peers team then developed an analysis structure that examined metrics at the local community or station level, the corridor level, and the regional level. Benefits were described in terms of their effect on equity, economic, and environmental outcomes. Working closely with Metro’s
leadership team, we crafted customer focused messaging and compelling visual content.

LA Metro Measure M 5-Year Comprehensive
Assessment & Equity Report (Los Angeles, CA) LA22-3367
Principal-in-Charge. Fehr & Peers is leading a consultant team for Metro's Office of Equity and Race. The Comprehensive
Assessment and Equity Report reviews Metro's progress related to the goals and plans of Measure M. The final report combines Measure M Ordinance assessment, five years of data, and a compilation of equity concerns, as they relate to quality of life in the region. The plan focuses on five themes of: Mobility, Experience, Community, Regional, and Stewardship. This study involved interviews and collaboration with staff and senior leadership at Metro, convening of community input, collection and analysis of myriad data, development of a narrative based on the data results, and compilation into a highly graphical and engaging public-facing report.

LA Metro Complete Streets Training & Education
(Los Angeles, CA)
Principal-in-Charge. Metro invested in a new Complete Streets training curriculum to assist local communities and advance their implementation of Complete Streets projects. Building upon similar work developed by Fehr & Peers for statewide Caltrans district engineer training, Fehr & Peers customized a 2-day course agenda, developed new interactive activities, and prepared annotated training presentations and printed materials for the effort.

StreetsLA Olympics Legacy Streets (Los Angeles, CA)
Principal-in-Charge. Fehr & Peers was part of the StreetsLA Olympics Legacy Streets team, working with StreetsLA to develop a vision for connecting the Downtown Sports Parks ahead of the 2028 Olympics and Paralympics games. Jeremy served as the Technical Advisory Committee lead for Fehr & Peers, managing engagement with department leaders from across the City family and venue managers from LA Live, USC, and Grand Park. The Downtown Sports Park Network was crafted with the goal of improving safety, public health, accessibility, equity, sustainability, and resiliency. Fehr & Peers incorporated the City’s asset management framework into the project development and
prioritization process.

City of Los Angeles Planning Department, Great Streets
Corridors Benchmarking (Los Angeles, CA)
Principal-in-Charge. The Fehr & Peers team is evaluating all 15 Great Streets corridors. For each, we are exploring a host of metrics related to public life and the goals of ED1. We are assessing each corridor before and after project implementation to shed light on how the Great Streets interventions have influenced their surroundings. We are also researching areas not slated to receive Great Streets enhancements. This establishes a baseline against which to compare the Great Streets corridors.

Fehr & Peers is overseeing all aspects of the project. Our firm is providing project management; coordinating fieldwork;
collecting, compiling, and analyzing data; and providing written documentation of our research. Our final reports will be production quality and will also include an online data visualization component.

Miguel Núñez, AICP
Project Manager

EDUCATION
Master of Arts, Urban Planning
University of California, Los Angeles, 2007
Bachelor of Arts, Political Science
University of California Los Angeles, 2004

REGISTRATIONS
American Institute of Certified Planners
(024917)

EXPERTISE
• Transit Planning
• Long-range Multimodal Transportation
Planning
• Parking Studies
• Bicycle and Pedestrian Planning
• Multimodal Corridor Planning
• Land Use and Transportation
• Multi-ethnic Community Engagement
• Traffic Analysis

CLIENT COMMENDATIONS
“Excellent. Helped Community get
the grant. It was a pleasure to work
with Miguel. Very responsive and
understood our needs” Anthony
Leonard, Project Manager, CivicWell, on
working with Miguel on the Thermal
Oasis ATP Support
ABOUT
Miguel Núñez, AICP, has over 17 years of experience in transportation planning, specializing in areas of expertise in pedestrian and bicycle planning, complete streets, and multimodal planning. Miguel managed Fehr & Peers efforts on the I-710 Livability Initiative, the Downey Active Transportation Plan, the People St Evaluation effort, the Huntington Park Complete Streets Plan, and General Plans for the Cities of Cudahy, Whittier, and Carson, all focused on implementable improvements and strategies for enhancing mobility and safety for all road users. Through his experience working on projects with a multimodal emphasis, complex and controversial traffic impact studies, and numerous regional transportation plans, Miguel has helped a wide range of communities expand transport options for their stakeholders. He has managed pedestrian safety assessments throughout California and presents at industry conferences on emerging and innovative multimodal practices.

PROJECT EXPERIENCE
Pico Rivera Historic Whittier Boulevard Specific Plan (Pico Rivera, CA) Fehr & Peers is currently assisting a team with the Historic Whittier Boulevard Revitalization Program/Specific Plan (HWB) for the City of Pico Rivera. The Plan will serve as the foundation for establishing a formal “uptown” district within the city. In terms of mobility, the Specific Plan will provide guidance for the multimodal and streetscape design plan that will complement proposed land use and policy changes on Whittier Boulevard. Fehr & Peers's role is to complete the Multimodal & Streetscape Plan as part of the Specific Plan. Fehr & Peers has documented and analyzed existing transportation conditions through a review of prior City documents and studies, fieldwork, and multimodal data collection. Our work has identified opportunities and constraints associated with multimodal transportation improvements (e.g., installing Class IV bike lanes, bus lanes, or shared bus/bike lanes) and includes an assessment of existing active transportation (walking and bicycling) patterns, public transit networks and vehicular circulation using available model, geospatial and collision data. Fehr & Peers has also participated in community engagement events to understand mobility needs of the community and will continue to provide public outreach support. This effort will result in updated goals, policies, and implementation actions that are consistent with the community’s values and desired future transportation conditions. Fehr & Peers will also support the team in addressing the CEQA checklist needs of the project, including vehicle miles traveled (VMT) analysis for the proposed land uses associated with the Specific Plan. Miguel is the Project Manager on this effort.

44 CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L 45 Metro Active Transportation Strategic Plan (Los
Angeles, CA)
Fehr & Peers prepared the Active Transportation Strategic Plan, which built support and set funding levels for active
transportation projects in LA’s successful sales tax initiative for transportation. The process of understanding the existing conditions included extensive data assembly from multiple stakeholders, data analysis, and the creation of visual displays and an interactive Web mapping system to organize and
communicate a complete picture of transportation issues at each of 661 high-ridership Metro transit stops and stations. Fehr & Peers considered innovative engineering and funding strategies, in conjunction with Metro, to expedite improvements and encourage successful build-out of the bikeway network. Fehr & Peers also developed an implementation plan that includes performance metrics, benchmarks, and implementation strategies to assist decision makers.

City of Downey Citywide Bicycle Master Plan (Downey,
CA)
Fehr & Peers led the preparation of the Downey Citywide Bicycle Master Plan, following Fehr & Peers’ effort on the regional Gateway Cities Council of Governments (GCCOG) Active
Transportation Plan (ATP). Fehr & Peers coordinated with city staff to develop a network of proposed bicycle facilities that identify bicycle parking locations and the bicycle facility classification and appropriateness for a given street, based on facility type, street characteristics, and nearby bicycle generators.

Analysis of proposed facilities focused on consolidating prior efforts and providing implementation and prioritization strategies based on local conditions and preferences, consistent with ATP grant requirements. We synthesized input gathered from the public through social media channels, the project website, community workshops, a Bicycle Circulation Assessment Needs Survey, and discussions with city staff to define the overarching goals and specific supporting objectives of the Bicycle Master Plan.

I-710 Livability Initiative (Gateway Cities, CA)
Fehr & Peers is leading the I-710 Livability Initiative, a grantfunded multidisciplinary effort initiated by the Gateway Cities COG and Metro, to identify livability and complete streets challenges, project ideas, and implementation options along the I-710 corridor. Specifically, this effort is focused on 30 corridors, within a one-mile radius of I-710, between SR-60 and Ocean Boulevard. This project focuses on a variety of challenges and solutions, such as but not limited to, improved pedestrian crossings, enhanced LA River access, landscaping, lighting, green streets, and public art. In addition to complete streets considerations, our team is also focusing on streetscape, urban design, and storm water recapture projects that offer substantial local benefit and can help eligibility for increased funding opportunities. Finally, stakeholder outreach to agency staff and the public are critical parts of this effort, with over 20 outreach events such as stakeholder interviews, group meetings, pop-up events, and public meetings throughout the corridor. This project will conclude in August of 2018 and Miguel is the consultant team Project Manager.

Downtown Glendora Parking Study (Glendora, CA)
Fehr & Peers prepared a Downtown Parking Study for the City of Glendora. The city has a burgeoning downtown that includes coffee shops, retail, local services, and restaurants with limited outdoor seating. Residents and merchants were concerned that there was insufficient parking in the downtown area to meet demand and that it was hurting local businesses, asking the City to study the situation. Fehr & Peers initiated the study with an extensive areawide parking supply and occupancy data collection effort that included on-street and off-street parking. Data was collected for weekdays and weekends throughout the day. The supply and occupancy data was then mapped and presented to staff and local stakeholders. The data revealed that while it was hard to find parking on a particular block with popular destinations, there were generally spaces available for people to park within one block. As a result, it was not necessary for the City to consider expanding parking supply. Instead, the City opted to increase awareness of the available parking areas by adding signage and considering modification to parking time limits to encourage turnover in the busiest areas. Since that time, the City of Glendora has also invested in bike and walking infrastructure to reduce parking needs and increase the ability for visitors and locals to access the central business district in a variety of ways.

City of Cudahy General Plan (Cudahy, CA)
Fehr & Peers assisted a team with the Circulation Element of the General Plan for the City of Cudahy. We documented and
analyzed existing station area transportation conditions through a review of circulation patterns and available data from previous and ongoing projects. Our work in this task was focused on analysis of opportunities and constraints associated with potential multimodal transportation improvements and included an
assessment of existing active transportation (walking and bicycling) patterns and vehicular circulation. Fehr & Peers also supported the team in the mobility components of the CEQA checklist. The Circulation Element involves classification of the street system and updated goals, policies, and implementation actions consistent with the community’s values and desired transportation conditions and analysis of intersections and street segments. Fehr & Peers worked with the team to develop a Circulation Element and analysis that was both legally defensible and reflective of current changes in statewide legislation. The effort included a forecast of future transportation conditions using a regional or sketch level transportation analysis model, a background technical report, and an evaluation of future conditions with and without the proposed project. Miguel was the Project Manager.

Claude Strayer PE, RSP1
Conceptual Design Lead

EDUCATION
BS, Civil Engineering

REGISTRATIONS
Civil Engineer, CA #86774
Civil Engineer, AZ #68882
Civil Engineer, HI #17856

AFFILIATIONS
Institute of Transportation Engineers
(ITE), Member
ITE Pedestrian & Bicycle Standing
Committee, Chair
ABOUT
Claude has a range of transportation experience with the design of traffic signals, bicycle facilities, signing and striping plans, safe routes to school improvements, pedestrian facilities, wayfinding and the public involvement process. He has led teams of designers on a variety of other transportation engineering projects such as temporary traffic control, roadway and sidewalk design, and lighting. He also has experience performing traffic analysis as well as studies with respect to parking, circulation and school zone safety.

PROJECT EXPERIENCE
Clark Avenue Protected Bicycle Facility Design PS&E (Long Beach) Fehr & Peers is leading the preparation of signing, striping, and signal modification plans for the construction of a 2.7 mile protected bikeway on Clark Avenue between Anaheim Street and Monlaco Road. The design includes complete streets elements such as bus boarding islands and protected intersections, and a roundabout is being studied at a complex sixlegged intersection. Clark Avenue will provide a multi-modal connection between Cal State Long Beach’s Beachside Campus housing and other student housing in the area, to both Long Beach City College on Clark Avenue, and Cal State Long Beach’s main campus via Atherton Street. The protected bike facility includes a mix of two way and one way facilities, with the crossover using bike signals at a protected intersection at Willow Street and Clark Avenue. Beyond the two-way section, which will feature raised medians, the facility will use the City’s quick-build concrete raised separators.

Fehr & Peers conducted a traffic operational analysis to determine how lane repurposing will affect travel time on the corridor. As part of the evaluation of the roundabout, Fehr & Peers is developing a Vissim simulation model to test configuration options. Fehr & Peers will prepare a project fact sheet with renderings and operations data to highlight the benefits and tradeoffs associated with the project for use in community outreach. Claude is the Engineer of Record.

46 CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L 47 Cherry Avenue Protected Bicycle Facility Design (Long
Beach)
To support the implementation of protected bikeways in
the City of Long Beach per the City’s Bicycle Master Plan, Fehr & Peers is leading the preparation of signing, striping, and signal modification plans for a 1.5 mile protected
bikeway on Cherry Avenue between Spring Street and
Carson Street. While Cherry Avenue is identified as an 8 to 80s corridor in the Bicycle Master Plan, it is also a truck corridor and provides important access to a major
logistics/aerospace manufacturing facilities developed by Goodman. Fehr & Peers’ design will balance the need for cyclists and trucks on the same corridor. Particular design focus will be paid to the connections between the Class IV bicycle facility on Cherry Avenue with the Wardlow Road protected bicycle facility developed as part of the
Goodman project, while still maintaining primary access for large trucks on Wardlow Road. Fehr & Peers will also
leverage the best practice guide that we authored for ITE Recommended Design Guidelines to Accommodate
Pedestrians and Bicycles at Interchanges to guide the
design of the protected bicycle facility at the Cherry
Avenue ramps of the I-405 freeway. Claude is the Engineer of Record.
3rd and Broadway Class IV Upgrades (Long Beach)
Fehr & Peers was brought on to assist with the permanent buildout of protected bicycle lanes along Broadway and
3rd Street in Downtown Long Beach associated with the
Broadway Block development project. Tasks include a
signing & striping plan and a signal modification plan. This project provides an opportunity to upgrade existing Class IV bikeways with curbs and a bicycle signal at an at-grade intersection with the LA Metro A Line. Claude was the
Engineer of Record.

Alameda Complete Streets Project (Union Station
Esplanade) (Los Angeles)
Fehr & Peers prepared the plans, specifications and cost estimates (PS&E) for signal modifications, traffic signal interconnect, and signing and striping for the Alameda
Esplanade and Los Angeles Crossing in front of Union
Station in LA, a project funded by two separate ATP grants.

The project includes a substantial reconfiguration of the driveway at Union Station, as well as lane repurposing on Alameda Street to provide wider sidewalks, and off-street bike paths and shared use paths. The bike path crossings include signal protection to enhance pedestrian and bicycle safety, as well as a raised crossing on Alameda Street, a first for the City of Los Angeles on a busy arterial and truck corridor. The engineering design plans for traffic signals, signal interconnect, and signing and striping were
prepared for LA Metro for submittal to the Los Angeles
Department of Transportation, who approved the
construction drawings. The project also included a separate Caltrans plan submittal and a Design Standard Design
Document (DSDD) for non standard elements that were
ultimately approved by Caltrans. Claude was the Engineer of Record.

San Diego State University Mission Valley Campus
(San Diego)
Fehr & Peers handled the transportation planning analysis and design services for the SDSU Mission Valley campus at the SDCCU (formerly Qualcomm) Stadium site. This
included assisting with the site planning and development of the overall mobility network, which involved multimodal facilities and design of two multilane roundabouts. This included the preparation of the Transportation Impact
Analysis (TIA) for the environmental document that
included the traffic operations analysis (i.e., level of service at intersections, on roadways, and on freeway facilities). We are currently working at the final design level of the design including roadway signing and striping and traffic signals PS&E for both on and off-site traffic engineering
improvements. Our work includes design of signing and
striping for on-site roadways, lighting design, a roundabout and signal design for both interior signalized intersections and modifications for perimeter streets to the new
development. Claude is Engineer of Record.

North-Park Mid-City Bikeways (San Diego)
Fehr & Peers completed the planning, specifications and estimates (PS&E) for 11 traffic signal modifications along the Meade, Georgia, and Landis bikeways in the North ParkMid City area of San Diego, as well as the wayfinding design for the Meade and Landis bikeways. The signal
modifications included the preparation of 100% plans that addressed the planned removal of separate left-turn lanes at numerous intersections, the installation of curb
extensions/bendouts, and modifications to signal phasing.

Claude was design engineer.

Emily Finkel, RSP1
Safety System Expert

EDUCATION
University of Southern California, Master of
Planning, 2016
Northeastern University, B.S. Business
Administration, Marketing, 2009

PRESENTATIONS & PUBLICATIONS
Institutionalizing the Safe System Approach in
Local Road Safety Plans ITE Technical Brief
(2023), presented at ITE Spring Conference
(2022) and national ITE webinar (2023)
California Statewide Guidance on High Injury
Networks - a report of the Strategic
Highway Safety Plan Pedestrian Challenge
Area Committee (2021)
Integrating the Safe System Approach with
the Highway Safety Improvement Program –
FHWA report (2020)
Shifting the Paradigm: Innovative Approaches
to Equitable Road User Safety – Association
of Pedestrian and Bicycle Professionals
Conference (2019)
Implementing Vision Zero: Getting from
Policy to Practice – American Planning
Association California Conference (2018)

CERTIFICATIONS & AFFILIATIONS
Roadway Safety Professional, Level 1
Certification ID: 723
Member, ITE Vision Zero Executive
Committee
ABOUT
Emily Finkel is an Associate with Fehr & Peers in the Long Beach office. She is a senior leader of the Fehr & Peers Safety Discipline Group and has managed more than a dozen recent safety planning projects throughout California and the Southwest, including Vision Zero, Local Road Safety Plans, and Systemic Safety Analysis Reports.

Emily was the lead author for the recent FHWA report Integrating the Safe System Approach with the Highway Safety Improvement Program. Emily has supported several safety planning clients in successfully securing millions of dollars for safety improvements through the Caltrans HSIP and USDOT SS4A grant programs.

VISION ZERO AND SAFETY PLANNING EXPERIENCE
Los Angeles Vision Zero 2.0 Technical Analysis
Los Angeles was one of the first national leaders in adopting a Vision Zero goal in 2015. Now, LADOT will be one of the first agencies to usher in an era of “Vision Zero

2.0” in refining and improving their program. Fehr & Peers is supporting LADOT in a comprehensive update to their initial Vision Zero technical analysis, originally completed 2015-2017. With several Vision Zero projects having been implemented five or more years ago, LADOT and Fehr & Peers will partner to evaluate successes and failures, reestablish priorities, and double down on what is proven to work best in improving road safety. The state of the practice has evolved since Los Angeles adopted Vision Zero in 2015, and Fehr & Peers will bring new industry innovations and best practices, such as systemic safe analysis, big data and near-miss analysis, and the Safe System approach, to the forefront of LA’s Vision Zero program. This project provides an opportunity to assess LA’s progress, and once again provide a national best practice model in Vision Zero analysis methods based on a systemic approach.

Emily is the project manager for this effort, and has supported various outreach and technical analysis efforts over several years for this project.

Sacramento Vision Zero Action Plan and Implementation
Fehr & Peers worked with the City of Sacramento to develop a Vision Zero Action Plan. The goal of the plan is to eliminate traffic fatalities and severe injuries citywide.

Emily led the collision data analysis and mapping effort, building a database that integrates collision records with environmental factors. Emily also wrote and developed the Vision Zero Action Plan for the City of Sacramento. She also assisted the City on safety countermeasure implementation on priority corridors through the Top 5 Corridors Project, developing corridor-specific countermeasures to address the factors that contribute to the high collision rates and high speeds.

48 CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L 49 El Paso, TX Vision Zero Action Plan
Fehr & Peers led the systemic safety analysis for El Paso's first Vision Zero Plan. Fehr & Peers’s role on the team was to conduct the data discovery and data collection, perform crash data analysis and develop the High-Injury Network (HIN), prepare collision profiles with crash reduction costs, prioritize locations for immediate attention, as well as prepare a predictive safety model that would help identify risky locations based on crash history, land use and roadway characteristics. Fehr & Peers also prepared the web-based Data Dashboard on the Esri Enterprise GIS Platform. Emily is the Associate-In-Charge for this effort and leads the data analysis team.

Los Angeles Vision Zero Transportation Assessments
Fehr & Peers performed corridor transportation assessments for LADOT in support of proposed safety projects along 13 Vision Zero corridors. This assessment included vehicle operations analysis, documenting existing volumes and collision patterns, using Streetlight big data to understand trip-making patterns on each corridor, and opportunities for mode shift. Fehr & Peers also conducted before-and-after studies on countermeasures,
updated prior technical analysis, and prioritized new locations for implementation. Emily was the PM for this effort, and has supported various outreach and analysis efforts over several years for LADOT’s Vision Zero program. The City hired Fehr & Peers to perform this work for the next round of priority corridors, and Emily is currently serving as a Technical Advisor on that work.

Additional Vision Zero Technical Analysis Advisor
Roles:
x City of Berkeley
x City of Fremont
x City of Oakland
x City of Sunnyvale
x Contra Costa County
x Arlington County, VA
x Boulder, CO
San Bernardino County Local Road Safety Plan
Fehr & Peers developed the San Bernardino County’s Local Road Safety Plan (LRSP) focused on County maintained roadway within unincorporated San Bernardino County. This Local Road Safety Plan applied a dual-pronged approach: 1) identifying priority systemic safety improvement projects based on high-risk roadway features that are correlated with fatal and severe collision types, and 2) reviewing collision trends to develop behavioral countermeasures. This project incorporated the Safe System approach, shifting from the traditional goal to reduce overall vehicle collisions towards the goal of reducing overall kinetic energy and thereby reducing the number of fatal and severe collisions. Through this plan, Fehr & Peers developed HSIP grant applications for the County, which resulted in $10 million dollars of funding for implementation. Emily was the AssociateIn-Charge for this effort.

Additional LRSPs completed:
x City of San Jacinto (PM)
x City of Oxnard (PM)
x City of Westminster (PM)
x City of Montclair (PM)
x City of Irvine (Associate-In-Charge)
x City of Moreno Valley (Technical Advisor)
OCTA Systemic Safety Plan - SSARP
The Orange County Transportation Authority (OCTA) hired Fehr & Peers to develop a Systemic Safety Analysis Report covering all of Orange County. The detailed collision analysis methodology developed for this project categorizes crash types by the roadway and land use characteristics of the immediate crash location and identifies appropriate engineering countermeasures that can be applied systemically and proactively to similar locations countywide, even if severe or fatal collisions have yet to occur at many of these locations. Emily served as Deputy Project Manager for this project.

Additional Systemic Safety Analysis Reports
completed:
x City of Moreno Valley (PM)
x City of Montclair (PM)
x City of Lancaster (PM)
FHWA Safe System Support for HSIP
Fehr & Peers, ITE, Vision Zero Network, and Leidos worked with the Federal Highway Administration Office of Safety to develop education materials related to the Safe System approach. These materials include a short video, a flyer, and a 30-minute presentation. In addition to the educational materials, we investigated the relationship between Safe System and existing safety funding programs, such as the Highway Safety
Improvement Program (HSIP). Emily led the development of Safe System recommendations for HSIP.

Caltrans District Safety Plans
Fehr & Peers, in partnership with Kittelson, is creating a safety plan for each of the Caltrans Districts. We are developing a statewide analysis approach and plan strategy to be piloted in District 3 then rolled out to the other districts. The plans are based on the Safe System approach and are a key part of the implementation of the Caltrans Safety Pivot started by the State Highway Safety Plan. Emily is leading the Literature Review and District Plans for Southern California.

Sean Reseigh
Project Planner/Data Lead

EDUCATION
Master of Geographic Information Science
California State University Long Beach, 2018
Bachelor of Arts, Natural Resources and
Environmental Management
University of Hawai`i at Manoa 2016

EXPERTISE
• Active Transportation Planning
• Bicycle and Pedestrian Planning
• First-Last mile planning
• Field Inventory projects
• Systemic Safety Planning
• Safe Routes to School Planning
• GIS database procurement and
management
• Big Data Analysis

PRESENTATIONS
• Ensuring ADA Compliance of Sidewalks,
2022 Esri User Conference
SKILLS
• Data Science (Python, Jupyter Notebooks,
Tableau, Excel)
• Visual Communications (Adobe Creative
Suite, Articulate Rise360)
• Geospatial Analysis (Esri Suite, ArcGIS
online, QGIS)
• Remote Sensing (ENVI, ERDAS, LiDAR)
• Web Development (Leaflet and ArcGIS API)
ABOUT
Sean is a transportation planner in the Long Beach office who specializes in geospatial analysis, data science, and data visualization. He has a refined proficiency in developing and managing data collection efforts across multiple disciplines – lending to his ability to oversee the entire process of developing a GIS database. Sean also has experience in systemic and local roadway safety projects, active transportation and safe routes to school projects, first-last mile studies, and local and regional field inventory pursuits. He has an acute skillset in developing data dashboards for public outreach, internal use, data management, and storytelling.

RELEVANT EXPERIENCE
SCAG Southern California Goods Movement Communities Opportunities Assessment
Fehr & Peers worked to assess the impacts of the goods movement industry on disadvantaged communities within the SCAG region. The goal is to connect these burdened communities to career opportunities in the freight sector through workforce development pathways in order to be a part of the solution. The project had a substantial community outreach and engagement component, with a series of listening workshops and input collected through F&P's Crowdsource+ tool. The final product was to develop and disseminate an opportunities toolkit for SCAG in the form of a StoryMap, that identifies community types, challenges, and opportunities within the goods movement industry. Sean was a planner and analyst on this effort.

SBCTA Pedestrian Sidewalk Connectivity Plan Phase II (San Bernardino County, CA)
Fehr & Peers developed Phase II of the comprehensive pedestrian sidewalk connectivity plan for SBCTA. Phase I conducted a countywide sidewalk inventory to pinpoint existing sidewalk gaps and pedestrian obstructions, identify potential improvements, and address ADA requirements. The purpose of Phase II was to expand on the data collected in Phase I, by collecting additional obstruction data on existing sidewalk such as lighting, utilities, adjacent parking, signposts, trees, driveways, and other points-of-conflict, as well as conducting a detailed ADA analysis. All collected data were be added to an existing public facing dashboard designed to provide broad

50 CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L 51 access and improved efficiency of data collection and
management at the regional and city level. Sean was the project manager on this effort.

Los Angeles County Traffic Safety Guidelines Update
(Los Angeles County, CA)
Fehr & Peers is supporting the Los Angeles County Public Works in updating guidelines and policies for recommending traffic safety infrastructure, and provide resources to staff, including standard drawings and plans, to incorporate traffic safety improvements in future projects. The resulting guidelines will utilize and institutionalize the principles of the Safe System approach with the goal proactively eliminating traffic-related fatalities and severe injuries on County-maintained roadways.

Fehr & Peers is developing a visually compelling design guide with updated roadway treatment guidelines and standards, safety benefits, application guidance, and treatment renderings. Sean is the Project Manager for this effort.

Los Angeles Vision Zero 2.0 Technical Analysis
Fehr & Peers supported LADOT in a comprehensive update to their initial Vision Zero technical analysis, originally completed 2015-2017. With several Vision Zero projects having been implemented five or more years ago, LADOT and Fehr & Peers will partner to evaluate successes and failures, reestablish priorities, and double down on what is proven to work best in improving road safety. The state of the practice has evolved since Los Angeles adopted Vision Zero in 2015, and Fehr & Peers will bring new industry innovations and best practices, such as systemic safe analysis, big data and near-miss analysis, and the Safe System approach, to the forefront of LA’s Vision Zero program. This project provides an opportunity to assess LA’s progress, and once again provide a national best practice model in Vision Zero analysis methods based on a systemic approach.

Sean is the Data Science lead on this project and has led the development and deployment of the high injury network (HIN) and prioritization methodologies used to update and expand on the technical analysis completed in 2017.

WRCOG Origin-Destination Assessment (Riverside
County, CA)
Fehr & Peers conducted an origin-destination assessment to identify how trip making occurs within each jurisdiction in WRCOG. Each member agency was provided a detailed
infographic containing data from StreetLight, California Household Travel Survey (CHTS), Census information, and Longitudinal Employment Household Data (LEHD). The
combination of data resulted in a holistic understanding of travel patterns and community profiles, helping agencies identify improvements to enhance high-demand and low-demand trips, and promote equal access to all people. Sean was an analyst on this project.

OCTA Mobility Hubs (Orange County, CA)
Fehr & Peers was hired as part of a larger team to lead the technical tasks associated with the Regional Mobility Hubs Study for OCTA. As a first step, we helped provide various definitions of mobility hubs in order to help OCTA pinpoint the most appropriate strategies for Orange County. We then developed a suitability web map that incorporated five mobility hub demand profiles to help capture demand potential from commuters, tourists, students, and entertainment seekers. Our final step was to develop and execute a methodology for estimating potential mode shift using regional travel demand model outputs and unique time/cost calculations for the different mobility hub services provided within proposed service areas. Sean was an analyst on this project.

Los Angeles Metro Green Line Extension (Los Angeles,
CA)
Fehr & Peers is leading the preparation of the transportation impacts chapter of the project’s EIR. In support of alignment design, Fehr & Peers is evaluating roadway operations and the effect of Light Rail Transit operations on grade crossings through the development and analysis of a Vissim microsimulation model.

Additionally, Fehr & Peers conducted an emergency response assessment to analyze potential travel time effects on emergency vehicle response times with the proposed at-grade crossings.

Sean was an analyst on this project.

Nata Kovalova Transportation Engineer/Planner

EDUCATION
Master of City Planning, Sustainable
Transportation and Infrastructure, University
of Pennsylvania
Bachelor of Arts, Economics and History,
Williams College

YEARS OF EXPERIENCE
Total: 2
With Fehr & Peers: 1

SOFTWARE
• ArcGIS
• Synchro

EXPERTISE
• Complete Streets
• Data Analysis
• Transportation Impact Analysis

FLUENCY
• Russian, Fluent
ABOUT
Nata is a transportation planner based in the Fehr & Peers Los Angeles office. She recently received her master's degree in city planning, sustainable transportation & infrastructure from the University of Pennsylvania. Her previous experience includes internships with the Office of Transportation, Infrastructure, and Sustainability (OTIS) and serving as a graduate research assistant with the University of Pennsylvania. Since joining Fehr & Peers, Nata regularly performs local origin-destination analysis, complete streets planning, and traffic impact studies. She is skilled in Synchro and GIS and is fluent in Russian.

RELEVANT PROJECT EXPERIENCE
Goleta Office TDM Plan (Goleta, CA)
Transportation Planner. Fehr & Peers prepared a study for the Hollister Avenue office project in the City of Goleta. The project was previously approved by the City and was required to complete a Transportation Demand Management Plan (TDMP). We assisted in the preparation of the TDMP by quantifying the various TDM measures that are already being proposed as part of the project. The purpose of this study is to determine if the TDM measures being proposed would reduce vehicle miles traveled (VMT) generated by the project enough to meet the City’s VMT threshold for employment generating uses. We utilized the Fehr & Peers TDM+ Tool as part of this effort.

Claremont College Traffic Study (Claremont, CA)
Project Manager. Fehr & Peers is preparing a traffic study for the proposed Student Services Building at Claremont Colleges. The project consists of the design and development of a new two-story Student Services Building (approximately 29,000 GSF) in the Mudd Quad located on the southeast corner of Dartmouth Avenue and E 10th Street in Claremont, CA. The new building will include space for OBSA, CLSA, SDRC, and Spiritual Life departments, Food, Shared Affinity Group use, and Social/Event space. Outdoor space will also include an area for events, small groups, and an independent study. This project will combine existing services currently housed in various buildings across the campuses into a singular building. The purpose of the transportation study is to determine the potential transportation impacts resulting from the proposed project for review and approval by the City of Claremont. This study will adhere to the City of Claremont Draft Transportation Study Guidelines for Vehicle Miles Traveled and Level of Service Assessment (City’s Guidelines) published in August 2020.

52 CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L 53 RELEVANT PROJECT EXPERIENCE (CONT.)
City of Burbank Vision Zero Plan (Burbank, CA)
Transportation Planner. The City of Burbank is developing their first safety plan in an effort to identify proactive and reactive approaches to addressing safety need throughout the city. The Vision Zero Plan will be USDOT SS4A and Caltrans HSIP
compliant to ensure eligibility for the City in upcoming grant cycles. The project will include collision landscape, systemic, and high-injury network analyses to feed into countermeasure and project identification. A Vision Zero Working Group will be established comprised of City department leads to build awareness and identify champions across the city. As part of the Working Group, this project will conduct a hurdles & policy analysis to identify potential challenges that may arise in implementing Vision Zero. An attitudinal survey will be conducted as part of that analysis.

LA Metro On-Call Sustainability Task Order,
Climate Emissions Study & VMT Target Setting
(Los Angeles, CA) LA21-3333
Transportation Planner. Fehr & Peers is providing advisory services to Metro to establish tangible VMT targets that comply with CEQA requirements for parallel Metro efforts. Fehr & Peers is also providing ongoing review and advisory services for VMT and GHG estimation.

The Nature Conservancy Land Conservation & VMT
Reduction (Riverside, CA)
Transportation Planner. In partnership with RCTC/RCA, WRCOG, and Caltrans, Fehr & Peers has been asked to support The Nature Conservancy in informing the design of a VMT Strategy that integrates conservation lands and land protection as an eligible activity for VMT mitigation across Western Riverside County based on pre-identified areas for conservation. Our effort will focus on finalizing a workflow to verify: (1) which parcels could be used as VMT mitigation (e.g. are they parcels in high or low VMT-generating areas), (2) what is the current zoning of those parcels and/or the likely development potential of those parcels, and (3) finalizing a method to quantify how much VMT would be reduced if those parcels were placed into land conservation.

City of West Hollywood WeHo Rail Integration
(West Hollywood, CA)
Transportation Planner. Fehr & Peers is part of a team supporting the City of West Hollywood in assessing the benefits and tradeoffs of various alternatives for the Metro Crenshaw North light rail project, which is in the early conceptual design and planning phase. The City of West Hollywood seeks to be an active participant in the planning process to ensure the final alternatives best meet the city’s needs and is thoughtfully integrated into one of the densest small cities in the region. Fehr & Peers’s work has included a regional origin-destination travel market analysis to illustrate the importance of an alignment serving the western end of the city; the travel analysis examined equity and economic support for a direct rail connection to historically marginalized and disadvantaged communities compared with the burden of driving or using the existing transit network. Other tasks have included analyzing the street network conditions to identify safety and connectivity concerns for pedestrians and bicyclists in accessing stations, and evaluating station portal siting through a transit and pedestrian connectivity lens. Upcoming work will evaluate station mode of access and curbside demand to
influence station design, and helping the City consider what adjustments to the city-operated transit lines would benefit station first/last-mile connections.
225 N. La Brea Ave VMT & Trip Generation
(Inglewood, CA)
Transportation Planner. Fehr & Peers used the City of Inglewood VMT Calculator Tool to conduct a screening analysis of a proposed 137-unit multi-family residential project in downtown Inglewood. Additional data collection and analysis was conducted to develop estimates of net daily trip generation for the project, which would be located in close proximity to a light-rail transit station.

City of Culver City Complete Streets (Culver City, CA)
Transportation Planner. Fehr & Peers is supporting as a subconsultant to prepare a Complete Streets Study for the City of Culver City. Fehr & Peer's responsibilities within the study including preparing an Existing Conditions & Best Practices report outlining potential physical and policy barriers to complete streets within Culver City and comparing local plans and policy to industry best practices. Fehr & Peers will also provide community engagement support to the City and will be responsible for drafting the curb management section of the Complete Streets Design Guidelines report as well as providing insight on all safety treatments considered.

County of Santa Barbara CWPP (Santa Barbara, CA)
Project Manager. Fehr & Peers is preparing a transportation study in support of the Wildfire Protection Plan in Santa Barbara. The Transportation Study will utilize readily available data from the County as well as data contained in the Santa Barbara County Association of Governments (SBCAG) travel demand model and census data. Areas with limited access and egress will be identified by evaluating the expected travel demand based on nearby population and comparing the demand to the roadway capacity and vehicle routing during evacuation conditions.

Recommendations to improve emergency access and resident evacuations, including infrastructure recommendations to improve public safety, access, and egress will be based on this evaluation and feedback received during the Working Group and Development Team meetings. Feedback gathered through
stakeholder outreach will also be incorporated into the community specific recommendations in the Transportation Study.

EDUCATION
Pasadena High School
2925 E Sierra Madre Blvd, Pasadena, CA 91107
2012
California State University Northridge
18111 Nordhoff St, Northridge, CA 91330
2016

YEARS WITH THE FIRM
1 Year
PERSON’S DISCIPLINE
Urban Studies and Planning

PROFESSIONAL CHARACTERISTICS
Community Engagement
Project Management
Ashley Mercado
Director - Strategic Engagement
Ashley has been dedicated to Day One as a Youth Advocate since the age of 14. After earning her degree in Urban Studies and Planning with a focus on community development from California State University, Northridge, she joined the Los Angeles Unified School District. There, she excelled as an Outreach Coordinator for the Facilities Division Bond Program for 7 years. Ashley has since returned to Day One, where she now serves as the Director of Strategic Engagement, overseeing and managing all special projects within the organization.

RELEVANT EXPERIENCE
Pico Rivera - Climate Action Plan
Project Role: Developed and implemented a comprehensive engagement strategy, facilitating regular communication and organized outreach activities to raise awareness about the City's development of a Climate Action Plan and encourage active participation from key community stakeholders, including local residents, community groups, and youth ambassadors in climate initiatives.

Project Verde-School Greening
Project Role: Created and led a comprehensive outreach strategy for students and families of the School of Arts and Enterprise in the City of Pomona. Designed specific activities to engage students in grades 6-12 in the planning process of their school greening plan. Assisted architects in understanding the student perspective and sat on the advisory committee for the project, amplifying the community voice.

Office of Environmental Justice and Climate Health- Strategic Plan Project Role: Coordinated community meetings and facilitated feedback sessions to gather input on the strategic plan that the office was preparing to present to the Board of Supervisors on behalf of the LA County Office of Environmental Justice and Climate Health.

Pomona ACTS- Transformative Climate Communities Grant
Project Role: Launched the first phase of the Direct-to-Renters grant and developed a strategic way to engage residents in Pomona in the decarbonization of their homes through electric appliances. Facilitated an appliance giveaway to ten families.
53 CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN

54 CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L 55

EDUCATION
California State University, Long Beach
1250 Bellflower Blvd, Long Beach, CA 90840
1999

YEARS WITH THE FIRM
<HDUV
PERSON’S DISCIPLINE
3ROLWLFDO6FLHQFH&ODVVLFV

CERTIFICATIONS
LHDGHUVKLS3DVDGHQD([HFXWLYH
3URJUDP*UDGXDWLQJ&ODVVRI

/RQJ%HDFK1RQSURILW0DQDJHPHQW0D\
/RQJ%HDFK1RQSURILW0DQDJHPHQW
*UDQW,QWHQVLYH-XQH
+LVSDQLF$VVRFLDWLRQRI&ROOHJHV 8QLYHUVLWLHV
/HDGHU&HUWLILFDWLRQ2FWREHU

RECOGNITIONS
&$6HQDWH1RQSURILWRIWKH<HDU
3DFLILF2DNV¶WRSORFDOOHDGHUVWRZDWFKLQ
&$6WDWH/HJLVODWXUH
2XWVWDQGLQJ:RPHQLQ%XVLQHVV$ZDUG
1RQ3URILW([HFXWLYH'LUHFWRU
&68/%'LVWLQJXLVKHG*UDGXDWH0D\

(23'LVWLQJXLVKHG*UDGXDWH0D\


&HUWLILHG6WXGHQW/HDGHU$SULO

PROFESSIONAL CHARACTERISTICS
1RQSURILW0DQDJHPHQW
&RPPXQLW\(QJDJHPHQW
<RXWK'HYHORSPHQW
Christy Zamani
Executive Director
2YHU  \HDUV RIH[SHULHQFHOHDGLQJG\QDPLFDQGGLYHUVHQRQSURILW RUJDQL]DWLRQV VXFK DV ORFDO FRPPXQLW\EDVHGRUJDQL]DWLRQV VWDWH KLJKHU HGXFDWLRQ GHSDUWPHQWV DQGFROODERUDWLYH FRPPXQLW\ FRDOLWLRQV DVZHOODVSXEOLFKHDOWKDQGSROLF\ DGYLVRU\ ERDUGV 6HQLRU PDQDJHPHQW DQGDGPLQLVWUDWLYHVNLOOVFRPELQHGZLWKD OLIHWLPHRIVHUYLFHLQWKHSXEOLF VHFWRU
([WHQVLYH H[SHULHQFH ZLWK JRYHUQPHQWDIIDLUV HQYLURQPHQWDO SXEOLF SROLF\ IXQG GHYHORSPHQWPHGLD UHODWLRQV DQG PHGLD FRPPXQLFDWLRQVVWUDWHJLHVDVZHOO DV H[SHUWLVH LQ VWUDWHJLF SODQQLQJ RUJDQL]DWLRQDOGHYHORSPHQW SURJUDP GHYHORSPHQW DQG PDQDJHPHQWDGPLQLVWUDWLRQ RI GDLO\ RSHUDWLRQV ILVFDO RYHUVLJKW WHDPEXLOGLQJDQGVWDIIGHYHORSPHQW
'D\2QH,QF([HFXWLYH'LUHFWRU<HDUV
3URMHFW5ROH
5HVSRQVLEOHIRUFXOWLYDWLQJUHODWLRQVKLSVPDLQWDLQLQJD SRVLWLYHZRUNLQJUHODWLRQVKLSZLWKWKHFRPPXQLW\UHVLGHQWVORFDO RUJDQL]DWLRQVLGHQWLI\LQJFRPPXQLW\QHHGVDQGRYHUVHHLQJJUDQWV SDUWQHUVKLSVDQGDOOH[WHUQDOIXQGLQJVRXUFHV
2WKHUUHVSRQVLELOLWLHVLQFOXGH

•'HYHORSHGDQGLPSOHPHQWHG\RXWKIRFXVHGGLUHFWLRQIRU'D\2QH •7ULSOHGWKHRUJDQL]DWLRQVEXGJHWDQGVWDII
•\HDUVRIH[HFXWLYHH[SHULHQFHZRUNLQJZLWK/RV$QJHOHV&RXQW\ DQGWKHIHGHUDOJRYHUQPHQWWRDGYDQFHSXEOLFKHDOWK
•\HDUVRIH[SHULHQFHZRUNLQJZLWK/$&RXQW\'HSDUWPHQWRI3XEOLF +HDOWK0DQDJLQJ6$3&7&33+&,DQG:DWHUVKHGFRQWUDFWV •/HDGYDULRXVUHJLRQDOFRDOLWLRQVWKURXJKRXWWKH6DQ*DEULHO9DOOH\ •'HYHORSHGDQGLPSOHPHQWHG\RXWKIRFXVHGGLUHFWLRQIRU'D\2QH •0DQDJHGORFDOHQYLURQPHQWDOSROLF\FDPSDLJQV
•0DQDJHGFDPSDLJQVIRUVXFFHVVIXOHQYLURQPHQWDOSROLF\ FDPSDLJQVWKDWZHUHDGRSWHGE\FRXQFLOV
•(VWDEOLVKHGNH\UHODWLRQVKLSVZLWKHOHFWHGRIILFLDOVDQGVWDNHKROGHUV •&ROODERUDWHGZLWKSDUWQHUVWRODXQFKWKH6.,//=3UHYHQWLRQ6XPPHU 6FKRROSURYLGLQJFUHGLWUHFRYHU\WR\RXWKIRUHQJDJLQJLQDRQHPRQWK VXPPHUVFKRROIRFXVHGRQFRPSUHKHQVLYHWHHQSUHYHQWLRQ 3URJUDPLVLQLWVWK\HDU
•3ODFHG'D\2QHDVRQHRIWKHWRSQRQSURILWVLQ3DVDGHQD ³$UUR\R0DJD]LQH´
•'HYHORSHGVWUDWHJLHVWRHQJDJH\RXWKSDUHQWVDQGFRPPXQLWLHV •2YHUVDZDOODJHQF\UHODWHGILQDQFLDODQGEXVLQHVVRSHUDWLRQV •'RXEOHGWKHDPRXQWRI\RXWKSURJUDPPLQJWKURXJKQHZLQQRYDWLYH DSSURDFKHVZKLOHFXWWLQJFRVWV
•6HUYHGDVWKHRUJDQL]DWLRQ&KLHI2SHUDWLQJ2IILFHUDQGVSRNHVSHUVRQ •:RUNHGZLWKFRPPXQLW\SDUWQHUVRQLVVXHVRINH\LPSRUWDQFHLQ 3DVDGHQDVXFKDV7HHQ-REV$VVHW'HYHORSPHQW0HQWRULQJ 3URJUDPV/LIH6NLOO'HYHORSPHQW6XVWDLQDEOH3UHYHQWLRQ$OWHUQDWLYH $FWLYLWLHV*DQJ3UHYHQWLRQ&RPPXQLW\6HUYLFHDQG<RXWK2XWUHDFK DQG(QJDJHPHQW
•)LVFDOPDQDJHPHQWDQGRYHUVLJKW
•(QVXUHGFRPSOLDQFHZLWKILVFDOSURJUDPDQGH[WHUQDOLQGHSHQGHQW DXGLWVDQGDOORWKHUDSSOLFDEOHUHJXODWLRQVIRU
QRQSURILW
F

E
RUJDQL]DWLRQV
N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L 54

EDUCATION
dŧLJŧőë nëƍLJŚŧƩŜơ ½ŜĺǀĕƍƕĺơLJ
1 Loyola Marymount University Dr, Los Angeles, CA 90045 ǛǣǣǛ

YEARS WITH THE FIRM
4 Years
PERSON’S DISCIPLINE
Political Science

CERTIFICATIONS
League Cycling Instructor #2240

PROFESSIONAL CHARACTERISTICS
Nonprofit Management
Community Engagement
Bicycle Safety Educator
Colin Bogart
Active Transportation Director
Colin has over 15 years of non-profit experience partnering with municipalities, governmental entities, and other non-profit groups to formulate policy change, deliver educational
programming and community services, organize advocacy campaigns, bicycle/pedestrian counts and events, and conduct community outreach.

RELEVANT EXPERIENCE
Metro Adopt a Bike Program January 2024 to Present
Project Role: Project manager for distributing unclaimed bikes from Metro to low income residents in Pomona, El Monte, and Pasadena.

GoSGV Engagement Fall 2022 to Present
Project Role: Project manager for the GoSGV bike share program, community engagement in partnership with SCAG, SGVCOG, and Active SGV. Engagement focused on universities, large employers, Metrolink, and the public.

Bike Month Pasadena 2022 & 2024
Project Role: Project manager for Bike Month Pasadena in May 2022 & 2024 which included multiple bike rides and events that were free to the public.

Walktober Pasadena 2022 & 2023
Project Role: Project manager for Walktober in October 2022 & 2023 which included multiple walking events and guided tours.

Pasadena Walks
Project Role: Community outreach manager for the Pasadena Walks pedestrian plan development. Conducted focus groups, stakeholder meetings, facilitated advisory committee meetings, promoted and facilitated community meetings.

Safer Streets Pasadena Summer 2021
Project Role: Project manager for a City of Pasadena program distributing bicycle lights, helmets, and bicycle safety information to the Pasadena community .

Pasadena Safe Routes to School
Project Role: Project manager for the Pasadena Safe Routes to School Contract in partnership with PUSD and Pasadena DOT. Organized walking school buses, bike trains, and bike repair workshops.

L.A. County Bicycle Coalition - Education Director
Project Role: Managed all bike education programming, including the Metro BEST series of classes and earlier contracts with Metro. 55 CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN

56 CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L 56 N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L 57 RESUMES D’LEON CONSULTING ENGINEERS

OVERVIEW
Mr. Chavez is a Civil Engineer with extensive
experience in civil engineering design, utilities,
structures and third-party coordination. Adrian has
developed designs for civil and structural related
projects. He has been involved in the design and
construction for numerous light rail, ExpressLanes
and facilities projects. He is an expert in AutoCAD
Civil 3D design software and AutoDesk Inventor
among other civil and facility design programs.

HIGHLIGHTS
⊲ Diverse experience in civil engineering for public
infrastructure projects with unique technical
expertise in power facilities
⊲ Bilingual in Spanish and English

RELEVANT EXPERIENCE
LA METRO EASTSIDE LRT EXTENSION PHASE 2, LOS
ANGELES, CA • CIVIL ENGINEER: The Eastside Phase
2 Light Rail Project is a $4 billion light rail project that will extend the existing Los Angeles Metro
Eastside Gold Line light rail into east Los Angeles
County. Two alternatives are being evaluated in this
phase: (1) From the Eastside Gold Line terminus at
Atlantic to the City of Whittier via Atlantic Avenue
and Washington Boulevard and (2) from the Eastside
Gold Line terminus at Atlantic Avenue to the City of
South El Monte via the State Route 60 freeway. Mr.

Chavez responsibilities included civil design, utility
identification and relocation design plus light rail
specification production..

LA METRO EAST SAN FERNANDO VALLEY (ESFV) LIGHT
RAIL, LOS ANGELES, CA • CIVIL ENGINEER: The East San
Fernando Valley Transit Corridor (ESFVTC) alignment
is located in the San Fernando Valley in the County
of Los Angeles. Adrian is a civil engineer on this
$3.6B project, including local streets and utilities
design, geometric alignment design, estimating,
coordination with third parties including Caltrans,
the City of Los Angeles, Metrolink and the City of
San Fernando.

LA METRO I-105 EXPRESSLANES PROJECT, LOS ANGELES,
CA • CIVIL ENGINEER: This is a $1.1 billion freeway
improvement and toll-facility project that spans
over 18 miles across multiple cities and agencies in
Los Angeles County. The project delivery method
is a Construction Management/General Contractor
(CMGC), the first CMGC for Los Angeles Metro.

Mr. Chavez provides civil engineering and design
oversight and helps lead the coordination with
all the cities including: City of Inglewood, City of
Hawthorne, City of Lynwood, City of Los Angeles,
City of El Segundo and the County of Los Angeles.

He also provides technical and highway design
coordination with all stakeholders including local
utility companies like Los Angeles Department of
Water and Power (LADWP), Southern California
Edison, The Gas Company, among other utility
owners.

LA METRO SEPULVEDA TRANSIT CORRIDOR (STC), LOS
ANGELES, CA • CIVIL ENGINEER: Metro has a plan to
make it easier to get around by creating better
transit options between the San Fernando Valley
and the Westside. Mr. Chavez’ responsibilities
include site investigations, power assessments for
the future rail operations, base mapping, conceptual
design, street improvement plans, station design,
support on environmental phase, and inputs to and
iterative comments on environmental documents.

BONNEVILLE POWER ADMINISTRATION BUILDING,
BECHTEL CORP., WA • CIVIL ENGINEER: Adrian led the
surveying of roads to get an accurate measure
for design and estimates to access building and
surrounding electrical power lines. Used AutoCAD
Civil 3D and ArcMAP programs to create roadway
design alignment. Created a project budget which
included roads or bridges surrounding power lines
and considered other items such as labor costs,
material, and project schedule.

HANFORD TREATMENT PLANT FACILITY, BECHTEL
CORP., WA • CIVIL ENGINEER: Supported multiple
improvements on the Hanford Treatment Plant.

Prepared design drawings that consist of structural
improvements. Used Bentley navigator, AutoCAD
Civil 3D and excel on all facility design drawings.

ADRIAN CHAVEZ
Civil Engineer
Years of Experience // with DLCE: 4 // 1
Education: BS, Civil Engineering (minor in
Electrical Engineering)
Areas of Expertise: Active Transportation •
First/Last Mile and Transit-Oriented Corridors •
Roadway and Utility Design• Bilingual: Spanish
57 CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN RESUMES D’LEON CONSULTING ENGINEERS

OVERVIEW
Aldair Sanchez is a Civil Engineer with utility,
roadway, and TPPS site design and third-party
coordination experience. He has worked on large
heavy civil transportation projects primarily in Los
Angeles and Santa Barbara Counties. These include
light rail, roadway, bridge and active transportation
corridors. His expertise includes utility design,
plan production, and coordination with cities and
local jurisdictions. He is skilled using AutoCAD,
MicroStation and InRoads, SharePoint, Microsoft
Office, and ProjectWise/Autodesk Construction
Cloud related software platforms.

HIGHLIGHTS
⊲ Diverse experience in civil engineering for public
infrastructure projects with extensive familiarity
with local Los Angeles County stakeholders
⊲ Bilingual in Spanish and English

RELEVANT EXPERIENCE
LA METRO EASTSIDE LRT EXTENSION PHASE 2, LOS
ANGELES, CA • CIVIL ENGINEER: The Eastside Phase
2 Light Rail Project is a $4 billion light rail project that will extend the existing Los Angeles Metro
Eastside Gold Line light rail into east Los Angeles
County. Two alternatives are being evaluated in this
phase: (1) From the Eastside Gold Line terminus at
Atlantic to the City of Whittier via Atlantic Avenue
and Washington Boulevard and (2) from the Eastside
Gold Line terminus at Atlantic Avenue to the City of
South El Monte via the State Route 60 freeway. Mr.

Sanchez is leading the utilities engineering efforts
including investigation, coordination, and plan
production. He works directly with the client, local
jurisdications, and utility owners on utility conflict
identification and relocation design. Mr. Sanchez
additionally coordinates with the project surveyor to
investigate and mitigate oil field/well conflicts in the project corridor.

LA METRO, SEPULVEDA TRANSIT CORRIDOR, LOS
ANGELES, CA • PROJECT MANAGER/CIVIL ENGINEER:

Metro has a plan to make it easier to get around
by creating better transit options between the
San Fernando Valley and the Westside. Through
the ACE design phase, Mr. Sanchez is leading the
DLCE engineering team in developement of utility
relocation, stree improvements, and TPSS site
designs for the 16-mile project corridor. Mr. Sanchez
and histeam continue to advance the project utility
conflict matrix and composite utility plans.

Mr. Sanchez has additionally performed power
assessments for the future rail operations, allowing
for early identification of risk associated with
infrastructure enabling efforts.

CITY OF SANTA BARBARA, BONITA SCHOOL RD BRIDGE
REPLACEMENT • CIVIL ENGINEER: The replacement of
the seismically deficient Floradale Avenue Bridge
west of Lompoc and the seismically deficient Bonita
School Road Bridge west of Santa Maria. One bridge
will replace a low-water crossing on Foothill Road
in New Cuyama. The new 580-foot-long bridge will
be located 60 feet west of the existing 521-foot
bridge and, with two 12-foot travel lanes and two
8-foot shoulders, will be 18-inches wider at 43.5
feet. Mr. Sanchez supported senior engineers to
identify utilities and coordinate with third parties and involved in the preliminary engineering design.

LA METRO LA RIVER PATH PROJECT, LOS ANGELES, CA •
CIVIL ENGINEER/LADWP SPECIAL COORDINATOR: The LA
River Path is a $500M project that will create new
bicycle and pedestrian path along an approximately
eight-mile stretch of the Los Angeles River (River)
from Elysian Valley through Downtown Los Angeles
to the City of Maywood. This project will close
the longest remaining continuous gap in the LA
River Path and create a path that will serve the
existing communities there today, as well as look
forward to and serve future needs. Mr. Sanchez is
working to identify utilities, and perform preliminary
engineering for utility relocations. Mr Sanchez also
played a critical role in early coordination efforts
with LADWP which enabled advanced design
reviews and reduced risk to the project in later
phases.

CITY OF INGLEWOOD, INGLEWOOD TRANSIT CONNECTOR
(ITC) • CIVIL ENGINEER: The ITC Project is a 1.6-
mile, three-station, fully elevated, Automated
People Mover (APM) sytem. Mr. Sanchez provided
engineering support for utility identification,
relocation design, and coordination.

ALDAIR SANCHEZ
Civil Engineer
Years of Experience // with DLCE: 4 // 4
Education: BS, Civil Engineering
Areas of Expertise: Active Transportation •
First/Last Mile and Transit-Oriented Corridors •
Roadway and Utility Design• Bilingual: Spanish

58 CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L 58 N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L 59 RESUMES D’LEON CONSULTING ENGINEERS

OVERVIEW
Borja brings more than 23 years of transportation
infrastructure engineering and construction
management experience that includes working
for Caltrans and the City of Los Angeles. He
has served in many Caltrans and local city roles
including Transportation Civil Engineer, Structures
Construction Representative, Resident Engineer,
and Transportation Advisor. As Deputy Mayor of Los
Angeles from 2005 to 2018, Borja was responsible
for managing the City’s transportation agenda for
LADOT, Metro, Caltrans District 7 City projects, LAWA
surface transportation projects and various LADPW
bridge and highway projects. He was instrumental in
the successful passing of Measure M, a $120 billion,
40-year funding source for all Los Angeles transit,
highway, and transportation improvements.

Borja has worked for years to build bridges between
his local community and his profession to foster
diversity and equity in engineering and construction.

He has served on the Dean Advisory Board for the
College of Engineering at CalState Long Beach
(CSULB) since 2018, helping lead recruiting eff orts
to draw young Angelenos — particularly those in
under-served communities in the region — into the
engineering and construction industry. He has also
provided professional expertise and support to the
CSULB’s Beach Engineering Student Success Team
(BESST) program, an engineering-based learning
community that provides dedicated mentorship,
tutoring, and scholarship opportunities to fi rst-year
students in the College of Engineering.

Borja is also working with the City of Pico Rivera
to develop a paid engineering internship program
for El Rancho Unifi ed School District high school
students. These internships will allow the local
students to collaborate with CSULB College of
Engineering students and faculty and work directly
on projects in Pico Rivera.

HIGHLIGHTS
⊲ Established successful working relationships with
City of Inglewood, City of Long Beach, Metro,
Caltrans, and utility owners across the region
⊲ Extensive experience overseeing and managing
transportation infrastructure programs and
projects throughout Los Angeles and Southern
California

RELEVANT EXPERIENCE

CITY OF INGLEWOOD, INGLEWOOD TRANSIT CONNECTOR
(ITC), INGLEWOOD, CA • SENIOR PROJECT MANAGER:

The ITC will provide residents and visitors with a
state-of-the-art transit connection to and from the
Metro Crenshaw/LAX Line directly to one of the
highest growing housing and employment centers
in Los Angeles County, and home to new worldclass sports and entertainment destinations. DLCE is providing staff for civil engineering support
(utilities, roadway, station), third-party agreements,
development design oversight and program
management/construction management support.

Aside from engineering and technical services, Borja
also provides strategy consulting services for the
project to help secure state and federal grants.

METRO, SEPULVEDA TRANSIT CORRIDOR, LOS ANGELES,
CA • SENIOR PROJECT MANAGER: This $12 billion project
is a 15-mile rail system with nine stations, navigating the Santa Monica mountains to connect transit
passengers in the San Fernando Valley and the
Westside. Currently in the environmental review
and advanced conceptual engineering (ACE) stages,
Metro is weighing six alternatives, fi ve aerial and
one underground. Borja is managing and guiding
the engineering team in utility relocation and design,
roadway design, TPSS site design, ACE planning,
and coordination with stakeholders and support on
the approval processes, including the LADWP.

BORJA LEON, PE
Principal, Project Manager
´ Mr. Leon has an exceptional level of
understanding and commitment to City
projects. Borja eff ectively helped coordinate and
deliver public works projects in the City.”
— Gary Lee Moore, City Engineer,
City of Los Angeles
Years of Experience // with DLCE: 23 // 6
Education: BS, Civil Engineering
Registrations/Certifi cations: Professional
Engineer: CA
Professional Affi liations: Society of Hispanic
Professional Engineers • Society of Military
Engineers • California State University Long
Beach School of Engineering Dean Advisory
Board • Caltrans District 12 Professional Liaison
Council (PLC)
59 CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN RESUMES D’LEON CONSULTING ENGINEERS

OVERVIEW
Julia Tung is a highly competent task order/project
manager with a diverse repertoire of projects across
public infrastructure and private residential sectors,
throughout Southern California. She has managed
engineering teams for City of Inglewood, LA Metro,
and LAWA, from planning through construction, and
is deeply familiar with each agency’s standards.

She has substantial experience collaborating across
project disciplines, delivering utilities, track/rail,
stations, and street improvements programs for
traditional and alternative delivery projects.

Julia’s career encompasses project leadership
positions across a diverse set of industries,
informing her adaptive and innovative approach
to project management. Whether allocating
resources across new and pipeline projects, leading
the production of engineering deliverables, or
collaborating with staff , client, and community
stakeholders to develop a values-aligned internship
program, Julia demonstrates her unique ability to
coordinate between the left and right brain.

HIGHLIGHTS
⊲ Engineering and management experience on
over $25 billion of public infrastructure projects
in the past fi ve years
⊲ Current knowledge of SoCal regulatory agency
processes/standards and ongoing engagement
with local stakeholders including utilities,
municipalities, and community groups
⊲ DLCE Project Manager for the Inglewood Transit
Connector Project since 2021, collaborating
directly with the City to deliver utility agreements,
advanced relocations, FTA-compliant reports, and
procurement documentation

RELEVANT EXPERIENCE

CITY OF INGLEWOOD, INGLEWOOD TRANSIT CONNECTOR,
INGLEWOOD, CA • PROJECT MANAGER: Julia led utilities
work for the ITC project and orchestrated eff orts
in utility base-mapping and outreach, third-party
agreements, utility corridor planning (composite
utilities), and Advanced Relocations for this $2 billion P3, DBFOM project. She coordinated directly with
the City of Inglewood Public Works Department and
private utilities (including SCE, SCG, LACSD, LACFCD,
and telecoms) to ensure designs represent the best
alternative for the owner, stakeholders, and project.

Julia and her team have developed Composite
Utility Plans, Advanced Relocation Plans, and a
full-suite of coordination-focused exhibits. She has
led utility contributions to various FTA-compliant
procurement documents including basis of
design, performance specifi cations, and thirdparty coordination memoranda and exhibits. She advocates for the City in responding to RFCs and
addressing developer concerns related to utility
standards, progress, and risks.

Project Success: Under Julia’s leadership, DLCE
was able to progress roughly 4000 ft of 12-inch and
24-inch water mainline relocation from 15% Conceptual
Design to Approved for Construction in less than four
months. Furthermore, when the City opted to add an
additional 2,000 feet of pipe to the relocation package after RFB release, Julia and her team were able to
effi ciently modify the plans and procurement documents to ensure the contract was awarded on time.

METRO, SEPULVEDA TRANSIT CORRIDOR, LOS ANGELES,
CA • PROJECT MANAGER/QA/QC MANAGER: Julia led
Utilities work for the STC project as part of predevelopment (PDA) phases 1-4. She developed Utilities portions of the feasibility study, BOD, and
managed a team under the DEIR.

Under Julia’s leadership, the DLCE team has
performed fi eld investigations and completed utility
base-mapping for the entire 16-mile project corridor.

Julia’s team developed the project utility confl ict
matrix and composite utility plans.

Julia has additionally performed power assessments
for the future rail operations, allowing for early
identifi cation of risk associated with infrastructure
enabling eff orts. She additionally contributes to
street improvements, station, and traction power
substation (TPSS) site design.

METRO, LA RIVER BIKE PATH, LOS ANGELES, CA • CIVIL
ENGINEER/LADWP SPECIAL COORDINATOR: Julia was
responsible for early utility mapping, coordination,
and relocation design for the entire project corridor.

JULIA TUNG, PE, LEED AP
Civil Engineer
Years of Experience // with DLCE: 6 // 4
Education: BS, Civil Engineering
Registrations/Certifi cations: PE: CA • LEED
AP Neighborhood Development • WTS Member

60 CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L 60 N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L 61 RESUMES D’LEON CONSULTING ENGINEERS

OVERVIEW
Ryan is a seasoned senior civil engineering
professional with more than 23 years of engineering
project management and design experience. He
applies his civil design knowledge and project
management experience during all phases of
complex highway, local street and road, transit
and large infrastructure projects. He has provided
design and engineering support to highway and
roadway projects, utilities design, and coordination
with Caltrans, Metro, and LAWA, along with many
other stakeholders. Ryan has experience providing
design review and management, engineering
oversight, utility design, highway engineering and
quality control facilitation of geotechnical, grading,
and stormwater management. He has prepared cost
estimates, schedules, budgets, plans, reports and
documentation packages for major public works
projects

HIGHLIGHTS
⊲ Extensive Metro, Caltrans, and land development
experience
⊲ CADD software expert skilled at setup, training,
and troubleshooting
⊲ Expert at creating 3D models for major
transportation projects
⊲ Well-versed in many areas of civil engineering
including transportation, drainage and light/
heavy rail

RELEVANT EXPERIENCE

METRO, SEPULVEDA TRANSIT CORRIDOR, LOS ANGELES,
CA • ENGINEERING MANAGER: This $12 billion project
is a 15-mile rail system with nine stations. Metro
is considering six alternatives. Ryan is leading
utility relocation and design, roadway design, and
coordination with stakeholders and support on the
approval processes, including the LADWP. He also
assesses numerous power sources along the entire
10-mile corridor and oversees plan production for
the ACE plans.

LAWA, CONCOURSE 0 PROGRAM, LOS ANGELES, CA •
ENGINEERING MANAGER: Part of the Airfield and
Terminal Modernization Project (ATMP) at LAX, the
Concourse 0 is an extension attached to Terminal 1.

The project will add a gate space and improve the
traveler experience. This is a $6 billion expansion
plan that would allow the busy airport to catch up
with passenger growth and prepare it fort he 2028
Olympic Games. Ryan is leading DLCE in delivering
the 30% and 60% design packages for the landside
civil design elements.

CALTRANS/METRO, SR-91 CENTRAL AVENUE TO ACACIA

COURT IMPROVEMENT PROJECT, COMPTON AND CARSON,
CA • ENGINEERING MANAGER: Caltrans, in cooperation
with Metro and the Gateway Cities Council of
Governments (GCCOG), proposes to improve a
portion of the SR-91 corridor between Central
Avenue and Acacia Court located in the City of
Compton and the City of Carson. Ryan is providing
engineering support on the civil elements for the
PS&E 60%, 95%, and 100% plans, cost estimate,
and specifications through staff augmentation. He
oversees and coordinates with the project owner
and stakeholders and coordinates project team
calls.

METRO, EAST SAN FERNANDO VALLEY CORRIDOR, SAN
FERNANDO, CA • PRINCIPAL ROADWAY ENGINEER: The
East San Fernando Valley Transit Corridor (ESFVTC)
alignment is located in the San Fernando Valley in
the County of Los Angeles. The project study area
extends from the City of San Fernando and the
Sylmar/San Fernando Metrolink Station in the north
to the Van Nuys Metro Orange Line Station in the
south. Ryan is the principal engineer for this $3.6
billion project, overseeing all aspects of the civil
engineering work including local streets and utilities
design, geometric alignment design, estimating,
coordination with third parties including Caltrans,
the City of Los Angeles, Metrolink and the City of
San Fernando.

LAWA, APM/ITF/ROADWAY IMPROVEMENTS WEST, LOS
ANGELES, CA • ENGINEERING MANAGER: The Intermodal
Transportation Facility (ITF) West will use designbuild methodology to provide a connected and convenient pick-up/drop-off location outside the
terminals. The ITF-West will be connected to an APM
station via pedestrian walkways. Ryan led the ITF
team in the civil engineering deliverables including
coordinating with Caltrans District 7 staff, ramp
designs, street and local roadway geometric design,
utilities, retaining wall design and drainage.

RYAN BROWNE
Engineering Manager
Years of Experience: 23
Education: BS, Civil Engineering

CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN RESUMES D’LEON CONSULTING ENGINEERS

OVERVIEW
Selena is a seasoned civil engineer with seven
years of experience in Metro and rail project
associated work. Selena has led the preparation
of environmental and engineering documents
for major projects in Los Angeles County. Selena
expertise includes track alignment design, highway
and local roadway design, utilities design, and
estimating. She is deeply familiar with Metro and
other local municipalities’ design standards and
specifi cations and fast-paced delivery schedules.

Selena understands industry engineering and design
standards.

HIGHLIGHTS
⊲ Unique experience working with local agencies
such as the City of Los Angeles, Port of Long
Beach, Caltrans, and Metro
⊲ Expertise in using software design tools like
Inroads, MicroStation, Civil 3D, and AutoCAD

RELEVANT EXPERIENCE

CITY OF LOS ANGELES, SIXTH STREET VIADUCT
REPLACEMENT, LOS ANGELES, CA • CIVIL ENGINEER: The
City of Los Angeles’s Sixth Street Bridge Viaduct
connects the west side of the Los Angeles River
and the historic neighborhood of Boyle Heights
on the east side. Selena assisted on identifying
all above and underground utility lines at both
approaches, nearby frontage roads and on the
bridge deck. She worked closely with the City of
Los Angeles Bureau of Engineering, Caltrans, the
Army Corps of Engineers, among other agencies,
to gather all supporting utility information. Selena
also assisted the Project’s Civil Engineer on record
to identify utility confl icts with new bridge design.

She prepared utilities drawing packages for the
contractor (Skanska) for demolition, foundations,
viaduct piers, intersections and river encroachments.

She used MicroStation design software tools in the
development of the drawings.

METRO, SEPULVEDA TRANSIT CORRIDOR, LOS ANGELES,
CA • CIVIL ENGINEER: The $12 billion Sepulveda Transit
Corridor is an approximately 15-mile rail system with
9 stations, navigating the Santa Monica mountains
to connect transit passengers in the San Fernando
Valley and the Westside. Selena supports the
utility relocation and design, roadway design, and
coordination with stakeholders and support on the
approval processes, including the LADWP. She also
assesses power sources along the 10-mile corridor
and oversees plan production for the ACE plans.

LAWA, CONCOURSE 0 PROGRAM, LOS ANGELES,
CA • SENIOR CIVIL ENGINEER: Part of the Airfi eld
and Terminal Modernization Project at LAX, the
Concourse 0 is an extension attached to Terminal 1.

The project will add a gate space where it’s needed
and improve the traveler experience. This is a
$6 billion dollar expansion plan that would allow the
busy airport to catch up with passenger growth and
prepare it fort he 2028 Olympic Games. Selena is
assisting in the delivery of the 30% and 60% design
packages for the landside civil design elements.

CALTRANS/METRO, SR-91 CENTRAL AVENUE TO ACACIA

COURT IMPROVEMENT PROJECT, COMPTON AND CARSON,
CA • CIVIL ENGINEER: Caltrans, in cooperation with the
Los Angeles County Metropolitan Transportation
Authority (Metro), and Gateway Cities Council
of Governments (GCCOG), proposes to improve
a portion of the State Route 91 (SR-91) corridor
between Central Avenue and Acacia Court located in
the City of Compton and the City of Carson and one
overhead sign located near Long Beach Boulevard
within the City of Long Beach in Los Angeles County,
CA. Selena provides engineering support on the
civil elements for the PS&E 60%, 95%, and 100%
plans, cost estimate, and specifi cations through staff augmentation. She coordinates directly with the
project owner and stakeholders.

PHOENIX SKYHARBOR NEW NORTH CONCOURSE (T3N2),
PHOENIX, AZ • SENIOR CIVIL ENGINEER: Selena is
performing utility design for relocations and new
services for the New North Concourse at Phoenix
Sky Harbor as part of this $408M improvement
project.

ADDITIONAL RECENT PROJECTS:
⊲ LA Metro Eastside Transit Corridor Extension
Phase 2 (Utilities)
⊲ I-605/SR-60 Intercange & Ramp Upgrades
(Roadway)
⊲ SR-57/60 Interchange Improvements (Roadway,
Cost Estimating)

SELENA PHAM
Civil Engineer
Years of Experience // with DLCE: 8 // 8
Education: BS, Civil Engineering
61

62 CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L 63 RESUMES D’LEON CONSULTING ENGINEERS

OVERVIEW
Werner Abrego is a senior civil engineering with
27 years of experience in planning, development,
design, and engineering for highway and transit
related facilities. Work experience is related to
general civil engineering including roadway and
track alignment both vertical and horizontal,
profi les and cross sections, street modifi cation &
reconstruction for alignments including crossings,
ADA ramps curb and gutters, restriping, parking,
utility identifi cation, relocation, clearance, and
redesign of main lines (water, sewer, storm
drains, power, gas, fuel, high risk, overhead and
underground high voltage engineering and CAD
work.

Mr. Abrego has worked in both heavy and light rail
METRO projects which are like the ESV corridor.

He is profi cient in AUTOCAD, Civil 3D MicroStation,
In-Roads CAD programs used in Metro projects. He
is very familiar with County of Los Angeles, Permit
B approval with BOE, utility companies and Caltrans
standards and general Microsoft offi ce software.

Mr. Abrego is a resident of Whittier and an avid
biker. He takes pride in his work on projects that
expand and improve pedestrian/cyclist travel in his
local community.

HIGHLIGHTS
⊲ 27 YOE on rail, roadway, and active
transportation projects in Los Angeles County
⊲ Bilingual in Spanish and English

RELEVANT EXPERIENCE
LA METRO EASTSIDE LRT EXTENSION PHASE 2, LOS
ANGELES, CA • SR. CIVIL ENGINEER: This is a $4B light
rail project that will connect the existing Eastside
Gold Line and extend it further east into Los
Angele County. Mr. Abrego supervised the utilities
engineering team to identify all utilities along two
light rail alignments. He led the team to produce a
project utility matrix and coordinated with all thirdparty utility companies to successfully receive all the utilities along the corridor. Mr. Abrego oversaw
the production of all utility drawings from Advanced
Conceptual Engineering phase to Preliminary
Engineering design. This also included a utility
identifi cation matrix, utility relocation design and
specifi cations plus potholing plan. As the supervising engineer, Mr. Abrego was also responsible for
the Quality Control and Quality Assurance of all
drawings using Bluebeam, Metro Rail Design
Standards and MicroStation for both alternatives.

LA METRO SEPULVEDA TRANSIT CORRIDOR (STC), LOS
ANGELES, CA • SR. CIVIL ENGINEER: Metro has a plan
to make it easier to get around by creating better
transit options between the San Fernando Valley
and the Westside. The Build Alternative is a Heavy
Rail Transit (HRT) option with a total of 8 stations.

Mr. Abrego also worked on Pre-Development
Agreement (PDA) delivery option. His responsibilities
include site investigations, power assessments for
the future rail operations, base mapping, conceptual
design, street improvement plans, station design,
support on environmental phase, and inputs to and
iterative comments on environmental documents.

LOS ANGELES WORLD AIRPORTS (LAWA) ROADWAY,
UTILITIES, AND ENABLING (RUE) • SR. CIVIL ENGINEER:

The RUE project focuses on restoring and
constructing roadways and utilities infrastructure
that will enable ongoing and future work at LAX;
this includes high-priority projects necessary to
support the automated people mover project, the
consolidated rent-a-car facility and intermodal
transportation facility-west. Werner led the design
and constructability eff orts for major recycled and
fi re water lines at LAX’s Central Terminal Area (CTA).

He worked closely and coordinated with City of
Los Angeles departments and LAWA personnel,
manages numerous engineers and coordinates daily
with the contractor.

ADDITIONAL RECENT PROJECTS:
⊲ LA Metro LA River Path Project
⊲ Los Angeles World Airports (LAWA) Southwest
Concourse 0 Program
⊲ City of Santa Barbara, Bonita School Road Bridge
⊲ LA Metro Crenshaw/LAX Light Rail Corridor

WERNER ABREGO
Sr. Civil Engineer
Years of Experience // with DLCE: 27 // 11
Education: BS, Civil Engineering
Areas of Expertise: Active Transportation • First/Last Mile and Transit-Oriented Corridors • Roadway, Rail, and Utility Design• Bilingual:

Spanish
62 Appendix C - Contract Exceptions
The following Appendix is not included in the page limit.

64 CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L 65

1. CONSULTANT’S SERVICES. Section 5.2
Changes Requested “Consultant shall perform all work and services hereunder exercising that degree of care, skill, and diligence ordinarily exercised by professionals performing similar services in the same or similar locale and under similar circumstances to that of Consultant under this Agreement to the highest professional standards of Consultant’s profession and in a manner reasonably satisfactory to City.”
Reason for Changes: We are providing the definition of the prevailing, professional standard of care consultants are to meet in their professional services. The stricken language creates a heightened standard that is unknown and undefined. Falling short of the prevailing, professional standard of care is the definition of negligence. Professional liability insurance only covers the insured professional’s negligence in the performance of its services. It does not cover contractual obligations to meet a standard higher than the prevailing, professional standard of care. Agreeing to a heightened standard of care creates an uninsurable contractual liability for the Consultant.

2. OWNERSHIP OF WRITTEN PRODUCTS. Section 11
Changes Requested “Upon full payment for all services rendered by Consultant under this Agreement, aAll reports, documents or other written material (“written products”) developed by Consultant in the performance of this Agreement shall be and remain the property of City without restriction or limitation upon its use or dissemination by City. Consultant may take and retain copies of such written products as desired, but no such written products shall be the subject of a copyright application by Consultant. If any state, federal, or local law requires mandatory copyright protection for Consultant’s work product, City shall comply with such laws to the extent feasible.

However, notwithstanding the foregoing, or any provision to the contrary herein, intellectual property owned or created by any third party other than Consultant, its subconsultants, or City (“Third-Party Content”), and inventions, improvements, discoveries, methodologies, models, formats, software, algorithms, processes, procedures, designs, specifications, findings, and other intellectual properties developed, gathered, compiled or produced by Consultant or its subconsultants prior to or independently of their performance of this Agreement (“Background IP”), including such Third-Party Content or Background IP that Consultant or its subconsultants may employ in their performance of this Agreement, or may incorporate into any part of the written products, shall not be the property of City. Consultant, or its subconsultants as applicable, shall retain all rights, titles, and interests, including but not limited to all ownership and intellectual property rights, in all such Background IP. Consultant, and its subconsultants as applicable, grant City an irrevocable, non-exclusive, non-transferable, royalty-free license in perpetuity to use, reproduce, prepare derivative works based upon, distribute, disclose, derive from, perform, and display such Background IP, but only as an inseparable part of, and only for the purpose intended by creation of, the written products. In the event the written products contain, or incorporate, any Third-Party Content, or derivative work based on such Third-Party Content, or any compilation that includes such Third-Party Content, Consultant shall secure all licenses to any such ThirdParty Content, but only as an inseparable part of the written products, where such licenses are We would like to request the following contract exceptions:
necessary for City to utilize and enjoy Consultant’s services and the written products for their intended purposes. Any use of Consultant’s written products for any other project or purpose not authorized in writing by Consultant, any modifications to the written products made by anyone other than Consultant, and any use of incomplete written products (“Unauthorized Uses”) shall be at City’s sole risk, and Consultant shall bear no liability for City’s Unauthorized Uses of the written products. City agrees to indemnify, defend and hold Consultant and its officers, agents and employees harmless from any claims, losses, damages, costs, including without limitation attorneys’ fees, arising out of any such Unauthorized Uses of the written products by City.” Reason for Changes: First, we may use or integrate some of our own pre-existing intellectual properties into our work product, which we believe will enhance our services and further the goals of our clients’ projects. However, we cannot take the risk of losing our rights to our intellectual properties. The only alternative would be to not use any of them. Second, we may have to use thirdparty content, such as big data provided by third-party data providers, for which we may receive only a limited-use license and not ownership. It is often necessary for such third-party providers to retain ownership of such data for the uses of other clients or purposes. In such cases, we will secure a license for the City to such content if it is incorporated into our deliverables.

3. INDEMNIFICATION. Section 15.1
Changes Requested “The Parties agree that City, its officers, agents, elected and appointed officials, employees, affiliated public agencies and volunteers should, to the extent permitted by law, be fully
protected from any loss, injury, damage, claim, lawsuit, cost, expense, attorneys’ fees, litigation costs, or any other cost arising out of or in any way related to the performance of this Agreement.

Accordingly, the provisions of this indemnity provision are intended by the Parties to be interpreted and construed to provide the fullest protection possible under the law to City. Consultant acknowledges that City would not enter into this Agreement in the absence of Consultant’s commitment to indemnify and protect City as set forth herein. Notwithstanding the foregoing, to the extent Consultant’s services are subject to Civil Code Section 2782.8, the above indemnity shall be limited, to the extent required by Civil Code Section 2782.8, to claims that arise out of, pertain to, or relate to the negligence, recklessness, or willful misconduct of the Consultant.” Reason for Changes: The Consultant’s indemnity obligation to the City is more clearly defined in Section 15.2. We are removing the language from Section 15.1 that could be contradictory and conflicting with the language in Section 15.2.

4. INDEMNIFICATION. Section 15.2
Changes Requested “To the full extent permitted by law, Consultant shall indemnify, hold harmless and defend City, its officers, agents, elected and appointed officials, employees, affiliated public agencies and volunteers from and against any and all claims, demands, lawsuits, causes of action, losses, costs or expenses for any damage due to death or injury to any person and injury to any property to the extent caused by the resulting from or arising out of any alleged intentional, reckless, negligent, or otherwise intentionally wrongful acts, errors or omissions of Consultant or any of its officers, employees, servants, agents, or subconsultants in the performance of this Agreement. Such costs and expenses shall include reasonable attorneys’ fees incurred by

66 CIT Y OF PICO RIVERA ACTIVE TRANSPORTATION MASTER PL AN N O N C I P N O. 3 0 0 5 8 , AT P L- 5 3 51 (0 4 6) | F E H R & P E E R S P R O P O S A L 67 counsel of City’s choice and expert witness fees and consultant fees. However, in no event shall the cost to defend charged to Consultant exceed Consultant’s proportionate percentage of fault.

Notwithstanding the foregoing, to the extent Consultant’s Services are subject to Civil Code Section 2782.8, the above indemnity shall also be limited, to the extent required by Civil Code Section 2782.8, to claims that arise out of, pertain to, or relate to the negligence, recklessness, or willful misconduct of the Consultant.”
Reasons for Changes: The changes are to align this indemnity obligation with the actual requirements and limitations from Civil Code Section 2782.8. Additionally, the Consultant awarded this contract will be performing professional services for the City. The insurance policy most likely to be invoked and implicated to cover this indemnity obligation is the Consultant’s Professional Liability Insurance. This type of insurance only covers the monetary damages the insured professional causes its clients to incur due to the actual negligence of the insured professional in its professional services. It does not cover monetary damages a client claims it was caused due to the “alleged intentional” or “wrongful” acts of the insured professional that may not rise to the level of negligence.

5. INDEMNIFICATION. Section 15.5
Changes Requested “Consultant agrees to obtain executed indemnity agreements with provisions identical to those set forth here in this Section 15 from each and every subconsultant or any other person or entity involved by, for, with or on behalf of retained by Consultant in the performance of this Agreement. In the event Consultant fails to obtain such indemnity obligations from others as required herein, Consultant agrees to be fully responsible and indemnify, hold harmless and defend City, its officers, agents, elected and appointed officials, employees, affiliated public agencies and volunteers from and against any and all claims, demands, lawsuits, causes of action, losses, costs or expenses for any damage due to death or injury to any person and injury to any property resulting from or arising out of any alleged intentional, reckless, negligent, or otherwise wrongful acts, errors or omissions of Consultant’s subconsultants or any other person or entity involved by, for, with or on behalf of Consultant in the performance of this Agreement. Such costs and expenses shall include reasonable attorneys’ fees incurred by counsel of City’s choice and expert witness fees and consultant fees.”
Reasons for Changes: First, we can only agree to be responsible for the performance of the services under this Agreement by us, our subconsultants, our agents, and our employees. Any subconsultants we engage will be signing subcontracts that state they agree to indemnify the City in accordance with the scope and type of indemnity in this contract. Second, in Section 15.2, we are already agreeing to defend and indemnify the City for the actions of our subconsultants in their performance of work for this project. This language is redundant but also problematic because this indemnity obligation would not mirror the indemnity obligation in Section 15.2 with our revisions.

6. MUTUAL COOPERATION. Section 17.2
Change Requested: “In the event any claim or action is brought against City relating to Consultant’s performance in connection with this Agreement, except for such claims or actions brought against City by Consultant, Consultant shall render any reasonable assistance that City may require.” Reason for Change: We cannot broadly agree to assist the City with respect to all claims against it, especially if we are in an adversarial relationship with regard to any claims or actions.

7. PERMITS AND APPROVALS. Section 19
Changes Requested “Consultant shall obtain, at its sole cost and expense, all only those permits and regulatory approvals typically and customarily obtained by consultants performing similar services to that of Consultant under this Agreement and as specified in Consultant’s Scope of Services attached hereto as Exhibit “A.” necessary in the performance of this Agreement. This includes, but shall not be limited to, encroachment permits and building and safety permits and inspections.”
Reason for Changes: This provision is written broadly. The Consultant should only be responsible for obtaining permits and approvals that are typically required to be obtained and maintained by those in the Consultant’s profession.

8. TERMINATION. Section 22
Changes Requested
“22.1 City shall have the right to terminate this Agreement for any reason on five (5) calendar days’ written notice to Consultant. Consultant shall have the right to terminate this Agreement for any reason on sixty (60) calendar days’ written notice to City. The effective date of termination shall be upon the date specified in the notice of termination. Consultant agrees that in the event of such termination, City’s obligation to pay Consultant shall be limited to payment only for those services satisfactorily rendered, as solely determined by the City, in accordance with this Agreement prior to the effective date of termination. Consultant agrees to cease all work under this Agreement on or before the effective date of any notice of termination. All City data, documents, objects, materials or other tangible things shall be returned to City upon the termination or expiration of this Agreement.

22.2 If City terminates this Agreement due to no fault or failure of performance by Consultant, then Consultant shall be paid based on the work satisfactorily performed, as solely determined by the City, in accordance with this Agreement at the time of termination. In no event shall Consultant be entitled to receive more than the amount that would be paid to Consultant for the full performance of the services required by this Agreement.”
Reason for Changes: The City’s satisfaction is a subjective standard, which may be unattainable and indeterminate. The Consultant should be paid for its services that are performed in accordance with the objective standard of care applicable to its services and the objective terms, conditions, and criteria specified in this Agreement.

9. NON-WAIVER. Section 27.3
Change Requested: “Consultant shall not be liable for any failure to perform if Consultant presents acceptable evidence, in City’s sole judgment, that such failure was due to causes beyond the control and without the fault or negligence of Consultant.” Reason for Change: This is a legal determination and should not be left to the sole judgment of, and determination by, one party to the contract.

Fee Proposal for City of Pico Rivera Active Transportation Master Plan Principal-inCharge Project Manager
High Injury
Network/Vision
Zero Safety
Specialist
Deputy Project
Manager Project Planner
Project
Coordinator/
Visual
Communications
Project
Manager Project Lead Project Support President/ CEO Sr. Civil Engineer Civil Engineer Support Staff Labor Hours Labor Cost Total Jeremy Klop Miguel Nuñez Emily Finkel Sean Reseigh Nata Kovalova Jack Zhai Christy Zamani Ashley Mercado Colin Bogart Borja Leon Werner Abrego Julia Tung CAD Staff Tasks $380 $300 $275 $215 $185 $160 $215 $180 $150 $280 $172 $112 $90 Task 1 - Project Management 4 24 0 36 0 18 9 25 11 10 0 18 12 167 $33,321 $33,321 Task 2 - Existing Conditions Data & Analysis 4 16 12 40 88 24 0 0 0 0 0 0 0 184 $38,340 $38,340 Task 3 - Community Engagement 430 858 130 26 160 195 150 0 0 0 0 761 $145,400 $145,400 Task 4 - Safety Education and Encouragement Programs 0 4 4 20 4 0 10 15 50 0 0 0 0 107 $19,690 $19,690Task 5 - Facility Analysis, Selection, and Plan Development 12 40 12 72 100 40 0 0 0 0 14 56 35 381 $72,070 $72,070Task 6 - Advanced Concept Designs Rosemead Bl Class IV 2 8 4 0 12 12 0 0 0 0 60 78 116 292 $37,896 $37,896Task 7 - Master Plan Adoption 12 26 8 36 80 50 8 4 1 0 0 0 0 225 $47,690 $47,690 Hours & Labor Subtotal 38 148 48 262 414 170 187 239 212 10 74 152 163 2,117 $394,407 $394,407Travel $500Counts (40 multimodal intersection and segment counts) $12,000 Refreshments/Giveaways $0
Supplies, materials, and printing $0Translation Services $3,000 $409,907
Notes:

This fee proposal is valid for a period of 90 days from the proposal submittal date.Actual billing rate at the time of service may vary depending on the final staffing plan at the time the project starts; the overall fee will not be exceeded.

Rates and non-key staff are subject to change at any time, without notice, and within the total budget shown Fehr & Peers (Prime) Day One (Subconsultant) D'Leon Engineers (Subconsultant) Labor & Direct Costs Subtotal
001

EXHIBIT C

TERMS FOR COMPLIANCE WITH CALIFORNIA LABOR LAW REQUIREMENTS

1. This Agreement calls for services that, in whole or in part, constitute “public works” as defined in Division 2, Part 7, Chapter 1 (commencing with Section 1720) of the California Labor Code (“Chapter 1”). Further, Consultant acknowledges that this Agreement is subject to (a) Chapter 1 and (b) the rules and regulations established by the Department of Industrial Relations (“DIR”) implementing such statutes. Therefore, as to those Services that are “public works”, Consultant shall comply with and be bound by all the terms, rules and regulations described in 1(a) and 1(b) as though set forth in full herein.

2. California law requires the inclusion of specific Labor Code provisions in certain contracts. The inclusion of such specific provisions below, whether or not required by California law, does not alter the meaning or scope of Section 1 above.

3. Consultant shall be registered with the Department of Industrial Relations in accordance with California Labor Code Section 1725.5, and has provided proof of registration to City prior to the Effective Date of this Agreement. Consultant shall not perform work with any subconsultant that is not registered with DIR pursuant to Section 1725.5. Consultant and subconsultants shall maintain their registration with the DIR in effect throughout the duration of this Agreement. If the Consultant or any subconsultant ceases to be registered with DIR at any time during the duration of the project, Consultant shall immediately notify City.

4. Pursuant to Labor Code Section 1771.4, Consultant’s Services are subject to compliance monitoring and enforcement by DIR. Consultant shall post job site notices, as prescribed by DIR regulations.

5. Pursuant to Labor Code Section 1773.2, copies of the prevailing rate of per diem wages for each craft, classification, or type of worker needed to perform the Agreement are on file at City Hall and will be made available to any interested party on request. Consultant acknowledges receipt of a copy of the DIR determination of such prevailing rate of per diem wages, and Consultant shall post such rates at each job site covered by this Agreement.

6. Consultant shall comply with and be bound by the provisions of Labor Code Sections 1774 and 1775 concerning the payment of prevailing rates of wages to workers and the penalties for failure to pay prevailing wages. The Consultant shall, as a penalty to City, forfeit $200.00 for each calendar day, or portion thereof, for each worker paid less than the prevailing rates as determined by the DIR for the work or craft in which the worker is employed for any public work done pursuant to this Agreement by Consultant or by any subconsultant.

7. Consultant shall comply with and be bound by the provisions of Labor Code Section 1776, which requires Consultant and each subconsultant to: keep accurate payroll records and verify such records in writing under penalty of perjury, as specified in Section 1776; certify and make such payroll records available for inspection as provided by Section 1776; and inform City of the location of the records.

8. Consultant shall comply with and be bound by the provisions of Labor Code seq. concerning the employment of apprentices on public works projects. Consultant shall be responsible for compliance with these aforementioned Sections for all apprenticeable occupations. Prior to commencing work under this Agreement, Consultant shall provide City with a copy of the information submitted to any applicable apprenticeship program. Within 60 days after concluding work pursuant to this Agreement, Consultant and each of its subconsultants shall submit to City a verified statement of the journeyman and apprentice hours performed under this Agreement.

9. The Consultant shall not perform Work with any Subconsultant that has been debarred or suspended pursuant to California Labor Code Section 1777.1 or any other federal or state law providing for the debarment of consultants from public works. The Consultant and Subconsultants shall not be debarred or suspended throughout the duration of this Contract pursuant to Labor Code Section 1777.1 or any other federal or state law providing for the debarment of consultants from public works. If the Consultant or any subconsultant becomes debarred or suspended during the duration of the project, the Consultant shall immediately notify City.

10. Consultant acknowledges that eight hours labor constitutes a legal day’s work. Consultant shall comply with and be bound by Labor Code Section 1810.

Consultant shall comply with and be bound by the provisions of Labor Code Section 1813 concerning penalties for workers who work excess hours. The Consultant shall, as a penalty to City, forfeit $25.00 for each worker employed in the performance of this Agreement by the Consultant or by any subconsultant for each calendar day during which such worker is required or permitted to work more than eight hours in any one calendar day and 40 hours in any one calendar week in violation of the provisions of Division 2, Part 7, Chapter 1, Article 3 of the Labor Code. Pursuant to Labor Code section 1815, work performed by employees of Consultant in excess of eight hours per day, and 40 hours during any one week shall be permitted upon public work upon compensation for all hours worked in excess of eight hours per day at not less than one and one-half times the basic rate of pay.

11. California Labor Code Sections 1860 and 3700 provide that every employer will be required to secure the payment of compensation to its employees. In accordance with the provisions of California Labor Code Section 1861, Consultant hereby certifies as follows:
“I am aware of the provisions of Section 3700 of the Labor Code which require every employer to be insured against liability for workers’ compensation or to undertake self-insurance in accordance with the provisions of that code, and I will comply with such provisions before commencing the performance of the work of this contract.”

12. For every subconsultant who will perform work on the project, Consultant shall be responsible for such subconsultant’s compliance with Chapter 1 and Labor Code Sections 1860 and 3700, and Consultant shall include in the written contract between it and each subconsultant a copy of those statutory provisions and a requirement that each subconsultant shall comply with those statutory provisions. Consultant shall be required to take all actions necessary to enforce such contractual provisions and ensure subconsultant’s compliance, including without limitation, conducting a periodic review of the certified payroll records of the subconsultant and upon becoming aware of the failure of the subconsultant to pay his or her workers the specified prevailing rate of wages.

Consultant shall diligently take corrective action to halt or rectify any failure.

13. To the maximum extent permitted by law, Consultant shall indemnify, hold harmless and defend (at Consultant’s expense with counsel reasonably acceptable to City) City, its officials, officers, employees, agents and independent consultants serving in the role of City officials, and volunteers from and against any demand or claim for damages, compensation, fines, penalties or other amounts arising out of or incidental to any acts or omissions listed above by any person or entity (including Consultant, its subconsultants, and each of their officials, officers, employees and agents) in connection with any work undertaken or in connection with the Agreement, including without limitation the payment of all consequential damages, attorneys’ fees, and other related costs and expenses. All duties of Consultant under this Section shall survive the termination of the Agreement.

To: Mayor and City Council
From: City Manager
Meeting Date: January 28, 2025
Subject: AMENDMENT NO. 3 TO AGREEMENT NO. 23-2248 WITH
SOUNDTHINKING, INC. FOR SHOTSPOTTER GUNSHOT

DETECTION, LOCATION AND FORENSIC SYSTEM
Recommendation:

1. Approve Amendment No. 3 to Agreement No. 23-2248 with SoundThinking, Inc., for the renewal of the ShotSpotter Gunshot detection, location, and forensics system service contracts for the first two square miles through September 24, 2027; and

2. Authorize the City Manager to execute the amendment in a form approved by the City Attorney.

Fiscal Impact:

The total cost for the proposed extension through September 24, 2027, with SoundThinking, Inc. for the ShotSpotter first two-mile coverage area is $272,047 with an annual cost of $99,000 over the contract period. Funding for this initiative will come from Public Safety Account No. 100.15.1500-54500. No additional appropriation is needed as funds have been allocated within the current budget.

Background:

In October 2023, the City Council approved a one-year pilot program with SoundThinking, Inc. for the ShotSpotter system, initially covering a two square mile area identified as high risk for gun-related incidents. As part of the original agreement, staff negotiated a one square mile service area for $49,500 for one (1) year. In November 2023, staff negotiated an amendment to the agreement (Amendment No. 1), adding an additional one square mile service area at no cost for six (6) months (January through June 2024). The effectiveness of the additional one square mile has been continuously monitored by staff in coordination with the City’s Public Safety Coordinator and the Los Angeles County Sheriff’s Department.

In September 2024, the City Council approved an additional three square miles, which allows a greater portion of the City of Pico Rivera (City) to benefit from the real-time gunfire detection and response capabilities of ShotSpotter, enhancing crime-fighting tools, data8 CITY COUNCIL AGENDA REPORT – MEETING OF JANUARY 28, 2025 AMENDMENT NO. 3 TO AGREEMENT NO. 23-2248 WITH SOUNDTHINKING, INC. FOR

SHOTSPOTTER GUNSHOT DETECTION, LOCATION AND FORENSIC SYSTEM

driven policing, and community confidence in public safety initiatives.

Subsequent to this, the City was able to secure a contract for the first two square miles at the original rate of $99,000 annually ($49,500 for each square mile). For reference, the current annual rate is $75,000 per square mile. As such, staff seeks City Council approval for Amendment No.3 to Agreement No. 23-2248, which would extend the contract term through September 24, 2027, and would lock in the rate at $99,000 per year for the first two square miles. As this term is 2.75 years, Amendment No. 3 prorates the amounts accordingly. The remaining contract term has a total cost of $272,250.

Below is a table summarizing the total costs for the ShotSpotter Gunshot Detection System:

Agreement
No.

Amendment
No. 1
Amendment
No 2.

Proposed
Amendment
No 3. Total Annual FY 24-25
Through
September
24, 2027
MILE 1 $ 49,500 49,500$ $ 49,500 $ 49,500 49,500$ $ 136,024 MILE 2 $ 49,500 - $ $ 49,500 $ 49,500 49,500$ $ 136,024 SUBTOTAL $ 49,500 $ 99,000 -$ 99,000$ $ 99,000 99,000$ $ 272,047 MILE 3 $ 75,000 75,000$ 56,250$ $ 225,000
MILE 4 $ 75,000 75,000$ 56,250$ $ 225,000
MILE 5 (1.05 MILES) $ 78,750 78,750$ 59,063$ $ 236,250
SUBTOTAL $ - -$ 228,750$ -$ 228,750 $ 171,563$ $ 686,250 GRAND TOTAL $ 49,500 99,000$ 228,750$ $ 99,000 $ 327,750 270,563$ $ 958,297 The proposed Amendment No. 3 involves an additional three-year or 33-month contract with SoundThinking, Inc., with an annual cost of $99,000 for the first two square miles, totaling $272,047 over the remaining contract period.

Conclusion:

Staff recommends that the City Council approve the amendment to the agreement with SoundThinking, Inc. to extend the contract term through September 24, 2027, for the first two square miles for the ShotSpotter gunshot detection, alert, and analysis system coverage area.

Steve Carmona
SC:AG:smc
Enclosures: 1) Amendment No. 3
2) Agreement No. 23-2248
AMENDMENT THREE TO MASTER SERVICES AGREEMENT ǀ Page 1 of 3

AMENDMENT THREE

TO MASTER SERVICES AGREEMENT
This Amendment Three (“Amendment Three”) to the Master Services Agreement entered into between SoundThinking, Inc. (“SoundThinking”) and the City of Pico Rivera (“Customer”), dated October 30, 2023 (the “Agreement”) is effective as of the last date of signature below.

Except as amended herein, all other terms and conditions of the Agreement shall remain in full force and effect. In the event of a conflict between the terms of the Agreement and this Amendment Three, the terms of this Amendment Three shall control.

WHEREAS, the Customer’s Coverage Area in the Agreement was for 1.0 square mile; and
WHEREAS, the Agreement was previously amended to increase the Customer’s ShotSpotter Coverage Area by an additional 1.0 square mile (Amendment One dated November 7, 2023); and
WHEREAS, the Agreement was previously amended to increase the Customer’s ShotSpotter Coverage Area by an additional 3.05 square miles (Amendment Two dated September 10, 2024); and
WHEREAS, Customer and SoundThinking desire to extend the Customer’s Phase I 2.0 square mile subscription for a prorated term (to align with the Phase II subscription term) followed by an additional two-year term.

The Parties agree as follows:

1. As set forth in SoundThinking’s Quote #PICOCA071124r, attached to this Amendment Three as Exhibit A, SoundThinking will extend the Phase II subscription for a 33-month period, subject to the provisions of the Agreement.

2. SoundThinking will invoice, and Customer agrees to pay the fees as set forth in Exhibit A.

3. The term of the Agreement shall be extended accordingly.

4. Other than as expressly modified in this Amendment Three with respect to the term and compensation of the extension of services, all remaining terms, conditions, and provisions of the Master Agreement, and the entirety thereof, shall remain in full force and effect, and is incorporated fully herein by this reference.

SIGNATURE PAGE FOLLOWS
ENCLOSURE 1
8a
AMENDMENT THREE TO MASTER SERVICES AGREEMENT ǀ Page 2 of 3 EACH PARTY’S ACCEPTANCE HEREOF IS EXPRESSLY LIMITED TO THE TERMS OF THIS

AMENDMENT THREE, INCLUDING ITS EXHIBITS AND ADDENDA, AND NO DIFFERENT OR

ADDITIONAL TERMS CONTAINED IN ANY CONFIRMATION, PURCHASE ORDER, OR OTHER

BUSINESS FORM, WRITING OR MATERIAL SHALL HAVE ANY FORCE OR EFFECT UNLESS EXPRESSLY AGREED TO IN WRITING BY THE PARTIES.

CITY OF PICO RIVERA SOUNDTHINKING, INC.

Accepted By (Signature) Accepted By (Signature)
Steve Carmona
Printed Name Printed Name
City Manager
Title Title
Date Date
AMENDMENT THREE TO MASTER SERVICES AGREEMENT ǀ Page 3 of 3

EXHIBIT A
QUOTE #PICOCA071124r
DocuSign Envelope ID: 9104B901- F002- 4201- AB59- 55829995BEBB

SOUNDTHINKINGTM' MASTER SERVICES AGREEMENT
Agreement No. 23-248
SouNDTH1NKlNG, INC.
for greater public safetySoundThinking, Inc.
39300 Civic Center Dr., Ste. 300
Fremont, CA 94538

1. 888. 274. 6877
i nfo( alsou ndthinkinq. com
www. soundthinkinq. com
Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States Enclosure 2
8b
DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB SOUNDTHINKING; INC.

Contents

MASTER SERVICES AGREEMENT

1. EXHIBITS 1

2. DEFINITIONS 1

3. SUBSCRIPTION SERVICES 2

4. INITIAL TERM AND RENEWAL 2

5. LICENSE AND OWNERSHIP 3

6. CONFIDENTIALITY AND PROPRIETARY RIGHTS 6

7. LIMITED WARRANTIES 7

8. CUSTOMER OBLIGATIONS 8

9. INTELLECTUAL PROPERTY INFRINGEMENT 9

10. INDEMNIFICATION AND LIMITATION OF LIABILITY 10

11. INSURANCE 11

12. DEFAULT AND TERMINATON; REMEDIES 11

13. TAXES 12

14. NOTICES 12

15. FORCE MAJEURE 12

16. ENTIRE AGREEMENT 13

17. GOVERNING LAW 13

18. NO WAIVER 13

19. SEVERABILITY 13

20. DISPUTE RESOLUTION 13

21. ASSIGNMENT 14

22. COMPLIANCE WITH LAWS 14

23. EQUAL EMPLOYMENT OPPORTUNITY 14

24. GENERAL PROVISIONS 14
EXHIBIT A - SOUNDTHINKING PROPOSAL 1
ADDENDUM ONE - SHOTSPOTTER® SUPPLEMENTAL TERMS 1
Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB SOUNDTHINKING; INC.

MASTER SERVICES AGREEMENT I Page 1 of 15
This Master Services Agreement ( this "Agreement") is entered into by and between SoundThinking TM, Inc. referred to herein as "SoundThinking"), with offices located at 39300 Civic Center Dr., Suite 300, Fremont, CA 94538, and the City of Pico Rivera, a California municipal corporation ( hereinafter referred to as Customer"), with offices located at 6615 Passons Blvd., Pico Rivera, CA 90660- 1015, effective as of the last date of signature herein. SoundThinking and Customer may also be referred to in this Agreement individually as a " Party" or collectively as the " Parties".

This Agreement and its exhibits define the deliverables, implementation, and support services for the SoundThinking Subscription Services to be provided under this Agreement and identified in SoundThinking' sProposal attached hereto as Exhibit A.

In consideration of the Parties' mutual covenants and promises set forth in this Agreement, the Parties agree as follows:

1. EXHIBITS
The following exhibits ("Exhibits") and Addenda are attached to, and incorporated in this Agreement:

A. Exhibit A SoundThinking Proposal ID # PICOCA091223
B. Addendum One - ShotSpotter® Supplemental Terms

2. DEFINITIONS
All capitalized terms not otherwise defined in this Agreement shall have the meanings set forth below:

A. Insight means the intemet portal to which Customer will have access to Reviewed Alerts with respect to the ShotSpotter® Gunshot Detection, Location, and Forensics System.

B. CaseBuilderTM, CaseBuilderTM Subscription Services, CaseBuilderTM Software, or CaseBuilderTM System means the SoundThinking case management software.

C. CaseBuilderTMICrime Gun, CaseBuilderTMICrime Gun Subscription Services, CaseBuilderTMICrime Gun Software, or CaseBuilderTMICrime Gun System means SoundThinking' sgun crime tracking and analysis case management tool.

D. Confidential Information means that information designated by either Party as confidential or proprietary as further defined in Section 6 of this Agreement.

E. CrimeTracerTM, CrimeTracerTM Subscription Services, CrimeTracerTM Software, or CrimeTracerTM System means the law enforcement search engine and information platform which enables customers to search data from agencies across the U. S.

F. Coverage Area means the area in square miles covered by the ShotSpotter® Subscription Services as set forth in Exhibit A and any increase to the Coverage Area as agreed to in writing between the Parties.

Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB SOUNDTHINKING; INC.

Iw 9reahrP K sa/ ety' MASTER SERVICES AGREEMENT I Page 2 of 15 G. ResourceRouterTM, ResourceRouterTM Subscription Services, ResourceRouterTM Software, or ResourceRouterTM System means the SoundThinking crime forecasting and patrol/ task force management system.

H. ShotSpotter®, ShotSpotter® System, ShotSpotter® Software, or ShotSpotter® Subscription Services means the ShotSpotter® Gunshot Detection, Location, and Forensic Analysis Service.

I. ShotSpotter Data means the data, information, and electronic files created, generated, modified, compiled, displayed, stored or kept in the course of providing the ShotSpotter Subscription Services, including, without limitation, information in Reviewed Alerts accessible through the ShotSpotter Subscription Services and/ or Software.

J. Software or SoundThinking Software means collectively the SoundThinking applications identified in Exhibit A and the Addenda to this Agreement to which Customer will have access under this Agreement on a subscription basis. The term Software shall also mean any new applications supplemental to the Subscription Services provided by SoundThinking to Customer subsequent to the execution date of this Agreement, and if purchased by Customer, the SoundThinking API Subscription License.

K. Subscription Services or SoundThinking Subscription Services means collectively the services provided to Customer on a subscription basis under this Agreement to access, and SoundThinking' s
maintenance of, the Software.

L. System means collectively the Software and Subscription Services provided under this Agreement.

3. SUBSCRIPTION SERVICES
A. SoundThinking will implement the applicable Subscription Services set forth in Exhibit A and the Addenda to this Agreement.

4. INITIAL TERM AND RENEWAL
The initial term of the Subscription Services shall be for a period of twelve ( 12) months commencing on the date that the Subscription Services are made available to the Customer (" go live"). Based on the Subscription Services provided under this Agreement, there may be more than one go live date.

The Subscription Services may be renewed for successive periods of one year each ( or multiple years as mutually agreed upon in writing by the Parties), in accordance with the following procedure. SoundThinking shall provide Customer with a renewal notice stating the renewal fees, terms, and conditions for the next successive renewal term approximately ninety ( 90) days prior to the expiration date of the then current term. Customer acknowledges that the Subscription Services fees, terms and conditions, and service levels hereunder are subject to change and that such fees, terms and conditions, and service levels may vary from those applicable to this Agreement in successive renewal terms. Annual Subscription fees are subject to increase at a rate of 5% for Customers whose annual subscription fee is less than the current SoundThinking list price.

Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB SOUNDTHINKING; INC.
for MASTER SERVICES AGREEMENT I Page 3 of 15
If Customer fails to renew prior to expiration of the then current subscription term, the Subscription Services will terminate in accordance with Section 5. 0 and the Customer' saccess to the Subscription Services will be disabled. With respect to ShotSpotter, at its discretion, SoundThinking may remove the ShotSpotter Service and any components from the Coverage Area at that time. If SoundThinking does not remove the ShotSpotter Service from the Coverage Area, Customer may reinstate the ShotSpotter Subscription Services at a later date by renewing this Agreement and payment of the applicable reactivation and ShotSpotter Subscription Services renewal fees; however, Customer will not have access to any Reviewed Alerts that they would have had access to during the lapsed period.

5. LICENSE AND OWNERSHIP
In consideration for and subject to the payment of the annual Subscription Services fees as set forth in Exhibit A, Customer is granted a non- transferrable, non- exclusive and terminable license (" License") to use the applicable SoundThinking Subscription Services, and ShotSpotter® Data for the Customer' sown internal purposes and, if applicable, permitting citizens to access the public facing components of the relevant Subscription Services as set forth in this Section 5 and the Addenda to this Agreement. Please read the terms and conditions of this Agreement carefully. By using any SoundThinkinq Subscription Services, you agree to be bound by the terms and conditions of this Agreement and its Addenda. If you do not agree to these terms, you must notify SoundThinking and discontinue any use of the SoundThinking Subscription Services.

A. License and Restrictions.

Software and Subscription Services. The Software is the proprietary product of SoundThinking, licensed to Customer on an annual subscription basis. The SoundThinking Software may incorporate components supplied to SoundThinking under license by third -party suppliers, and may be protected by United States patent, trade secret, copyright law and international treaty provisions.

All such rights in and to the Software and Subscription Services any part thereof is the property of SoundThinking or, if applicable, its suppliers. All right and title to the SoundThinking computer programs, including, but not limited to related documentation, technology, know- hw and processes embodied in or made available to Customer in connection with the Subscription Services, patent rights, copyrights, trade secret rights, trademarks, and services marks remain with SoundThinking. Customer may not make any copies of the written materials or documentation that accompany any component of the Software, or use them, or any other information conceming the Subscription Services that SoundThinking has designated as confidential, for any purpose other than bona fide use of the Subscription Services or Software for in accordance with the terms of this Agreement, nor allow anyone else to do so. Customer shall not: (i) modify, adapt, alter, translate, copy, perform, or display ( publicly or otherwise) or create compilations, derivative, new, or other works based, in whole or in part, on the Software, or on the Subscription Services; ( ii) merge, combine, integrate, or bundle the Software, in whole or in part, with other software, hardware, data, devices, systems, technologies, products, services, functions, or capabilities; ( iii) transfer, distribute, make available the Subscription Services, or Software to any person other than Customer; or (iv) sell, resell, sublicense, lease, rent, or loan the Subscription Services or Software, in whole or in part. No component of the Subscription Services, or Software may be used to operate a service bureau, rental or time- sharing arrangement.

Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB SOUNDTHINKING; INC.

MASTER SERVICES AGREEMENT I Page 4 of 15
Nothing in this Agreement shall be construed as granting any right or title to any SoundThinking Software, the ShotSpotter Data, or any component thereof, or any other intellectual property of SoundThinking or its suppliers to Customer.

Customer shall not alter, remove or obscure any copyright, patent, trademarks, confidential, proprietary, or restrictive notices or markings on any component of the Subscription Services, Software or any documentation.

Use, duplication, or disclosure by applicable U. S. government agencies is subject to restrictions as set forth in in the provisions of DFARS 48 CFR 252.7- 7013 or FAR 48 CFR 52. 227- 14, as applicable.

B. Export.

Customer acknowledges that the ShotSpotter System has been determined by the United States Department of State to be a controlled commodity, software and/ ortechnology subject to the United States Export Administration Regulations of the U. S. Department of Commerce. Customer is specifically prohibited from the export, or re- export, transfer, consignment, shipment, delivery, downloading, uploading, or transmitting in any form, any ShotSpotter Software, ShotSpotter Subscription Services, ShotSpotter Data, documentation, or any component thereof or underlying information or technology related thereto, to any third party, government, or country for any end uses except in strict compliance with applicable U. S. export controls laws, and only with the express prior written agreement of SoundThinking. In the event that such written agreement is provided, Customer shall be responsible for complying with all applicable export laws and regulations of the United States and destination country, including, but not limited to the United States Export Administration Regulations of the U. S. Department of Commerce, including the sanctions laws administered by the U. S. Department of Treasury, Office of Foreign Assets Control ( OFAC), the U. S. Anti -Boycott regulations, and any applicable laws of Customer' s country. In this respect, no
resale, transfer, or re- export of the ShotSpotter System or any ShotSpotter System component exported to Customer pursuant to a license from the U. S. Department of Commerce may be resold, transferred, or reported without prior authorization by the U. S. Government. Customer agrees not to export, re- export or engage in any " deemed export," or to transfer or deliver, or to disclose or furnish, to any foreign ( non- U. S.) government, foreign ( non- U. S.) person or third party, or to any U. S. person or entity, any of the ShotSpotter System, or ShotSpotter System components, Data, Software, Services, or any technical data or output data or direct data product thereof, or any service related thereto, in violation of any such restrictions, laws or regulations, or without all necessary registrations, licenses and or approvals. Customer shall bear all expenses relating to any necessary registrations, licenses or approvals.

In addition to the restrictions and requirements set forth above, the Customer shall not export, or re- export, transfer, consign, ship, deliver, download, upload, or transmit in any form, the CaseBuilder, CaseBuilderlCrime Gun, CrimeTracer, or ResourceRouter Subscription Services, Software, documentation, or any component thereof or underlying information or technology related thereto to any third party, government, or country for any end uses except in strict compliance with applicable U. S. export controls laws, and only with the express prior written agreement of SoundThinking. In the event that such written agreement is provided, Customer shall be responsible for complying with all applicable export laws and regulations of the United States and Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States DocuSign Envelope ID: 91046901- F02- 42D1- AB59- 55829995BEBB SOUNDTHINKING; INC.

MASTER SERVICES AGREEMENT I Page 5 of 15
destination country, including, but not limited to the United States Export Administration Regulations of the U. S. Department of Commerce, including the sanctions laws administered by the U. S. Department of Treasury, Office of Foreign Assets Control ( OFAC), the U. S. Anti -Boycott regulations, and any applicable laws of the import country.

In addition to the foregoing, Customer shall not disclose, discuss, download, ship, transfer, deliver, furnish, or otherwise export or re- export any such item( s) to or through: (a) any person or entity on the U. S Department of Commerce Bureau of Industry and Security' sList of Denied Persons or Bureau of Export Administration' santi -proliferation Entity List; (b) any person on the U. S.

Department of State' s List of Debarred Parties; (c) any person or entity on the U. S. Treasury Department Office of Foreign Asset Control' sList of Specially Designated Nationals and Blocked Persons; or ( d) any third party or for any end -use prohibited by law or regulation, as any and all of the same may be amended from time to time, or any successor thereto.

C. Termination.

Customer agrees that its right to use any of the applicable Subscription Services, or Software, provided hereunder, including ShotSpotter Data, will terminate following thirty ( 30) day' s prior written notice due to a material breach of the terms of this Agreement, including failure to pay any sums to SoundThinking when due, or failure to renew the applicable Subscription Services prior to expiration of the then current subscription term unless such breach has been cured within said thirty ( 30) day period. In the event of a breach of SoundThinking' sintellectual property rights, SoundThinking at its sole discretion may terminate this Agreement immediately upon written notice to Customer. In the event of termination for any reason, Customer' saccess to the applicable Subscription Services and Software will terminate and be disabled. With respect to ShotSpotter, Customer' s access to ShotSpotter Data will also terminate; and SoundThinking will cease delivering Reviewed Alerts for ShotSpotter. Customer agrees that SoundThinking shall not be liable to Customer nor to any third party for any suspension of the Subscription Services resulting from Customer' s
nonpayment of the Subscription Services fees as described in this section.

D. Modification to, or Discontinuation of the Subscription Services.

Upon reasonable notice to Customer, SoundThinking reserves the right at its discretion to modify, temporarily or permanently, the Subscription Services ( or any part thereof). In the event that SoundThinking modifies the Subscription Services in a manner which removes or disables a feature or functionality on which Customer materially relies, SoundThinking, at Customer' srequest, shall use commercially reasonable efforts to restore such functionality to Customer. In the event that SoundThinking is unable to substantially restore such functionality, Customer shall have the right to terminate the Agreement and receive a pro -rata refund of the annual Subscription Services fees paid under the Agreement for the subscription term in which this Agreement is terminated.

Customer acknowledges that SoundThinking reserves the right to discontinue offering the Subscription Services at the conclusion of Customer' sthen current term. Customer agrees that SoundThinking shall not be liable to Customer or to any third party for any modification of the Subscription Services as described in this section.

Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB SOUNDTHINKING; INC.

E. New Applications.

MASTER SERVICES AGREEMENT I Page 6 of 15
From time to time, at SoundThinking' sdiscretion, SoundThinking may release to its customer base, new applications supplemental to the Subscription Services. Customer' s use of such new applications shall be subject to the license, warranty, intellectual property, and support terms of this Agreement. Prior to general release, SoundThinking may request Customer to act as a pre- release test site for new applications, or major upgrades. Provided that Customer agrees in writing to such request, SoundThinking will provide a pre- release package explaining the details and requirements for Customer' sparticipation.

F. No Use by Third Parties.

Except as otherwise expressly set forth in this Agreement, use by anyone other than Customer of the Subscription Services, Software, documentation, or ShotSpotter Data is prohibited, unless pursuant to a valid assignment of this Agreement as set forth in Section 21 of this Agreement.

6. CONFIDENTIALITY AND PROPRIETARY RIGHTS
A. SoundThinking Confidential Information.

Customer acknowledges and agrees that the source code, technology, and internal structure of the SoundThinking Software, ShotSpotter Data, and SoundThinking Subscription Services, as well as documentation, operations manual( s) and training material( s), are the confidential information and proprietary trade secrets of SoundThinking, the value of which would be destroyed by disclosure to the public. Use by anyone other than Customer of the Subscription Services, documentation, and ShotSpotter Data is prohibited, unless pursuant to a valid assignment under this Agreement.

Unless prohibited by applicable law, the terms and conditions of this Agreement, including pricing and payment terms shall also be treated as SoundThinking' s confidential information. Customer
shall not disassemble, decompile, or otherwise reverse engineer or attempt to reconstruct, derive, or discover any source code, underlying ideas, algorithms, formulae, routines, file formats, data structures, programming, routines, interoperability interfaces, drawings, or plans from the Software, or any data or information created, compiled, displayed, or accessible through the Subscription Services, in whole or in part. Customer agrees during the term of this Agreement, and thereafter, to hold the confidential information and proprietary trade secrets of SoundThinking in strict confidence and to not permit any person or entity to obtain access to it except as required for the Customer' sexercise of the license rights granted under this Agreement. Nothing in this Agreement is intended to or shall limit any rights or remedies under applicable law relating to trade secrets, including the Uniform Trade Secrets Act as enacted in applicable jurisdictions.

B. Customer Confidential Information
During the term of this Agreement or any subsequent renewals, SoundThinking agrees to maintain Customer information designated by the Customer as confidential to which SoundThinking gains access in the performance of its obligations under this Agreement, and not disclose such Customer Confidential Information to any third parties except as may be required by law. SoundThinking agrees that Customer' sConfidential Information shall be used solely for the purpose of performing SoundThinking' sobligations under this Agreement.

Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB SOUNDTHINKING; INC.
for greater pubbc safely' MASTER SERVICES AGREEMENT I Page 7 of 15 C. Obligations of the Parties.

The receiving Party' s ("Recipient") obligations under this section shall not apply to any of the disclosing Party' s ("Discloser") Confidential Information that Recipient can document: (a) was in the public domain at or subsequent to the time such Confidential Information was communicated to Recipient by Discloser through no fault of Recipient; (b) was rightfully in Recipient' spossession free of any obligation of confidence at or subsequent to the time such Confidential Information was communicated to Recipient by such Discloser; ( c) was developed by employees or agents of Recipient independently of and without reference to any of Discloser' sConfidential Information; or d) was communicated by Discloser to an unaffiliated third party free of any obligation of confidence.

A disclosure by Recipient of any Discloser Confidential Information ( a) in response to a valid order by a court or other governmental body; (b) as otherwise required by law; or ( c) necessary to establish the rights of either party under this Agreement shall not be considered to be a breach of this Agreement by the Recipient; provided, however, that Recipient shall provide prompt prior written notice thereof to the Discloser to enable Discloser to seek a protective order or otherwise prevent such disclosure. The Recipient shall use reasonable controls to protect the confidentiality of and restrict access to all Confidential Information of the Discloser to those persons having a specific need to know for the purpose of performing the Recipient' s obligations under this Agreement. The Recipient shall use controls no less protective than Recipient uses to secure and protect its own confidential, but not " Classified" or otherwise Government- legended, information.

Upon termination of this Agreement the Recipient, as directed by the Discloser, shall either return the Discloser' sConfidential Information, or destroy all copies thereof and verify such destruction in writing to the Discloser.

Unless the Recipient obtains prior written consent from the Discloser, the Recipient agrees that it will not reproduce, use for purposes other than those expressly permitted in this Agreement, disclose, sell, license, afford access to, distribute, or disseminate any information designated by the Discloser as confidential.

7. LIMITED WARRANTIES
A. SoundThinking warrants that the Software will function in substantial conformity with the SoundThinking documentation accompanying the Software and Subscription Services. The Software covered under this warranty consists exclusively of ShotSpotter Dispatch, ShotSpotter Respond, and ShotSpotter Insight applications and user interface; CaseBuilder; CaseBuilderiCrime Gun; CrimeTracer; and ResourceRouter Software and Subscription Services that are made available to the Customer under this Agreement as identified in Exhibit A or any subsequent amendment to this Agreement. Additional limited warranties as applicable are set forth in the Addenda attached to this Agreement and incorporated herein.

B. SoundThinking further warrants that the Subscription Services, and Software shall be free of viruses, Trojan horses, worms, spyware, or other malicious code or components.

C. SoundThinking does not warrant or represent, expressly or implicitly, that any of its Subscription Services or Software will be uninterrupted or error free; or that any SoundThinking- supplied network will remain in operation at all times or under all conditions.

Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States DocuSign Envelope ID: 91046901- F02- 42D1- AB59- 55829995BEBB SOUNDTHINKING; INC.
br9reatx WbUcsakry- MASTER SERVICES AGREEMENT I Page 8 of 15 D. Any and all warranties, express or implied, of fitness for high -risk purposes requiring fail- safe performance are hereby expressly disclaimed.

E. The Parties acknowledge and agree that the Subscription Services are not consumer goods, and are not intended for sale to or use by or for personal, family, or household use.

EXCEPT AS EXPRESSLY SET FORTH IN THIS SECTION 7, AND THE APPLICABLE ADDENDA TO

THIS AGREEMENT SOUNDTHINKING MAKES AND CUSTOMER RECEIVES NO OTHER

WARRANTIES, EXPRESS OR IMPLIED, INCLUDING WITHOUT LIMITATION ANY WARRANTIES OF

NON -INFRINGEMENT, QUALITY, SUITABLITY, MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE.

8. CUSTOMER OBLIGATIONS.

Customer acknowledges and agrees that SoundThinking' sduties, including warranty obligations, and ability to perform its obligations to Customer under this Agreement shall be predicated and conditioned upon Customer' stimely performance of and compliance with Customer' s obligations hereunder, including, but
not limited to:

A. Customer agrees to pay all sums due under this Agreement when they are due pursuant to the payment terms in Exhibit A.

Customer' saddress for invoicing:

City of Pico Rivera
Accounts Payable
6615 Passons Road
Pico Rivera, CA 90660- 1016
Email: FinanceDepartmentt? a.. Pico- Rvera. orq
B. Customer agrees to use reasonable efforts to timely perform and comply with all of Customer' s obligations allocated to Customer under this Agreement, and its Addenda.

C. Customer shall not permit any alteration, modification, substitution, or supplementation of any SoundThinking Subscription Services or web portal, or the combining, connection, merging, bundling, or integration of the SoundThinking Subscription Services or web portal into or with any other system, equipment, hardware, software, technology, function, or capability, without SoundThinking' s express prior written consent.

D. Unless otherwise expressly agreed in advance in writing by SoundThinking, Customer shall not authorize or appoint any contractors, subcontractors, original equipment manufacturers, value added integrators, systems integrators, or other third parties to operate, or have access to any part of the Subscription Services or Software.

E. In order to use the Subscription Services, Customer must have and maintain access to the World Wide Web to enable a secure https connection from the Customer' s workstation( s) to SoundThinking' shosted services, either directly or through devices that access Web -based content. Customer must also provide all equipment necessary to make such ( and maintain such) connection.

Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB SOUNDTHINKING; INC.

MASTER SERVICES AGREEMENT I Page 9 of 15
F. Should criminal background checks or fingerprinting for SoundThinking employees performing any Services under this Agreement or an Addendum hereto be required by Customer, or Federal or State regulations, such background checks or fingerprinting will be conducted by Customer.

G. Customer shall be responsible for the accuracy, quality, appropriateness, and legality of all Customer data, any other Customer business information used in any Subscription Services.

H. SoundThinking will assist the Customer in initially setting up passwords and user names for Customer' semployees, agents, or representatives to whom Customer designates access to the applicable Subscription Services (" Authorized Users"). Thereafter, Customer shall be responsible for assigning passwords and user names for each of its Authorized Users. Customer shall be responsible for maintaining the confidentiality and use of Customer' spassword and user names and shall not allow passwords and/ or user names to be shared by Authorized Users; nor shall Customer permit any unauthorized users to access the Subscription Services. The maximum number of Authorized Users for the applicable Subscription Services is set forth in Exhibit A. Each Authorized User identification may only be used to access the applicable Subscription Services during one ( 1) concurrent login session.

I. Customer shall comply with all applicable laws, rules and regulations relating to the goods and services provided hereunder.

9. INTELLECTUAL PROPERTY INFRINGEMENT
SoundThinking will, at its expense, defend and indemnify Customer from and against losses, suits, damages, liability, and expenses ( including reasonable attorney fees) arising out of a claim asserted in a lawsuit or action against the Customer by a third party unrelated to the Customer, in which such third party asserts a claim that the Subscription Services and/ or Software, when used in accordance with SoundThinking' suser documentation, infringes any United States patent which was issued by the U. S.

Patent and Trademark Office, or United States copyright which was registered by the U. S. Copyright Office, as of the effective date of Customer' s
agreement to license the applicable SoundThinking Subscription Services and Software ( collectively " Action"), provided that Customer provides SoundThinking with reasonably prompt notice of any such Action, or circumstances of which Customer becomes aware that could reasonably be expected to lead to such Action including but not limited to any cease and desist demands or warnings, and further provided that Customer cooperates with SoundThinking and its defense counsel in the investigation and defense of such Action.

SoundThinking shall have the right to choose counsel to defend such suit and/ oraction, and to control the settlement ( including determining the terms and conditions of settlement) and the defense thereof.

Customer may participate in the defense of such action at its own expense.

This Section 9 shall not apply and SoundThinking shall have no obligation to defend and indemnify Customer in the event the Customer or a third party modifies, alters, substitutes, or supplements any of the Subscription Services, or Software, or to the extent that the claim of infringement arises from or relates to the integration, bundling, merger, or combination of any of the same with other hardware, software, systems, technologies, or components, functions, capabilities, or applications not licensed by SoundThinking as part of the Subscription Services, nor shall it apply to the extent that the claim of Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB SOUNDTHINKING; INC.

MASTER SERVICES AGREEMENT I Page 10 of 15
infringement arises from or relates to meeting or conforming to any instruction, design, direction, or specification furnished by the Customer, nor to the extent that the Subscription Services or Software are used for or in connection with any purpose, application, or function other than in accordance with the SoundThinking documentation accompanying the Subscription Services or Software.

If, in SoundThinking' s opinion, any of the Subscription Services, or Software may, or are likely to become, the subject of such a suit or action, does become the subject of a claim asserted against Customer in a lawsuit which SoundThinking is or may be obliged to defend under this section, or is determined to infringe the foregoing patents or copyrights of another in a final, non -appealable judgment subject to SoundThinking' sobligations under this section, then Soundminking may in full and final satisfaction of any and all of its obligations under this section, at its option: (1) procure for Customer the right to continue using the affected Subscription Services or Software, ( 2) modify or replace such Subscription Services or Software to make it or them non -infringing, or ( 3) refund to Customer a pro -rata portion of the annual Subscription Services fees paid for the affected Subscription Services for the term in which the Agreement is terminated.

This Section 9 states the entire liability of SoundThinking and is Customer' sexclusive remedy for or relating to infringement or claims or allegations of infringement of any patent, copyright, or other intellectual property rights in or to any SoundThinking Subscription Services, SoundThinking Software or any component thereof. This section is in lieu of and replaces any other expressed, implied, or statutory warranty against infringement of any and all intellectual property rights.

10. INDEMNIFICATION AND LIMITATION OF LIABILITY
SoundThinking shall, at its expense, indemnify, defend, save, and hold Customer harmless from any and all claims, lawsuits, or liability, including attorneys' fees and costs, arising out of, in connection with, any loss, damage, or injury to persons or property to the extent of the gross negligence, or wrongful act, error, or omission of SoundThinking, its employees, agents, or subcontractors as a result of SoundThinking' sor any of its employees, agents, or subcontractor' sperformance pursuant to this Agreement. SoundThinking shall not be required to indemnify Customer for any claims or actions caused to the extent of the negligence or wrongful act of Customer, its employees, agents, or contractors. Notwithstanding the foregoing, if a claim, lawsuit, or liability results from or is contributed to by the actions or omissions of Customer, or its employees, agents, or contractors, SoundThinking' s obligations under this provision shall be reduced to the extent of such actions or omissions based upon the principle of comparative fault.

In no event shall either Party, or any of its affiliates or any of its/ their respective directors, officers, members, attorneys, employees, or agents, be liable to the other Party under any legal or equitable theory or claim, for lost profits, lost revenues, lost business opportunities, exemplary, punitive, special, indirect, incidental, or consequential damages, each of which is hereby excluded by agreement of the Parties, regardless of whether such damages were foreseeable or whether any Party or any entity has been advised of the possibility of such damages.

Except for its Intellectual Property infringement indemnity obligations under Section 9 of this Agreement, SoundThinking' scumulative liability for all losses, claims, suits, controversies, breaches or damages for any cause whatsoever arising out of or related to this Agreement, whether in contract, tort, by way of indemnification or under statute, and regardless of the form of action or legal theory shall not exceed ( i) two ( 2) times the amount of the annual subscription fee( s) for the Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States DocuSign Envelope ID: 91046901- F02- 42D1- AB59- 55829995BEBB SOUNDTHINKING; INC.
for greater public safety' MASTER SERVICES AGREEMENT I Page 11 of 15 twelve ( 12) month period in which the claim arises, or ( ii) the amount of insurance maintained by SoundThinking available to cover the loss, whichever is greater. The foregoing limitations shall apply without regard to any failure of essential purpose of any remedies given herein.

11. INSURANCE
During the term of this Agreement, SoundThinking at its expense, shall carry, maintain, and keep in full force and effect insurance coverage in the limits below. SoundThinking shall provide certificates of insurance to Customer' s Risk Manager evidencing such coverage, and naming the Customer as an additional insured under the commercial general liability policy( ies). Such certificates shall be provided prior to commencement of the Services under this Agreement, and annually on renewal of the required insurance.

Commercial General Liability Insurance: $1, 000,00 ea. occurrence/$ 2, 000,00 aggregate Auto Liability ( any auto):

Umbrella Liability:

E&O/ Cyber Liability:

Workers' Compensation:

Employer' sLiability:
1, 000,00 combined single limit
5, 000,00 ea. occurrence/$ 5, 0000,0 aggregate
3, 000,00 ea. claim/ aggregate
Statutory
2, 000,00 ea. accident
2, 000,00 disease, ea. employee
2, 000,00 disease, policy limit
Certificates of insurance shall include a waiver of subrogation in favor of Customer.

Policies shall be issued by insurers authorized to do business in the State of California, with a rating of at
least A: VII in the latest edition of Best' sInsurance Guide.

SoundThinking shall provide thirty ( 30) days' written notice to Customer in the event such policies are reduced or cancelled.

The commercial general liability and automobile liability policies shall be primary to any coverage available to the City.

The
duties
provision
to indemnify,
of insurance
hold harmless,
by SoundThinking
or defend
shall
as set
not
forth
be construed
in Section
as

10. full performance of SoundThinking' s

12. DEFAULT AND TERMINATON; REMEDIES
Either Party may terminate this Agreement in the event of a material breach of the terms and conditions of this Agreement upon thirty (30) days' prior written notice to the other Party; provided that the Party alleged to be in breach has not cured such breach within said thirty ( 30) day period.

In addition to the termination provisions in Section 5.0 for failure to pay annual Subscription Services fees, upon the occurrence of a material breach of Customer' sobligations under this Agreement not susceptible to cure as provided in the preceding paragraph, SoundThinking may at its option, effective immediately upon written notice to Customer, either: ( i) terminate SoundThinking' sfuture obligations under this Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States DocuSign Envelope ID: 91046901- F02- 42D1- AB59- 55829995BEBB SOUNDTHINKING; INC.

MASTER SERVICES AGREEMENT I Page 12 of 15
Agreement, terminate Customer' sLicense to use the Subscription Services and Software, or ( ii) accelerate and declare immediately due and payable all remaining charges for the remainder of the Agreement and proceed in any lawful manner to obtain satisfaction of the same.

13. TAXES
Unless otherwise included as a line item in Exhibit A, the fees due under this Agreement exclude any sales, use, value added or similar taxes that may be imposed in connection with this Agreement. Customer agrees that it shall be solely responsible for payment, or reimbursement to SoundThinking as applicable, of all sales, use, value added or similar taxes imposed upon this Agreement by any level of government, whether due at the time of sale or asserted later as a result of audit of the financial records of either Customer or SoundThinking. If exempt from such taxes, Customer shall provide to SoundThinking written evidence of such exemption. Customer shall also pay any personal property taxes levied by government agencies based upon Customer' s use or possession of the items acquired or licensed in this Agreement.

14. NOTICES
Any notice or other communication required or permitted to be given under this Agreement shall be in writing delivered to the address set forth in this Agreement by certified mail return receipt; overnight delivery services; delivered in person; or via email with read receipt. A Party' s address may be changed by written notice to the other Party.

Notices to Customer:

City of Pico Rivera
Attn: Steve Carmona, City Manager
PO Box 1016
6615 Passons Blvd.

Pico Rivera, CA 90660- 1016
Facsimile: 562. 801. 4765
With a courtesy copy to:

Arnold M. Alvarez- Glasman, City Attorney
13181 Crossroads Parkway North
Suite 400 — West Tower
City of Industry, CA 91746
Facsimile: 562. 692. 2244

15. FORCE MAJEURE
Notices to SoundThinking:

SoundThinking, Inc.

Attn: CFO
39300 Civic Center Dr., Ste. 300
Fremont, CA 94538
accou ntinq( asou ndth i n king. com
In no event shall the Parties be liable for any delay or default in its performance of any obligation under this Agreement caused directly or indirectly by an act or omission of the other Party , or persons acting under its direction and/ or control, fire, flood, act of God, an act or omission of civil or military authority of a state or nation, strike, lockout, or other labor disputes, inability to secure, delay in securing, or shortage of labor, materials, supplies, transportation, or energy, failures, outages or denial of services of wireless, power, telecommunications, or computer networks, acts of terrorism, sabotage, vandalism, hacking, natural disaster or emergency, war, riot, embargo, or civil disturbance, breakdown or destruction of plant or Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States DocuSign Envelope ID: 91046901- F02- 42D1- AB59- 55829995BEBB SOUNDTHINKING; INC.
w 9reale. Per yY' MASTER SERVICES AGREEMENT I Page 13 of 15 equipment, or arising from any cause whatsoever beyond either Party' s reasonable control. At SoundThinking' s option and following notice to Customer, any of the foregoing causes shall be deemed to suspend such obligations of SoundThinking so long as any such cause shall prevent or delay performance, and SoundThinking agrees to make, and Customer agrees to accept performance of such obligations whenever such cause has been remedied.

16. ENTIRE AGREEMENT
This Agreement and its Exhibits and Addenda represent the entire agreement and understanding of the Parties and a final expression of their agreements with respect to the subject matter of this Agreement and supersedes all prior written or oral agreements, representations, understandings, or negotiations with respect to the matters covered by this Agreement.

17. GOVERNING LAW
The validity, performance, and construction of this Agreement shall be governed by the laws of the state of California, without giving effect to the conflict of law principles thereof. The United Nations Convention on Contracts for the International Sale of Goods is expressly disclaimed and shall not apply.

18. NO WAIVER
No term or provision of this Agreement shall be deemed waived, and no breach excused unless such waiver or consent is in writing and signed by both Parties. Any consent by either Party to, or waiver of, a breach by the other, whether expressed or implied, shall not constitute a consent to, waiver of, or excuse for any other, different, prior, or subsequent breach.

The failure of either Party to enforce at any time any of the provisions of this Agreement shall not constitute a present of future waiver of any such provisions or the right of either Party to enforce each and every provision.

19. SEVERABILITY
If any term, clause, sentence, paragraph, article, subsection, section, provision, condition, or covenant of this Agreement is held to be invalid or unenforceable, for any reason, it shall not affect, impair, invalidate or nullify the remainder of this Agreement, but the effect thereof shall be confined to the term, clause, sentence, paragraph, article, subsection, section, provision, condition or covenant of this Agreement so adjudged to be invalid or unenforceable.

20. DISPUTE RESOLUTION
If the Parties disagree as to any matter arising under this Agreement or the relationship and dealings of the Parties hereto, then at the request of either Party, SoundThinking and Customer shall promptly consult with one another and make diligent, good faith efforts to resolve the disagreement by negotiation prior to either Party taking legal action. If such negotiations do not resolve the dispute within sixty ( 60) days of the initial request, either Party may take appropriate legal action.

Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB SOUNDTHINKING; INC.

M 9M q, Elic v/ efy

21. ASSIGNMENT
MASTER SERVICES AGREEMENT I Page 14 of 15
This Agreement may not be assigned or transferred by either Party, nor any of the rights granted herein, in whole or in part, by operation of law or otherwise, without the other Party' s express prior written consent, which shall not be unreasonably withheld. Provided, however, that SoundThinking may assign or transfer this Agreement and/ or SoundThinking' srights and obligations hereunder, in whole or in part, in the event of a merger or acquisition of all or substantially all of SoundThinking' sassets. No assignee for the benefit of Customer' screditors, custodian, receiver, trustee in bankruptcy, debtor in possession, sheriff, or any other officer of a court, or other person charged with taking custody of Customer' sassets or business, shall have any right to continue or to assume or to assign these without SoundThinking' sexpress consent.

22. COMPLIANCE WITH LAWS
During the term of this Agreement SoundThinking will comply with all applicable local, state, and federal laws, statutes and regulations.

23. EQUAL EMPLOYMENT OPPORTUNITY
SoundThinking is committed to equal -employment principles, and the provisions outlined in the Equal Opportunity Clauses of Executive Order 11246, (41 CFR 60- 1. 4), section 503 of the Rehabilitation Act of 1973, (41 CFR 60- 741. 5(a)), section 402 of the Vietnam Era Veterans Readjustment Act of 1974, (41 CFR 60- 250. 5(a)), and, the Jobs for Veterans Act of 2003, (41 CFR 60- 300. 5(a)) as well as any other regulations pertaining to these orders. SoundThinking' s decisions and criteria governing its hiring and employment practices are made in a non- discriminatory manner, without regard to age, race, color, national origin, citizenship status, gender ( including pregnancy, childbirth or medical condition related to pregnancy or childbirth), gender identity or expression, sex, religion, creed, physical or mental disability, medical condition, legally protected genetic information, marital status, veteran status, military status, sexual orientation, or any other factor determined to be an unlawful basis for such decisions by federal, state, or local statutes.

24. GENERAL PROVISIONS
A. This Agreement and its Addenda shall be binding on and inure to the benefit of the Parties and any permitted successors and assigns; however, nothing in this paragraph shall be construed as a consent to any assignment by either Party except as provided in Section 21 of this Agreement.

B. This Agreement shall not become a binding contract until signed by an authorized representative of each Party, effective as of the date of signature.

C. This Agreement and its Addenda may be executed in any number of identical counterparts, each of which shall be deemed a duplicate original.

D. The provisions of this Agreement and Addenda shall not be construed in favor of or against either Party because that Party or its legal counsel drafted this Agreement, but shall be construed as if all Parties prepared this Agreement.

E. An electronic signature copy of this Agreement and its Exhibits, Addenda, notices and documents prepared under this Agreement shall be considered an original. The Parties agree that any document in electronic format or any document reproduced from an electronic format shall not be Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB SOUNDTHINKING; INC.
for greaterpubbc s. fety MASTER SERVICES AGREEMENT I Page 15 of 15 denied legal effect, validity, or enforceability, and shall meet any requirement to provide an original or hard copy.

F. This Agreement is made for the benefit of the Parties, and is not intended to benefit any third party or be enforceable by any third party. The rights of the Parties to terminate, rescind, or agree to any amendment, waiver, variation or settlement under or relating to this Agreement are not subject to the consent of any third party.

EACH PARTY' SACCEPTANCE HEREOF IS EXPRESSLY LIMITED TO THE TERMS OF THIS

AGREEMENT, INCLUDING ITS EXHIBITS AND ADDENDA, AND NO DIFFERENT OR ADDITIONAL

TERMS CONTAINED IN ANY CONFIRMATION, PURCHASE ORDER, AMENDMENT OR OTHER

BUSINESS FORM, WRITING OR MATERIAL SHALL HAVE ANY FORCE OR EFFECT UNLESS EXPRESSLY AGREED TO IN WRITING BY THE PARTIES.

CITy0O 9PRO RIVERA
CC6CB5FBF 10E4BF...

SOUNDT -IINat1G, INC.

KOZarin.* .41-14n44,
5A2E233158A94FE...

Accepted By ( Signature) Accepted By (Signature)
Steve Carmona Roxanne Lerner
Printed Name Printed Name
City Manager Director of Contracts
10/ 30/ 2023
Title Title
10/ 30/ 2023
Date Date
Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB SOUNDTHINKING; INC.

MASTER SERVICES AGREEMENT EXHIBIT A I Page 1 of 1
EXHIBIT A — SOUNDTHINKING PROPOSAL
SoundThinking Proposal No.: PICOCA091223
Attached on Following Pages)
Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States DocuSign Envelope ID: 91046901- F002- 42D1- AB59- 55829995BEBB 1_ ShotSpotter®
Price Proposal for Subscription -Based
Gunshot Detection, Location, and Forensic Analysis Service for the City of Pico Rivera, California
September 12, 2023
Proposal ID: PICOCA091223
Submitted by:

SOUNDTHINKING
Terri Greene — Director, West Region
714. 365. 5102 mobile
650. 887. 2106 fax
tgreene@soundthinking. com
SoundThinking, Inc.
39300 Civic Center Drive, Suite 300
Fremont, California 94538
888. 274. 6877
www. soundthinking. com
DocuSign Envelope ID 91046901- F02- 42D1- AB59- 55829995BEBB Table of Contents
Executive Summary 1
Introduction 1
Company History 3
SoundThinking' sSafetySmart Platform 4
ShotSpotter Service Overview 5
How ShotSpotter Works 5
ShotSpotter Application 6
InSightTM 7
Mobile Alerts 9
Investigative Lead Summary 10
Detailed Forensic Reports and Expert Witness Testimony 11 Notifications API ( Optional) 12
Onboarding Services 13
Getting Started 13
Best Practices 13
User Training 14
Agency Metrics/ KPIs (Key Performance Indicators) 14
Onsite Support During Service Activation ( Go -Live) 14 Ongoing Customer Support 15
Customer References 15
Proposed Coverage Area 16
Pricing 17

1. 0 mi2 Coverage Area ( One Year Term) 17

1. 0 mi2 Coverage Area ( Three Year Term) 17
Forensic Consultation Services 17
Payment Terms 17
One -Year Payment Terms 17
Three -Year Payment Terms 17
Pricing Assumptions 18
Optional Additional Services 18
Notifications API Annual Subscription Fee 18
Notifications API Pricing Assumptions 18
SOUNDTHINKING- © 2023
DocuSign Envelope ID: 91046901- F02- 42D1- AB59- 55829995BEBB or ShotSpotter®
Executive Summary
Price Proposal for Pico Rivera, CA
Introduction
SoundThinkingT' is pleased to present this proposal in response to the City of Pico Rivera' s request. A component of our SafetySmartTM Platform, the proposed ShotSpotter® solution is designed to identify, locate, and track active gunfire, and will support the Los Angeles Sheriffs Department' s (LASD' s) efforts to more effectively respond to and investigate gunfire incidents.

The proposed solution is deployed across the country and serves agencies of all sizes that are committed to leveraging our real- time gunfire intelligence to reduce gun violence and build community trust.

The ShotSpotter gunshot detection, alert, and analysis services provide what would be otherwise unobtainable, critical real- time gunfire intelligence. The core capabilities of the ShotSpotter solution are:

DETECT — ShotSpotter detects and locates gunfire incidents to enable a fast, precise response to over 90% of shooting incidents within the targeted areas. This has a powerful deterrent effect and disrupts the gun violence cycle.

PROTECT — ShotSpotter alerts allow first responders to respond swiftly to find victims and save lives. Cities with ShotSpotter report a 3. 5 minute reduction in transport time for gunshot victims. In addition, ShotSpotter helps protect officers by providing them with comprehensive data on the actual amount of gunfire activity that occurs in the neighborhoods they patrol and provides critical situational awareness when responding to specific incidents.

CONNECT — By applying community policing - oriented best practices, ShotSpotter provides a unique opportunity for law enforcement agencies to connect with vulnerable communities. Rapid response to gunfire incidents in communities that have been most impacted by gun violence builds positive attitudes towards law enforcement and leads to more constructive engagements and cooperation.

ShotSpotter has become an indispensable crime -fighting tool for these agencies, in light of the community dynamics that fuel gun violence and the well -documented challenges of relying solely on 9-1-calls for service:

Under -reporting of persistent gunfire: Nationwide, on average, less than 20% of gunfire incidents are reported to 9-1-. Why don' tresidents call? The answer is complex, but typically involves the following concerns:
o Recognition: " Was that gunfire, fireworks, or something else?" o Retaliation: " If they find out I called, will they come after me?" o Resignation: " No one came the last time I called..." Without ShotSpotter, most law enforcement agencies are working with an 80% to 90% deficiency in their gun violence - related intelligence.

Late and inaccurate information: When a citizen reports a gunfire incident, the 9-1- call typically comes several minutes after the event occurred, and based on analysis, the location provided is usually mislocated by 750 feet ( on average). As a result, valuable time and resources are wasted trying to locate the incident, diminishing the opportunity to identify suspects and witnesses, recover evidence, and most importantly, render lifesaving aid to victims.

SOUNDTHINKING- © 2023 1
DocuSign Envelope ID: 91046901- F02- 42D1- AB59- 55829995BEBB 1 iir ShotSpotter® Price Proposal for Pico Rivera, CA
The ability to receive near real- time gunfire intelligence data provides law enforcement agencies with a critical advantage in their efforts to reduce and prevent gun violence and improve officer safety. Specific results include:

Officers can more quickly and accurately go directly to the scene of the shooting Situational awareness is vastly improved over what is available when relying solely on the 9-1-system
Law enforcement has a better chance of arriving before the shooter has left the scene Officers are more likely to find evidence in the form of shell casings ( which, in conjunction with NIBIN/ IBIS, provide valuable investigative leads) and/ or other ground truth that can aid in the investigation
Officers are more likely to find witnesses who may have information that can aid in the investigation
Community engagement is heightened, which often translates into more information from the community ( e.g., tip lines, field interviews, etc.) Enhanced targeted enforcement ( precision policing)
More court -admissible and scientifically sound forensic evidence is available to strengthen prosecutions of the worst offenders
We appreciate your consideration of our proposal. SoundThinking is committed to your success and we look forward to partnering with you to make ShotSpotter a key component of your efforts to reduce gun crime in the City of Pico Rivera.
1SOUNDTHINKING © 2023 2
DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB I. ShotSpotter®
Company History
SoundThinking is a public safety technology company that combines transformative solutions and strategic advisory services for sound decisions, to make neighborhoods safer and improve community confidence. SoundThinking was founded in 1995 ( as ShotSpotter, Inc.) and has been providing gunshot detection solutions since its inception. SoundThinking is the world leader in gunshot detection, with over 1, 000 square miles operational; more than 14 million incidents reviewed; and 40 issued patents. SoundThinking is a publicly traded corporation NASDAQ: SSTI) with approximately 200 full- time employees and is headquartered in Fremont, California.

Price Proposal for Pico Rivera, CA
The following table provides an overview of SoundThinking' shistory and growth. 1995
SoundThinking ( formerly ShotSpotter) founded by Dr. Robert Showen. With over 30 years of acoustic and geophysics experience, it was Dr. Showen' svision to help curb gunfire that led him to design the ShotSpotter gunshot detection system. 1996 The US Patent Office granted SoundThinking its first patent 2010 Ralph Clark joined SoundThinking as President and CEO 2011 SoundThinking opened the Incident Review Center ( IRC) allowing SoundThinking to publish or dismiss detected gunshots with a higher level of accuracy 2014 Cape Town, South Africa became SoundThinking' sfirst international SaaS customer 2016 SoundThinking formed our Customer Success Team to assist all customers in maximizing the value of the ShotSpotter service
2017 SoundThinking achieved a World Class Net Promotor Score ( NPS) of 55% SoundThinking became a publicly traded company ( NASDAQ: SSTI) 2018
SoundThinking acquired HunchLab technology and introduced a proactive patrol management solution ( formerly Connect, now ResourceRouter") SoundThinking won the Noble Technology Award from National Organization of Black Law Enforcement Executives
SoundThinking won AST Homeland Security Award for Best Gunshot Detection System
The City of Chicago expanded ShotSpotter coverage to over 100 miles and reported a 26% decrease in shootings from the previous year
Kruger National Park in South Africa went live with ShotSpotter in the park' s iconic Intensified Protection Zone ( IPZ).
2019
SoundThinking received approval from the Oakland City Council and unanimous approval for use of its gunshot detection technology from the Oakland Privacy Advisory Commission ( PAC).

SoundThinking welcomed its 100th customer
SoundThinking deployed its first sensors in Malaysia in an effort to reduce blast fishing, save the coral reef, and ensure local food security 2020
SoundThinking acquired LEEDS, LLC and assumed responsibility for case management within the New York Police Department. With this strategic acquisition, SoundThinking added case management technology to its SafetySmart platform.

Rangers from Kruger National Park reported nearly 60% reduction in the number of rhinos killed within the ShotSpotter coverage area
2021
SoundThinking won the AST Homeland Security Award for Best Gunshot Detection System for fourth consecutive year
The US Patent Office granted SoundThinking its 40th patent SoundThinking published its one millionth gunshot alert SoundThinking introduced two new applications: CaseBuilder" and CaseBuilder Crime Guns' focused on gun crime management
SOUNDTHINKING © 2023 3
DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB ShotSpotter®
2022
2023
Price Proposal for Pico Rivera, CA
SoundThinking acquired Forensic Logic, LLC and their COPLINK X solution ( now CrimeTracer'""), an investigative search engine and analytics tool SoundThinking introduced our Data for Good program, designed to use ShotSpotter data to identify communities experiencing high levels of gunfire violence and assist community providers to deliver timely support and intervention SoundThinking certified a " Great Place to Work"
SoundThinking introduced our SafetySmart Platform, a suite of products that provide law enforcement agencies with better information, to enable better decisions, and drive better outcomes
SoundThinking' sSafetySmart Platform
The SafetySmart Platform brings together specialized software and objective data to help law enforcement and civic leadership better protect their communities by ensuring the right resources are provided when and where they are needed most. As a trusted partner to many law enforcement agencies, SoundThinking has been both a firsthand witness and participant in the evolution of policing as it faces increasing challenges, such as staffing shortages, aging technologies, and exponential growth in data ( as well as the need to access, analyze, and share data). In response to these challenges, SoundThinking has developed our SafetySmart Platform that provides a range of tools beyond gunshot detection to help law enforcement agencies operate and collaborate more efficiently.

SafetySmartBetter Information • Better Decisions • Better Outcomes ShotSpotter
Gunshot Detection
Real- time alerts for rapid, precise
response to save lives
Increase evidence recovery and
NIBIN leads
Enhance gun violence
prevention/ intervention with Data for
Good
Investigative Lead Generation
Accelerate investigations with largest
database of local and regional crime
data in single portal
Advanced link analysis detects
relationships between people. places,
and things
ResourceRouter
Community - First Patrol Managemen
Data -driven deployment of patrol
resources for more effective crime
deterrence
Drive accountability into officer activity
Reduce over -policing and bias in
patrols
CaseBuilder
Digital Case Management
One -stop digital case folder houses
all data and workflows
Analytical and collaboration tools
accelerate and improve solvability
More efficient and effective case
handling
Gun Crime Management
Centralized collaboration on gun
crime activities including Respond
alerts and NIBIN leads
Prioritize and track leads and tasks
Operational insights on case
outcomes for stakeholderfeedback
The SafetySmart Platform brings the power of digital transformation to law enforcement.

Together or separately, these data -driven solutions act as a force multiplier and help drive deeper community engagement by delivering better information, enabling better decisions, and driving better outcomes, for more efficient, effective, and equitable policing.

SOUNDTHINKING- © 2023 4
DocuSign Envelope ID: 91046901- F02- 42D1- AB59- 55829995BEBB ShotSpotter®
ShotSpotter Service Overview
Price Proposal for Pico Rivera, CA
How ShotSpotter Works
Based on an analysis of known gunfire -related crimes, the SoundThinking team designs and deploys networked sensors within the targeted coverage area. These acoustic arrays detect and locate gunshot activity within the coverage area and report Incident Review Center ( IRC) which is staffed 24/ 7/ 365. ShotSpotter that information
uses a
to
two -
SoundThinking' s
factor incident
review process to minimize false alerts. The first tier is performed by sophisticated Al software, to filter out any incidents that do not meet the minimum threshold for human review as potential gunfire incidents ( e.g., helicopter noise, fireworks, etc.). The incidents that meet the minimum threshold for human review are then received at our IRC. The IRC review process is performed by a team of highly trained acoustic experts. In addition to examining the incident audio, SoundThinking' sacoustic experts also examine the visual characteristics of the detected pulses and the incident, such as the number of participating sensors, the wave form, pulse alignment, and the direction of sound. The IRC review results in either publishing ( Gunshot or Probable Gunshot) or dismissal ( Non -Gunshot) of the incident with a high level of precision.

If the reviewer classifies the incident as a gunshot, the reviewer sends an alert, including location information and an audio snippet, to law enforcement agencies via a password - protected application on a mobile phone, in -car laptop, or computer. In addition to the dot -on - the -map and audio, ShotSpotter provides details such as number of shots fired, whether multiple shooters were involved, and whether high -capacity and/ or fully automatic weapons were used. SoundThinking designed this entire process ( i.e., recording the impulsive sound, two -factor review, and publishing alerts to authorized users) to be completed in less than 60 seconds ( but is often completed within 25 to 30 seconds).

ShotSpotter customers receive a contextually rich, detailed gunfire alert that enables a fast, precise, and safer response to gunfire incidents. In addition, ShotSpotter alerts can also trigger other technology platforms such as cameras that can pan and zoom in the direction of an event.

SoundThinking has successfully integrated ShotSpotter with a wide range of third -party applications such as CAD, RMS, License Plate Readers, drones, and other applications.

ShotSpotter helps law enforcement agencies by directing resources to the precise location of more than 90% of gunfire incidents. ShotSpotter rapidly notifies first responders of shootings via dispatch centers, in -vehicle computers, and smart phones. Instant alerts enable first responders to aid victims, collect evidence, and identify witnesses. ShotSpotter' sactionable intelligence can then be used to prevent future crimes by positioning law enforcement when and where crime is likely to occur. ShotSpotter gunshot detection and location services are delivered as an easily implemented Software as a Service ( SaaS) solution, with no requirement for customer investment in or maintenance of expensive hardware or software. SoundThinking hosts, secures, monitors, and maintains the ShotSpotter infrastructure. Contracts are based on an affordable one- year or multi - year subscription agreement, and the subscription includes unlimited licenses for the proposed SoundThinking applications.

SOUNDTHINKING" © 2023 5
DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB ShotSpotter® Price Proposal for Pico Rivera, CA
ShotSpotter Application
The ShotSpotter application is used by Call Takers, Dispatchers, and Patrol Officers in the field.

Real- time notifications of gunfire incidents are delivered to this app and includes the following data:

Incident location ( dot on the map, per the incident latitude and longitude) Type of gunfire ( single round, multiple round)
Unique identification number
Date and time of the muzzle blast (trigger time)
Nearest address of the gunfire location
Number of shots
District identification
Beat identification
ShotSpotter
Q.

DAYS
2620 Fordham St
wwropouswal
AKA
ORPROP MMl
184 Jasmine Way
AREA
ORAN
1771E Bayahore Rd
N. Ro ww
E ODAN
o,:> Qeo
2255 aide Ave
blesopeliPlat
nmm
Bay Trail
MNpyOIiSWOA
ns NI Of
ARIA
A. el
Mx
27 14 30
M

CAD BELLE HAVEN
f5Z
ID
tAD
H OF
ART •
E OARS
TOWN
1TN
Figure 1. ShotSpotter App in Dispatch View

DUVENECR/
ST. FRANCIS t
172 Jasmine Way
TOAtv:: w<si AREA
OtE0: 9 &. I3
vM er. arov w<e AN, .-- A
A SoundThinking analyst may add other contextual information such as the possibility of multiple shooters, high -capacity weapons, full -automatic weapons, and the shooter' slocation related to a building ( front yard, back yard, street, etc.). The report also includes an audit trail of the time the alert was published, acknowledged, and closed at the customer facility. All notes entered by Call Takers and Dispatchers added to the alert are time- and date -stamped with the operator' sID. For Patrol Officers, the alert includes an audio snippet of the incident. 1 Based on the reverse geo- vrification of the incident latitude and longitude, using commercially available GIS sources such as Google or customer -provided GIS data.

SOUNDTHINKING- © 2023 6
DocuSign Envelope ID: 9104B901- F002- 42D1- AB59- 55829995BEBB ShotSpotter® Price Proposal for Pico Rivera, CA
ShotSpotter
2255 Clarke Ave
2255ClaikeAve
MMmpolisWest
today 0328/ 2073@070() co
tM Smeggotint, OE
j LLvt3 9751 aYRBAklIC
919091
AMITY
revievver@shotspotter. com. Mw..1. 11.

Modified CM to 29- tn.
reviewe1( DSh0t. Spoter Qmt: ' 6». .'
Ad0OYAedgd
system . ne..., ao
ewiwKd
Chat or email support@ soundthir. kinc
9 Figure 2. ShotSpotter App in Respond Vii
InSightTM
InSightTM enables customers to explore details about prior gunshot incidents in their ShotSpotter coverage area and use the data for investigation and analysis. Crime analysts, investigators, and command staff can view, filter, sort, report, and transform historical gunshot data into meaningful insights, ultimately informing strategies for reducing gun violence.

InSight enables users to find and identify the incidents using an extensive array of filters for date, time, location, keywords, single vs. multiple gunshots, patrol areas, as well as shapes drawn on the map. The shape filters narrow a search for shooting incidents within a radius of a known address, across several blocks, or look for and monitor activity on both sides of a jurisdictional border. Saved reports retain common filter settings for quick retrieval ( e.g., "District 4 Gunfire — Last 28 days").

SOUNDTHINKING- © 2023 7
DocuSign Envelope ID: 91046901- F02- 42D1- AB59- 55829995BEBB or ShotSpotter® Price Proposal for Pico Rivera, CA
fill InSight Q S9a, th
CD 0 M® oll. West
0 9
9 0
V©
9 9
9 L 724 le, gunshot moderns
VIEW . FILTERS -
larva Fora ( 3) R
acapi
28 n
28 105
1 at
V
OY+
S+Msarte. l0 a
Q M91kple ( wrolwts 9/ 517113n5Rde
9 0uyt4Gun5hat 9/ S1- 00510- 1-
Mukple W1shon 915146/ a4Pgn
9, 9
MuItip0 Gunshots 9751 / 9g0RCk
r
Q Mutupl0Gullhp, 3 9751- 0nel T1m
Mu10pk41nshos 9151. u59MP2t
9 Mulnplo 40001115 9/ 51 01100. 2
Mu10p04. uash. 9751i] Fm0. 50. nV
4 9192149. 3001/999
03/ 78/ 202300710. X
975119000811e
WRU 041155 51015 91A118
CLASSY IC110R SENSORS A04RC1
lA. t 700MMAC3 Cd15i1115
IR111e111 9 3210815 pawner
I owl 119E 0441010 HRH II
409440094*

41. Figure 3. InSight App
InSight shows how a shooting event unfolded by watching a shot -by -shot animation that details the location and sequence of each shot. The software also highlights other nearby incidents that may be potentially related based on its relative distance and time of occurrence.

InSight comes with a set of reports that make it easy to share incident data throughout an agency:

The Investigative Lead Summary report give details of a shooting incident including audio, location, sequence, and timing of each shot fired. This report is often used to share incident audio and details with colleagues, aid investigators with collecting evidence at the scene of a shooting and conducting better interviews of witnesses, suspects, and victims, or attach to a case file.

The Multi -Incident report provides a summary of shooting incidents broken out by single, multiple, and probable gunshot incidents as well as any non -gunfire incidents if they were included in the search. The summary is followed by details for each incident including the date, time, location, number of rounds, CAD ID, ShotSpotter ID, and other details.

For customized, ad hoc reporting and analysis, InSight can export incident data to other off -the - shelf products such as Microsoft Excel, Tableau, Google Earth, ArcGIS, and other tools.

SOUNDTHINKING- © 2023 8
DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB I. ShotSpotter®
Mobile Alerts
The ShotSpotter smartphone
application delivers real- time gunfire
alert data to smart phones and smart
watches, available for use on iPhones
and Android platforms. The ShotSpotter
app displays the gunfire location as a
dot -on -a -map and the data also
includes the number of rounds fired and
access to the incident audio.

Price Proposal for Pico Rivera, CA
Figure 4. Smartwatch Notification
MJItiple_ Gunshots -
2 rounds at: 13451
Burleigh ,
Alert
Gunfire: 7 Rounds at
794 Green St,
Metropolis A
Figure 5. ShotSpotter Smartphone App
SOUNDTHINKING © 2023 9
DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB L
ShotSpotter® Price Proposal for Pico Rivera, CA
Investigative Lead Summary
The ShotSpotter Investigative Lead Summary ( ILS) is an on -demand report that provides useful details about the location, timing, and sequence of each shot fired during an incident. The ILS is very valuable on scene, helping law enforcement find shell casings, confirm witness accounts, and identify suspects. ILS reports are available immediately after an incident occurs through a single click of a button within the mobile, web, or desktop ShotSpotter and InSight applications.

The ILS will fulfill the majority of law enforcement agency needs, particularly in situations where a report is not intended for presentation to court ( since the ILS report is electronically produced, it is not court admissible).

ShotSpotter

INVESTIGATIVE LEAD SUMMARY
T. following shat court tone, end 90, 0,,,., were eutonaticellycekJeted oy the Shot'. 00' c avatem M the lime,; t detection. They ere ', await.. end n. ud ot deemed no 3, The', anon, ofln4v, d, nlshot, be., rev not match Ifw' mind mum reported on
page one. t en Incident Reviewer edjo, 4d the rood count dui, inodent, eriew or. to putlkaton Some shots may cv. lep or tide other aho1. on Me mop• INDIVIDUAL 111015
SHOT
INCIDENT DATE:

CITY / ZONE:

REPORT DATE:

REOl1ESTED BY.

ShotSpotler ID. 9751-442021m
MAR 28, 2023

METROPOLISWEST / METROPODSWEST
MAR 28, 2023 09: 49: 50
OOEISNERSS` SIIOTSFOTTER. COM
DATE TIME INTERVAL ( Dec) LOCATION
03/ 28/023 01: 3090. 051 0.00 37. 457093,- 122.31414
03/ 28/023 0130:. 295 0. 244 37. 457044, 122.31472
63 03/ 28/023 01: 3090. 525 0. 230 37. 457035, - 122.31474 4 03/ 28/023 01. 30D0 725 0. 200 37456951,- 1 22 131526 05 03/ 28/023 01: 3000. 971 0. 246 37 457044, 122131410 06 03/ 28/023 013091. 195 0. 224 37457029, - 122131433
TO man n14 O'* wn.. 0108 . 0001 0AayadtwMhyt: an, cal 86S2/ 4. WA// a * 1. 010. / 049144, * DA3 & mid 10. 0µ r4. All , IoM114, nMred. 8olSooll•>< 4, d the Shatq, 019 65000mpnwatnadmw, kaol Sml1dlNuNog', Inc.

PADS 2082
Figure 6. ShotSpotter Investigative Lead Summary ( ILS) SOUNDTHINKING. © 2023 10
DocuSign Envelope ID: 91046901- F02- 42D1- AB59- 55829995BEBB r`- ShotSpotter® Price Proposal for Pico Rivera, CA
Detailed Forensic Reports and Expert Witness Testimony
In nearly all the criminal proceedings in which our experts have been called to testify, SoundThinking has produced detailed, round - by -round analysis of the timing and location of the shots fired by one or more weapons. To the best of our knowledge, no other acoustic -based gunshot detection system has been accepted in a court of law as providing this kind of forensic evidence.
r`- ShotSpotter®
Detailed Forensic Report
oy: •- M
bow
I... on Om se JY1. 1
00101611 1014 PC R 14... 8
doted DEW II MO MO
Shooting Description
At 0708As 10208113 AM) hems . n Japery 23.018 sno4Spod r d. teded. Maapl.

Oo_ ot nadot n +. eta. shospoutt nmrd. dthe incident a Flee 10 01» s and located .. 177 0.. $t
Position with Respect to the Coverage Area
AO.. I - $ h0Ipae.r Carol* Are- l.plrys the sootsp, W aev. rad. n 1.. w M 1M tns el M a ekleet the fed dot ndloates the boated a the Waxing Ina0M.

P. I- dlostOtootar Caro,. Ono
ShotSpotter
Detailed Forensic Report
do- 1010 1fe

5..:
t•S a.e_, fMrsw
Munro'. tot it. MOW
Men dew NM. MI
8M -specific Acoustics
The detected audio wr. lain below. ww.. y represent the ecl0ent . 5 that was teacake' by, and downloaded heal Mame sensors Each sensor numb, . gbe . n the C. IGa.Id dll. Ke from tot sensor to the inddsnt location. ( CIO 8n speako icons to play the . ale keen poth sensor)
111
INDOMMW 14 P50, ot
rti
Figure 7. ShotSpotter Detailed Forensic Report (DFR)
SoundThinking data supports detailed forensic analysis of gunfire incidents, including:

Weapon type ( e.g., automatic vs. semi - automatic)
Number of rounds fired
Possibility of multiple shooters
Unlike the ILS, the DFR is a court -admissible document prepared by our forensic engineers.

The DFR is intended to be used by attorneys as part of a court case for the exact, verified timing, sequence and location of each shot fired. Secondarily, DFRs are available for use by law enforcement to obtain search warrants or to investigate Officer Involved Shootings. DFRs are SOUNDTHINKING' © 2023 11
DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB L
ShotSpotter® Price Proposal for Pico Rivera, CA
available upon written request, and our goal is to deliver all DFRs within ten business days of the request.

To support prosecutions, audio snippets provide powerful demonstrative evidence to prosecutors and allow jurors to gain a deeper understanding of the victims' experience of the incident. For prosecutors who wish to have a SoundThinking expert witness testify regarding a DFR, to help interpret and clarify crime scene activity derived from ShotSpotter data, or provide other forensic consultation services, these services are available for an hourly fee.

In 20 states and in the District of Columbia, SoundThinking evidence and SoundThinking expert witness testimony have been successfully admitted in over 200 court cases. ShotSpotter forensic evidence has prevailed in 25 Frye and Daubed challenges throughout the United States.

Notifications API ( Optional)
The Notifications API ( available as a separately priced option) allows client applications to receive accurate, timely details about ShotSpotter gunfire alerts, including precise latitude and longitude (geolocation), GPS- synchronized timestamps, incident audio, and situational context provided by the 24/ 7/ 365 Incident Review Center. Typical integrations include:

Video Management Systems ( VMS)
Computer -Aided Dispatch ( CAD) systems
Records Management Systems ( RMS)
Automated License Plate Readers (ALPRs)
Crime analysis and statistics packages ( including COMPSTAT software) Each Notifications API license pack is available for an annual subscription fee that includes:

Up to three ( 3) interfaces
Establishing an instance of the API for the LASD on SoundThinking- hosted servers Consulting with the LASD and third parties to ensure the API operates according to the API specifications
24/ 7 alerts to up to three third -party interfaces
Supporting the third party and LASD as systems are upgraded Additional API licenses can be purchased in packs of three interfaces. 1 SOUNDTHINKING' © 2023 12
DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB L
ShotSpotter®
Onboarding Services
Concurrent with the sensor design and deployment activities, SoundThinking will provide a series of onboarding services to prepare the LASD to maximize the value of the ShotSpotter service. These standard onboarding steps will be refined to best serve the LASD team and ShotSpotter users. SoundThinking onboarding services are designed to:

Ensure successful ShotSpotter service activation ( go -live) Ensure full use of the features and functions available with the ShotSpotter service Ensure that the LASD' s Best Practices are refined, as needed, to respond most effectively to the gun crime intelligence data being delivered for the coverage area Track and monitor the efficacy of the ShotSpotter service Price Proposal for Pico Rivera, CA
SoundThinking has assembled a Customer Success Team of professionals with more than 275 years of combined law enforcement experience. The mission of this team of Consultants, Trainers, and Analysts is to maximize customer success with the ShotSpotter service. This team is available to our customers both pre- and post -production to advise, train, and guide them on the most effective use of the tools and services available with the ShotSpotter solution. The following provides a high- level overview of SoundThinking' sstandard Customer Onboarding Services, which will be tailored to support the LASD.

Getting Started
Prior to contract execution, a SoundThinking Customer Success Director will work with the LASD' sproject team to plan the onboarding process, beginning with an onsite Customer Kick - Off Meeting with all stakeholders. The teams will review the program objectives, lay out the key implementation steps, agree on a targeted activation date ( go -live), and establish a protocol for ongoing communication throughout the onboarding process. SoundThinking will schedule biweekly status calls with the LASD' sProgram Manager and other project leaders to maintain regular communication throughout the implementation process.

Best Practices
Early in the Customer Onboarding Process, SoundThinking' s Customer Success team, led by
the assigned Customer Success Director, will work with the LASD' s Program Manager and other project leaders to schedule and conduct a series of Best Practices sessions. These sessions will assist the LASD in establishing response protocols and procedures to manage the gunshot alerts and gun crime intelligence data that will be provided upon activation of the ShotSpotter service. SoundThinking will customize and conduct these sessions for each of the following groups of users involved in the gun violence reduction program in the targeted coverage area:

Program Management
Dispatch/ Communications
Field Operations/ Patrol
Investigations
Prosecution
Intelligence & Crime Analysis
SOUNDTHINKING. © 2023 13
DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB ShotSpotter® Price Proposal for Pico Rivera, CA
User Training
SoundThinking will assign a Customer Success Director to the LASD to ensure that we deliver consistent, quality best practices training based on the LASD' s needs to maximize the value of our service. The Customer Success Director will remain engaged with the LASD for the duration of our relationship. In preparation for the planned cutovers, SoundThinking will assign a Trainer to the LASD to train each group of users on the SoundThinking applications, including ShotSpotter, Dispatch, Administrative Portal, and InSight. The Trainer will conduct a Training Orientation with the LASD' sProgram Manager to ensure all users are properly trained on the relevant applications. SoundThinking' sTrainer will work with the LASD to tailor a training program that addresses the unique needs and/ or scheduling constraints of the LASD users. The training will be performed through a combination of remote instructor - led live training, train -the - trainer, and on- line recorded computer -based training.

Agency Metrics/ KPIs (Key Performance Indicators)
Customer Success team members, led by the assigned Customer Success Director, will work with the LASD' sProgram Manager and Command staff to review, define, and adopt a set of agency metrics, or Key Performance Indicators ( KPIs), to establish and monitor the efficacy of the ShotSpotter service and related agency Best Practices. It is important to ensure that the agency and all stakeholders have visibility ( and routines in place) to track the program metrics or KPIs needed to monitor the status of the program and to make informed decisions regarding resources, response protocols, and the best practices to drive success.

Onsite Support During Service Activation ( Go -Live)
On the day of ShotSpotter service activation to a live production status, the Customer Success Director will be on site to ensure that the transition is smooth, that the established best practices are being implemented as planned, and that user questions are answered quickly. Prior to cutover, SoundThinking' steam will facilitate an introduction to the SoundThinking Support organization to review the support process and introduce the designated Technical Support Engineer to the LASD. Following service activation, the designated Technical Support Engineer will facilitate a series of Status Calls with the LASD to review the performance of the service.

The Customer Success Director will continue to work with the LASD to review and results being achieved by each group of users involved in the gun violence reduction program.

SOUNDTHINKING- © 2023 14
DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB ShotSpotter®
Ongoing Customer Support
Customers can use the monthly scorecard in the InSight app to communicate details on system performance and our service, including the number of Gunshot Alerts, Misses, Mislocated Incidents, Misclassified Incidents, and other useful metrics. A designated SoundThinking Technical Support Engineer reviews service requests and reported issues monthly and is available to discuss and address any concerns.

Price Proposal for Pico Rivera, CA
SoundThinking standard customer support includes 24/ 7 assistance with user accounts, software interface, tools, features, incident ( re) classification, and review. Tier 1 Support is provided by our Incident Review Center ( IRC). IRC staff have extensive experience with SoundThinking applications and provide real- time support of basic issues, and first level of support for information gathering and triage for advanced troubleshooting by Tier 2 Support.

The Tier 2 Support Team comprises technically advanced, experienced Customer Support professionals who are responsible for advanced levels of troubleshooting and analysis, IT support, mapping issues, etc.

Support Level Tier 1 Support (IRC) Tier 2 Support
Customer Support)
Features Login support
Report a misclassification
Report a missed incident
Report a mislocated incident
Basic audio request
General/ application questions
Request for ILS
Normal Support:

Analysis of missed gunshots
Detailed audio search
Performance analysis
Integration issues
Critical Support:

System outage
Hours of Operation 24/ 7/ 365 Normal Support: 5 am — 11 pm Pacific Time Zone
Escalation: 24/ 7/ 365
Customer References
SoundThinking has more than 150 customers covering over 1, 000 square miles. SoundThinking is the leader in the development and deployment of wide area acoustic gunshot detection and location systems. Today, SoundThinking provides gunshot detection and location services to law enforcement agencies across the country. Among these are:

Hawaiian Gardens, CA
Antioch, CA
Pasadena, CA
San Francisco, CA
Bakersfield, CA
Perris, CA
Riverside County Sheriff)
SOUNDTHINKING' © 2023
Oakland, CA
East Palo Alto, CA
San Pablo, CA
Richmond, CA
San Francisco, CA
Sacramento County, CA
Las Vegas, NV
Albuquerque, NM
Glendale, AZ
Denver, CO
Sacramento, CA
Rancho Cordova, CA
Sacramento Sheriff)
15 DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB or ShotSpotter®
Proposed Coverage Area
ShotSpotter is deployed to provide coverage for a specified area, bounded by a specific coverage area perimeter. SoundThinking will design the coverage area based upon the LASD' s requirements and based upon analysis of historical crime data. The area delineated by a blue boundary in the image below is a rough estimate of the proposed coverage area based on analysis of the LASD- provided crime data as described below; please note, the final coverage area may vary. SoundThinking will collaborate with LASD stakeholders to determine the final coverage boundaries and any resulting adjustments to the proposal to address the LASD' s needs and priorities.

Price Proposal for Pico Rivera, CA
IAa
g LA,
1: p
Yaason
ue
LASD Q572 ,
NO
t
9 LASD 057 w z.,, i
y. Ga 6
cd' t
SY R
5! P
wPf '
9 LASDMa1= A e,P,. , `
C,.• , vMorn m 4
e
Ib
i
ce' pF
b0'
i,, it
c'''''''',
6,1 > eeq. ge irs 4' a
s Les t
SY e
n •

1.,
a ,,,
a
a `
i
o y, ay • t. P
r? •
F < e'r i :.r
D
e °"
m
0,, : . ASD 1576
1 jai , p, Beas xm .
tot ' / a
m s,
e . ' t'R
m •, S,
11k,' g •

81. Ji ' a',,
4 O. • e," xes,
i
w. i ` Sha,,,
Aero q
s"'
eaa In al'
44 •.:
lbw4¢ b
0,.

O
R
F Sr '' a
I<
I
r
1'
F
1574 •
i
4 LAD 1580
Sip 1572
LASD 15721 ` 4
D1 4 j
5,=. n„, f`486), 1; 570
1579
SPY C
riots et
Beverly ai
Sources,
METI, Egli
Earl,
China:( Hong
HERE, WrArtiSGS
Kong), Ean Korea.

In* E
Esn (
HP. INCREMER1
Thailand), RGCCi
P44g, E*
lo)'
Cpe Sh* MMep Emtrlktere, NV the GIS User community
Figure 8. Proposed ShotSpotter Coverage Area = 1. 0 square mile Using the data provided by the LASD for January 1, 2021 through July 12, 2023, the map above depicts the preliminary coverage boundaries. The heat map in Figure 8: Proposed ShotSpotter Coverage Area depicts the following within the 1. 0 square mile coverage area (outlined in blue):

Icon Crime Type Definition Quantity Percentage of Totals Shots Heard ( Radio Code 923) 52 31. 7%
SOUNDTHINKING- © 2023 16
DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB ShotSpotter®
Pricing
ShotSpotter is deployed to provide coverage for a specified area. SoundThinking offers our Lower Tier Pricing program to smaller communities. This pricing includes a one- time Service Initiation and Onboarding fee, as well as a reduced subscription fee for coverage areas of up to two square miles. SoundThinking will locate the proposed one square mile coverage area based upon the LASD' srequirements. The pricing presented below assumes a simplified design for the proposed ShotSpotter coverage area, one that targets the City' s highest crime area( s), while avoiding a highly customized coverage area. SoundThinking will collaborate with LASD stakeholders to determine the final coverage area location and related boundaries.

Price Proposal for Pico Rivera, CA

1. 0 mi2 Coverage Area ( One Year Term)
Contract Term Coverage Area
Size
One -Time Fee
Service
Initiation &
Onboarding)
Annual
Subscription
Fee*
Total
1 Year 1. 0 mi2 Included

1. 0 mi2 Coverage Area ( Three Year Term)
49, 500 49, 500
Contract Term Coverage Area
Size
One -Time Fee
Service
Initiation &
Onboarding)
Annual
Subscription
Fee*
Total
3 Years 1. 0 mi2 Included 49, 500 $ 148, 500
The ShotSpotter current annual subscription fee for cities the size of City of Pico Rivera is $ 49, 500 per square mile.

Please note, this rate is available for coverage areas up to a total of two ( 2) square miles. Any coverage beyond two 2) square miles will be at SoundThinking' sstandard annual subscription rate of $ 70, 000 per square mile, plus a onetime Service Initiation Fee of $ 10, 000 per square mile.

Forensic Consultation Services
Forensic Consultation Service Fee ( Expert Witness Services) $ 350/ hour Expert Witness Testimony Services are available upon request and billed separately at the above rate.

Payment Terms
Payment for the service initiation, onboarding, and subscription shall be as follows:

One -Year Payment Terms
50% of fee due upon execution of agreement ($ 24, 750)
50% of fee due upon ShotSpotter service activation ( live) status ($ 24, 750) Three -Year Payment Terms
50% of fee due upon execution of agreement ($ 24, 750)
50% of fee due upon ShotSpotter service activation ( live) status ($ 24, 750) 100% of Year 2 fee due prior to first anniversary of ShotSpotter live status ($ 49, 500) 100% of Year 3 fee due prior to second anniversary of ShotSpotter live status ($ 49, 500) Expert Witness Testimony Services are available upon request and billed separately at the above rate.

SOUNDTHINKING- © 2023 17
DocuSign Envelope ID: 91046901- F02- 42D1- AB59- 55829995BEBB ShotSpotter® Price Proposal for Pico Rivera, CA
Pricing Assumptions
This pricing is submitted based on the following assumptions:

Services will be delivered under the terms of the SoundThinking Master Services Agreement and its Exhibits and Addenda, to which this Proposal will be attached as Exhibit A.

The LASD will provision network access to meet SoundThinking minimum specifications and requirements for all computers ( PCs and MDCs) that will access the ShotSpotter service.

This pricing does not include any state or local taxes; if taxes are applicable, we will be happy to provide an amended price quotation upon request.

This proposal and all pricing contained herein remains valid for ninety ( 90) days from the date of this proposal.

Optional Additional Services
Notifications API Annual Subscription Fee
Contract Term
Notifications API License
Pack Annual Subscription Fee
Total
1 Year 9, 500 9, 500
Contract Term
Notifications API License
Pack Annual Subscription Fee
Total
3 Years 9, 500 28, 500
Notifications API Pricing Assumptions
The services will be delivered under the terms of the SoundThinking Master Services Agreement to which this Proposal will be attached as Exhibit A ( sample attached).

The optional Notifications API License is a
recurring annual subscription fee which
includes up to three interfaces. Fee does not include costs required from other vendors to implement or support the planned interfaces.

SOUNDTHINKING. © 2023 18
DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB L
ShotSpotter® MASTER SERVICES AGREEMENT ADDENDUM ONE
SHOTSPOTTER® SUPPLEMENTAL TERMS I Page 1 of 10
ADDENDUM ONE - SHOTSPOTTER® SUPPLEMENTAL TERMS
This Addendum One ("Addendum One") to the SoundThinking TM, Inc. Master Services Agreement the " Agreement") by and between SoundThinking, Inc. ("SoundThinking") and City of Pico Rivera, a California municipal corporation (" Customer") is effective as of the last date of signature below.

The following provisions are expressly added to and made a part of the Agreement for the purposes of further defining the ShotSpotter® Subscription Services and terms of use. All terms and conditions of the Agreement shall remain in full force and effect. In the event of a conflict between this Addendum One and the Agreement, this Addendum One shall control:

In consideration of the Parties' mutual covenants and promises set forth in this Addendum One, the Parties Agree as follows:

Section 2 DEFINITIONS
ShotSpotter
Insight means the internet portal to which Customer will have access to Reviewed Alerts with respect to the ShotSpotter® Gunshot Detection, Location, and Forensics System.

Coverage Area means the area in square miles covered by the ShotSpotter Services as set forth in Exhibit A and increase to the Coverage Area as agreed to in writing between the Parties.

Reviewed Alerts means the data reviewed by SoundThinking' sincident review staff related to gunfire incidents detected by the ShotSpotter Gunshot Detection, Location, and Forensic Analysis Service.

Section 3 SUBSCRIPTION SERVICES
ShotSpotter
B. SoundThinking will install the ShotSpotter System in the Coverage Area specified in Exhibit A attached to the Agreement. SoundThinking will host the Subscription Services and may update the functionality and Software of the Subscription Services from time to time at its sole discretion and in accordance with the Agreement and this Addendum One.

C. SoundThinking will be responsible for determining the location( s) for installation of acoustic sensor( s) ( the " Sensors") that detect gunshot - like sounds, and obtaining permission from the premises owner/ property manager/ lessee. SoundThinking owns, and is responsible for maintenance of the Sensors.

D. The ShotSpotter System acoustic Sensor may use wired, wireless, or cellular wireless communications which necessitates the existence of a real- time data communications channel from each Sensor to the SoundThinking hosted servers via a commercial carrier.

Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States DocuSign Envelope ID: 91046901- F02- 42D1- AB59- 55829995BEBB ShotSpotter® MASTER SERVICES AGREEMENT ADDENDUM ONE
SHOTSPOTTER® SUPPLEMENTAL TERMS I Page 2 of 10
The unavailability or deterioration of the quality of such wired, wireless, or wireless cellular communications may impact the ability of SoundThinking to provide the Subscription Services. In such circumstances SoundThinking will use commercially reasonable efforts to obtain alternate wired or wireless cellular communications or adjust the coverage area as necessary. In the event SoundThinking is unable to do so, SoundThinking will terminate the ShotSpotter Subscription Services and refund a pro -rata portion of the annual Subscription Services fee to Customer.

E. SoundThinking will provide Customer with user documentation, online help, written or recorded video training material, and other applicable documentation ( as available).

F. SoundThinking will provide reasonable efforts to respond via email to requests for support relating to incident classification as defined in the Support Level Matrix provided at Attachment A.

G. During the term of the Agreement, SoundThinking will provide real- time gunfire analysis and alert services. After an explosive ( or impulsive) sound triggers enough Sensors that an
Incident
incident
Review
is detected
Center (
and
IRC)
located,
via secure,
audio
high- speed
from the incident
network
is
connections
sent to SoundThinking' s
for real- time
qualification. Within seconds, a SoundThinking professional reviewer analyzes audio data and recordings to confirm gunfire or explosions. The qualified alert is then sent directly to the Customer' sdispatch center, PSAP, mobile/ patrol officers, and any other relevant safety or security personnel, as determined by the Customer. The SoundThinking IRC will review gunfire incidents as further defined in Attachment A to this Addendum One.

H. The ShotSpotter Subscription Services shall consist of (i) providing access to the Customer of Reviewed Alerts delivered via the Insight password -protected internet portal and user interface supplied by SoundThinking; ( ii) providing Customer access to historical Reviewed Alerts and incident information via the ShotSpotter Software; and ( iii) other services as specified in the Agreement and its Exhibits or this Addendum One.

I. SoundThinking will use commercially reasonable efforts to respond to support requests as set forth in the Support Level Matrix provided at Attachment A to this Addendum One.

These requests may be made to SoundThinking through one of the following methods: 1) email to supportc( soundthinkinq. com; 2) Live Chat through the ShotSpotter Subscription Services applications: 3) A phone call to SoundThinking' s Customer Support organization
at 888. 274. 6877, option 4. These are the only methods SoundThinking will receive and respond to support requests.

Tier 1 ( as defined in the Support Matrix included at Attachment A). A SoundThinking Customer Support specialist will be responsible for receiving Customer reports of missed incidents, or errors in the Subscription Services, and, to the extent practicable over email or telephone, making commercially reasonable efforts to assist the Customer in resolving the Customer' sreported problems. In the event the problem cannot be resolved within 24 hours, requiring further research and troubleshooting, SoundThinking will use commercially reasonable efforts to resolve the issue within seventy- two (72) hours of Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States DocuSign Envelope ID: 9104B901 - F002 -42D 1- AB59- 55829995BEBB L
ShotSpotter MASTER SERVICES AGREEMENT ADDENDUM ONE
SHOTSPOTTER® SUPPLEMENTAL TERMS I Page 3 of 10
receipt of the report. In the event that the ShotSpotter Subscription Service is fully nonfunctional, and it is not due to power outage or other reasons that are outside of SoundThinking' scontrol, SoundThinking will work continuously to restore functionality of the Subscription Services in accordance with the standard ShotSpotter user documentation provided with the Subscription Services as soon as reasonably possible, and no later than seventy- two (72) hours of receipt of the report.

J. FORENSIC REPORTS.

Investigative Lead Summary (" ILS"). SoundThinking provides an on -demand report available through the ShotSpotter Respond Application. The Investigative Lead Summary ( ILS) provides useful details about the approximate location, timing, and sequence of each shot fired during an incident. The ILS is very valuable on scene, helping law enforcement find shell casings, confirm witness accounts, and identify suspects. ILS reports are available immediately after an incident occurs via the mobile, web, or desktop ShotSpotter Respond application ( machine -generated). The ILS is not a court -admissible document.
ii. Detailed Forensic Report (" DFR"). If requested by Customer, SoundThinking will provide a DFR for any ShotSpotter- detected incidents, including Reviewed Alerts. The DFR is intended to be a court -admissible document used by attorneys as part of a court case for the exact, verified timing, sequence and location of each shot fired. Secondarily, the DFR is available for use by law enforcement to obtain a search warrant or to investigate an Officer Involved Shooting.

DFRs must be requested in writing and addressed to the SoundThinking Customer Support Department. Requests may be submitted via the Forensics Services page under the Law Enforcement tab on SoundThinking' s
website
www. soundthinking. com). SoundThinking will use commercially reasonable efforts to provide a DFR within ten ( 10) business days of receipt of the request.

K. EXPERT WITNESS SERVICES.

SoundThinking offers reasonable expert witness services, including Reviewed Alerts, for an hourly fee as set forth in Exhibit A of the Agreement, as well as reimbursement of all travel and per diem costs. If requested to provide such services, SoundThinking will invoice the Customer for the number of hours expended to prepare for and provide expert witness testimony, and actual travel expenses, upon completion of the services. Customer understands that SoundThinking undertakes to provide individuals whose qualifications are sufficient for such services, but does not warrant that any person or his or her opinion will be accepted by every court. SoundThinking requires at least fourteen ( 14) days prior notice of such a requirement in writing from the Customer. Customer must include dates, times, specific locations, and a point of contact for SoundThinking personnel. Due to the nature of legal proceedings, SoundThinking cannot guarantee that its services described in this section shall produce the outcome, legal or otherwise, which Customer desires. Payment for expert witness services described shall be due and payable when services are rendered regardless of the outcome of the proceedings.

Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States DocuSign Envelope ID: 91046901- F02- 42D1- AB59- 55829995BEBB L
ShotSpotter MASTER SERVICES AGREEMENT ADDENDUM ONE
SHOTSPOTTER® SUPPLEMENTAL TERMS I Page 4 of 10
Section 5 LICENSE AND OWNERSHIP
ShotSpotter Data
A. Rights in Data.

SoundThinking shall own and have the unrestricted right to use the ShotSpotter Data, as that term is defined in the Agreement, for internal purposes such as research or product development. SoundThinking may provide, license, or sell the ShotSpotter Data on an aggregated basis to third parties ( excluding press or media) to be used for research or analytical purposes, or for law enforcement and/ or security purposes.

SoundThinking will not release or disseminate to any person or entity ShotSpotter Data related to or consisting of specific forensic or law enforcement sensitive incident information pertaining to any active inquiry, investigation, or prosecution, unless in response to a valid order or subpoena issued by a court or other governmental body, or as otherwise required by law. SoundThinking will not release, sell, license, or otherwise distribute the gunfire alert ShotSpotter Data to the press or media without the prior express written consent of an authorized representative of the Customer.

Customer shall have the unrestricted right to download, make copies of, distribute, and use the ShotSpotter Data within its own organization, exclusively for its own internal purposes, and for purposes of detecting and locating gunfire, routine archival recordkeeping, evidence preservation, and investigative, or evidentiary, and prosecutorial purposes, and for community engagement and community services initiatives. Customer shall not provide to, license the use of, or sell the ShotSpotter Data to any third parties, which restriction will not pertain to the collaboration with other law enforcement agencies for the purposes of investigating and prosecuting crimes detected by the ShotSpotter Subscription Service; (ii) government or non -governmental entities focused on the support of victims of gun crime in the local community; or ( iii) entities focused on local community outreach and/ or violence intervention.

Section 6 CONFIDENTIALITY AND PROPRIETARY RIGHTS
SoundThinking Privacy Policy
A. SoundThinking Privacy Policy.

With respect to the ShotSpotter Subscription Services, SoundThinking has structured its technology, processes and policies in such a way as to minimize the risk of privacy infringements from audio surveillance while still delivering important public safety benefits to its customers. These efforts to maintain privacy include the following:
1) SoundThinking will not provide extended audio to customers beyond the audio snippet ( 1 second of ambient noise prior to a gunshot, the gunshot audio itself, Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States DocuSign Envelope ID: 91046901- F02- 42D1- AB59- 55829995BE8B L
ShotSpotter® MASTER SERVICES AGREEMENT ADDENDUM ONE
SHOTSPOTTER® SUPPLEMENTAL TERMS I Page 5 of 10
and 1 second after the incident). SoundThinking will vigorously resist any subpoena or court order for extended audio that goes beyond an audio snippet.
2) SoundThinking will not provide a list or database of the precise location of Sensors to police or the public if requested and will challenge any subpoenas for this location data.

Section 7 LIMITED WARRANTIES
ShotSpotter Subscription Services and Software Additional Limited Warranties and Disclaimers
A. The ShotSpotter Subscription Services are not designed, sold, or intended to be used to detect, intercept, transmit, or record oral or other communications of any kind.

SoundThinking cannot control how the ShotSpotter Subscription Services are used, and, accordingly, SoundThinking does not warrant or represent, expressly or implicitly, that use of the ShotSpotter Subscription Services will comply or conform to the requirements of federal, state, or local statutes, ordinances, and laws, or that use of the ShotSpotter Subscription Services will not violate the privacy rights of third parties. Customer shall be solely responsible for using the ShotSpotter Subscription Services in full compliance with applicable law and the rights of third persons.

B. SoundThinking does not warrant or represent, expressly or implicitly, that the ShotSpotter System or its use will: result in the prediction or prevention of crime, apprehension or conviction of any perpetrator of any crime, or detection of any criminal; prevent any loss, death, injury, or damage to property due to any reason including the discharge of a firearm or other weapon; or in all cases result in a Reviewed Alert for all firearm discharges within the designated coverage area; or that the ShotSpotter- supplied network will remain in operation at all times or under all conditions.

C. SoundThinking expressly disclaims, and does not undertake or assume any duty, obligation, or responsibility for any decisions, actions, reactions, responses, failure to act, or inaction, by Customer as a result of or in reliance on, in whole or in part, the ShotSpotter Subscription Services, or Reviewed Alerts provided by SoundThinking, or for any consequences or outcomes, including any death, injury, or loss or damage to any property, arising from or caused by any such decisions, actions, reactions, responses, failure to act, or inaction. It shall be the sole and exclusive responsibility of the Customer to determine appropriate decisions, actions, reactions, or responses, including whether or not to dispatch emergency responder resources. The Customer hereby expressly assumes all risks and liability associated with any and all action, reaction, response, and dispatch decisions, and for all consequences and outcomes arising from or caused by any decisions made or not made by the Customer in reliance, in whole or in part, on the ShotSpotter Subscription Services provided by SoundThinking, including any death, injury, or loss or damage to any property.

Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States DocuSign Envelope ID. 9104B901- F02- 42D1- AB59- 55829995BEBB ShotSpotter

MASTER SERVICES AGREEMENT ADDENDUM ONE
SHOTSPOTTER` SUPPLEMENTAL TERMS I Page 6 of 10
EXCEPT AS EXPRESSLY SET FORTH IN SECTION 7 OF THE AGREEMENT AND THIS

ADDENDUM ONE, SOUNDTHINKING MAKES AND CUSTOMER RECEIVES NO OTHER

WARRANTIES, EXPRESS OR IMPLIED, INCLUDING WITHOUT LIMITATION ANY

WARRANTIES OF NON -INFRINGEMENT, QUALITY, SUITABLITY, MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE.

THE PARTIES HERETO HAVE EXECUTED THIS ADDENDUM ONE
CONTEMPORANEOUSLY WITH THE AGREEMENT.

CITY OF PICO RIVERA
r—DocuSigned by:

Stmt- C zkYvvOln a.

CC6CB5FBF10E48F_.

Accepted By (Signature)
Steve Carmona
Printed Name
City Manager
Title
10/ 30/ 2023
Date
Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States SOUNDTHINKING, INC.

DocuSigned by:

JKozavvn. o .4(~2
5A2E233158^. 4FE...

Accepted By ( Signature)
Roxanne Lerner
Printed Name
Director of Contracts
Title
10/ 30/ 2023
Date
DocuSign Envelope ID: 91046901- F02- 42D1- AB59- 55829995BEBB L
ShotSpotter®
Summary

MASTER SERVICES AGREEMENT ADDENDUM ONE
SHOTSPOTTER® SUPPLEMENTAL TERMS I Page 7 of 10
ATTACHMENT A — SERVICE LEVEL AGREEMENT
ShotSpotter® Gunshot Detection, Location System
Reviewed Alert Service Levels
Under the terms and conditions of the SoundThinking Master Services Agreement and this Addendum One between SoundThinking, Inc. ("SoundThinking") and Customer, SoundThinking commits to meet or exceed the following Service Level Agreement ( SLA) standards as it provides its ShotSpotter Gunshot Location Services':

Service SLA and Measurement
Gunshot Detection
Location
90% of unsuppressed, outdoor gunfire incidents, using standard, commercially available rounds greater than . 25 caliber, inside the Coverage Area will be detected and located within 25 meters of the actual gunshot location.

Reviewed Alerts 90% of gunshot incidents will be reviewed and published in less than 60 seconds.

Service Availability The ShotSpotter Gunshot Location System service will be available to the Customer 99.% of the time with online access to ShotSpotter data, excluding scheduled maintenance windows.

Gunshot Detection & Location Performance
The ShotSpotter System will detect and accurately locate to within 25 meters of the actual gunshot location 90% of unsuppressed, outdoor gunshots fired inside the contracted coverage area using standard, commercially available rounds greater than . 25 caliber.

Reviewed Alerts Service
SoundThinking' sreal- time Incident Review Center ( IRC) will review at least 90% of all gunfire incidents within 60 seconds. This human review is intended to confirm or change the machine classification of the incident type, and, depending on the reviewer' sconfidence level that the incident is or may be gunfire, will result in an alert (" Reviewed Alert") sent to the Customer' sdispatch center, patrol car mobile data terminals MDT), and officer smartphones ( via the ShotSpotter App), based on the following criteria:

Incident Type Action
High confidence incident is gunfire Reviewed Gunfire Alert, (Single Gunshot "SG" or Multiple Gunshots " MG") sent to Customer' s
dispatch center, patrol car mobile data terminals
MDT), and officer smartphones ( via the
ShotSpotter Respond App)
Uncertain if incident is gunfire or not Reviewed Probable Gunfire (" PG") Alert sent to Customer' sdispatch center, patrol car MDTs, and
officer smartphones
Low confidence incident is gunfire No alert will be sent; incident available for Customer review in the incident history available
through Insight
1 See attached " ShotSpotter — Definition of Key Terms" for a complete definition of terms associated with this SLA and further details in the expanded definitions listed below the Summary. The basis for this SLA and performance measurement will be total gunshot incidents as defined by the Definition of Key Terms.

Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB L
ShotSpotter MASTER SERVICES AGREEMENT ADDENDUM ONE
SHOTSPOTTER® SUPPLEMENTAL TERMS j Page 8 of 10
Reviewed Alerts are sent to the Customer' sdispatch center, patrol car MDTs, and officer smartphones.

Information in a Reviewed Alert will include the following:

Dot on the map" with latitude and longitude indicating the location of the incident.

Parcel address closest to location of the incident.

When available, additional situational awareness data points may be included, such as:
o Qualitative data on the type/ severity of incident: Fully automatic, High Capacity o Other comments ( if any)
The ShotSpotter Respond App, and Insight provide the Customer with full and immediate access to incident history including information SoundThinking uses in its internal review process. This information includes, among other things, the initial incident classification and any reclassifications of an incident, incident audio wave forms, and incident audio files. This data access is available as long as the Customer is under active subscription.

Service Availability
The ShotSpotter System' will be able to detect gunfire and available to users with online access to ShotSpotter data 99.% of the time, on a 24x7 by 365 day per year basis, excluding: a) scheduled maintenance periods which will be announced to Customer in advance; b) select holidays; and c) third party network outages beyond SoundThinking' scontrol.

Customer SLA Credits
Each Service Level measurement shall be determined quarterly, the results of which will be reviewed during the periodic account review meetings with Customer. For each calendar quarter that SoundThinking does not meet at least two of the three above standards, a fee reduction representing one free week of service for the affected Coverage Area) for each missed quarter shall be included during a future Customer renewal.

Service Level Exclusions and Modifications
SoundThinking takes commercially reasonable efforts to maintain Service Levels at all times. However, Service Level performance during New Year' sEve and Independence Day and the 48 -hour periods before and after these holidays, are specifically excluded from Service Level standards. During these excluded periods, because of the large amount of fireworks activity, SoundThinking uses fireworks suppression techniques3.
2 ShotSpotter Subscription Service includes all database, applications, and communications services hosted by SoundThinking, Inc. at our data center and specifically exclude Customer' sinternal network or systems or 3rd party communications networks, e.g. Verizon, AT& T, Sprint/ T- Mobile, or Customer' sInternet Service Provider. 3 SoundThinking will put the ShotSpotter System into " fireworks suppression mode" during this period in order to reduce the non - gunfire incidents required for human classification. SoundThinking will formally inform the Customer prior to the System being placed in fireworks suppression mode and when the mode is disabled. While in fireworks suppression mode, the incident alerts determined to be fireworks are not sent to the reviewer nor the Customer dispatch center, patrol car MDTs, and officer smartphones; however, these non - gunfire incidents will continue to be stored in the database for use if required at a later time.

Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States DocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB ShotSpotter

MASTER SERVICES AGREEMENT ADDENDUM ONE
SHOTSPOTTER® SUPPLEMENTAL TERMS I Page 9 of 10
The SoundThinking sensors send incident information to the SoundThinking cloud via third party cellular, wireless or wired networks. SoundThinking is not responsible for outages on the third -party networks.

Service Failure Notification
Should SoundThinking identify any condition ( disruption, degradation or failure of network, cloud, servers, sensors etc.) that impacts SoundThinking' sability to meet the Gunshot Detection & Location standard above), SoundThinking will proactively notify the Customer with: a) a brief explanation of the condition; b) how the Customer' sservice is affected; and c) the approximate timeframe for resolution. SoundThinking will also notify the Customer once any such condition is resolved.

Customer Responsibilities
The purpose of the Reviewed Alert service is to provide incident data to the Customer, reviewed, analyzed and classified in the manner described above. However, it is the sole responsibility of the Customer to interpret the data provided, and to determine any appropriate follow- up reaction or response, including whether or not to dispatch emergency responder resources based on a Reviewed Alert. SoundThinking does not assume any obligation, duty or responsibility for reaction, response, or dispatch decisions, which are solely and exclusively the responsibility of Customer, or for the consequences or outcomes of any decisions made or not made by the Customer in reliance, in whole or in part, on any services provided by SoundThinking.

Customer must inform SoundThinking when Verified Incidents of gunfire are missed by the ShotSpotter System in order to properly calculate Performance Rate, as defined below.

Customer is responsible for providing any required workstations, mobile devices and internet access for the Customer' sdispatch center, patrol car MDTs, and officer smartphones, or Insight.

Support Level Matrix
Support Level Tier 1 Support (IRC) Tier 2 Support
Customer Support)
Features
Hours of Operation
Login support
Report a misclassification
Report a missed incident
Report a mislocated incident
Basic audio request
General/ application questions
Request for ILS
24x7x365
Normal Support:

Analysis of missed gunshots
Detailed audio search
Performance analysis
Integration issues
Critical Support:

System outage
Normal Support: 5 am — 11 pm
Pacific Time Zone
Escalation: 24x7x365
Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States iDocuSign Envelope ID: 9104B901- F02- 42D1- AB59- 55829995BEBB L
ShotSpotter

MASTER SERVICES AGREEMENT ADDENDUM ONE
SHOTSPOTTER® SUPPLEMENTAL TERMS I Page 10 of 10
ShotSpotter — Definition of Key Terms
The ShotSpotter System will provide data for correct detection and accurate location for ninety percent 90%) of detectable ( outdoor, unsuppressed) community gunfire which occurs within a coverage area, the
Coverage Area", provided the measurement is Statistically Significant, as defined below. This performance rate shall be calculated as a percentage as follows:

NumberAccuratelyLocated
Performance Rate =
NumberAccuratelyLocated + NumberNotDetected + NumberMislocated) where the " Performance Rate" is a number expressed as a percentage, " NumberAccuratelyLocated" is the number of "Gunfire Incidents" occurring within the Coverage Area during the specified period for which the ShotSpotter System produced an Accurate Location, NumberMislocated is the number of Verified Incidents ( a " Verified Incident" is an incident where Customer has physical or other credible evidence that gunfire took place) for which the ShotSpotter System produced an inaccurate location ( i.e., a Mislocated Incident), and NumberNotDetected is the number of Verified Incidents for which the ShotSpotter System failed to report a location at all ( i.e., Missed Incidents).

An " Accurate Location" shall mean an incident located by the ShotSpotter System to a latitude/ longitude coordinate that lies within a 25 -meter radius of the confirmed shooter' slocation ( 25 meters = approximately 82 feet). "Detectable Gunfire" incidents are unsuppressed discharges of ballistic firearms which occur fully outdoors in free space ( i.e. not in doorways, vestibules, windows, vehicles, etc.) using standard commercially available rounds of caliber greater than . 25.

ShotSpotter Review Period is measured as the period commencing when the Incident Review Center ( IRC) receives the alert and the first audio download to the time it is published to the customer.

ShotSpotter System performance is guaranteed after a " Statistically Significant" set of incidents has been detected in accordance with timeframes set forth herein and following DQV and commercial system acceptance. The ShotSpotter System is designed to detect gunfire which is typically well distributed throughout the Coverage Area; however, performance should not be construed to mean that 90% of gunfire fired at any given location within the Coverage Area will be detected and located within the guaranteed accuracy.

The ShotSpotter System is not a " point protection" system and is therefore not designed to consistently detect gunfire at every single location within the Coverage Area, but rather to Accurately Locate 90% of the Detectable Incidents in aggregate throughout the entire Coverage Area. There may be certain locations within the Coverage Area where obstacles and ambient noise impede and/ or overshadow the propagation of acoustic energy such that locating the origin at those positions is inconsistent or impossible. The Performance Rate calculation is thus specifically tied to the Community Gunfire across the entire Coverage Area.

Statistically Significant shall be defined as measurements and calculations which shall be performed as follows: (a) Across an entire Coverage Area; (b) Aggregating over a period of at least 30 days under weather conditions seasonally normal for the area; and ( c) Provided that the total number of gunfire incidents being counted is equal to or greater than: (i) thirty ( 30) incidents for systems of up to three ( 3) square miles of Coverage Area, or ( ii) ten ( 10) incidents multiplied by the number of square miles of Coverage Area for systems where one or more Coverage Areas are three (3) square miles or larger.

Copyright © 2023 SoundThinking, Inc. — Confidential
All rights reserved under the copyright laws of the United States ENCLOSURE 2

SOUNDTHINKING
To whom it may concern:

Please accept this letter as information that SoundThinking, Inc. (formerly ShotSpotter, Inc.) is the worldwide sole source vendor of ShotSpottere, a wide - area Gunshot Detection, Location, and Forensic Analysis Service.

This wide -area service uses acoustic sensing technology protected by 40 unique and current patents to identify, discriminate, record, and locate gunshots, then send an alert to law enforcement within seconds of the shots being fired. The sensing is accomplished via multiple networked acoustic sensors deployed over a wide area that communicate registered gunshot activity back to a central server.

There is currently only one wide - area gunshot detection and location system available commercially for law enforcement and it is exclusively offered by SoundThinking. SoundThinking is the exclusive provider of ShotSpotter, the cloud - based, subscription managed service offering which includes warranty, repair, maintenance, and support services on all of its systems.

We have been informed that your agency has determined that for such a solution to be beneficial it must have the capabilities listed in this document. SoundThinking is the only vendor in the world able to deliver these capabilities. Many of these capabilities and techniques are the exclusive intellectual property of SoundThinking; are patented; and can only be provided by SoundThinking and licensed to end users:

Detects a gunshot in a public place and provides the location of the event ( address) and geographical coordinates of the event back to your agency through a qualified reviewed alert and plot the event on a map.

Provides a short audio snippet of the event for immediate playback.

Provides the ability to record the event and save all corresponding information in a hosted Microsoft SQL database so it can be forensically examined later. All incident data, including audio snippets, are stored on a secure, hosted server for the duration of the subscription.

The system and the associated 24/ 7/ 365 incident review service distinguish between a gunshot and other similar sounds (fireworks, car backfiring, etc.) and classify these events for a web - based display.

Acoustic sensors are certified to withstand harsh wind and other demanding climate conditions reducing the need for constant maintenance.

The system has a proven track record of real - world performance in deployment areas equal to or greater than 1 square mile.

The system timestamps individual gunshots to 100th of a second using a GPS clock.

The system can recreate crime scenes ( e.g., provide locations where individual shots occurred, time - stamping when each individual shot was fired within 100th of a second, and the audio snippet and acoustic waveform signature of the shots).

The system' s data output, including detailed forensic reports, are court certifiable with current case law supporting its use as forensic evidence.

SoundThinking Inc. soundthinking. com 39300 Civic Center Dr, Suite 300, Fremont, California 94538, US
11b
Ability to network acoustic sensors together in a Wide Area Network utilizing public wireless/ cellular carriers.

The system has a documented, proven track record of helping to reduce gun - related crimes, assisting in arrests and the confiscation of weapons; used as evidence in court and assisting in the prosecution and conviction of criminals in the areas where the system is deployed.

Interfaces with networked video surveillance cameras for automated control when an event is detected.

Wide -Area Acoustic Surveillance
ShotSpotter uses nondescript acoustic sensors deployed over wide areas (e.g., from one -to -many square miles).

Acoustic analytics classify incoming potential incidents as either gunfire, or other loud sounds not classified as gunfire. The result is gunfire alerts that include a pinpoint location that reveal incident severity and situational intelligence. Through its patented technology' and methods, only SoundThinking can deploy systems requiring a relatively small number of acoustic sensors to achieve a blanket of coverage over wide areas; fewer sensors result in lower procurement and operating costs.

Incident Review Center
ShotSpotter acoustic arrays detect and locate gunshot activity within the coverage area and report that information to SoundThinking' sIncident Review Center (IRC) which is staffed 24/ 7/ 365. ShotSpotter uses a two - factor incident review process to minimize false alerts. The first tier is performed by sophisticated Al software, to filter out any incidents that do not meet the minimum threshold for human review as potential gunfire incidents e.g., helicopter noise, fireworks, etc.). The incidents that meet the minimum threshold for human review are then received at our IRC. The IRC review process is performed by a team of highly trained acoustic experts. In addition to examining the incident audio, SoundThinking' sacoustic experts also examine the visual characteristics of the detected pulses and the incident, such as the number of participating sensors, the wave form, pulse alignment, and the direction of sound. The IRC review results in either publishing ( Gunshot or Probable Gunshot) or dismissal ( Non -Gunshot) of the incident with a high level of precision.

If the reviewer classifies the incident as a gunshot, the reviewer sends an alert, including location information and an audio snippet, to law enforcement agencies via a password - protected application on a mobile phone, in - car laptop, or computer. In addition to the dot -on - the - map and audio, ShotSpotter provides details such as number of shots fired, whether multiple shooters were involved, and whether high -capacity and/ orfully automatic weapons were used. SoundThinking designed this entire process ( i.e., recording the impulsive sound, two -factor review, and publishing alerts to authorized users) to be completed in less than 60 seconds ( but is often completed within 25 to 30 seconds).
1 The most current list of patents is available online at: httpi/ www. soundthinking. com/ patents SoundThinking 2023 2
ShotSpotter customers receive a contextually rich, detailed gunfire alert that enables a fast, precise, and safer response to gunfire incidents. In addition, ShotSpotter alerts can also trigger other technology platforms such as cameras that can pan and zoom in the direction of an event.

Situational Intelligence and Forensic Data
The ShotSpotter service includes the web - based ShotSpotter and InSightTM applications which run on any standard browser - based platform. ShotSpotter is also available as a smartphone application which runs on Android and iOS platforms. Incidents are shown as dots on an aerial map image along with the corresponding street address. Maps can also be viewed using Google Street View. Audio snippets are available to field - based commanders as well as responders. The audio snippet provides invaluable situational intelligence while en route to a scene, stationary in a command van, moving in patrol vehicles, or airborne in helicopters.

The ShotSpotter solution captures and stores a precise timestamp plus GPS coordinate for each detected incident and each round of a multi - round gunfire incident. This level of detail has successfully been used in investigations and courtrooms to exonerate contentious officer -involved shootings, corroborate testimony, refute false testimony, and prove the presence of multiple shooters in the absence of physical evidence and/ or eyewitnesses.

The ShotSpotter service offers the following unique forensic and intelligence data that enhance situational awareness, investigations, and prosecutions:

Audio snippets of each incident from multiple sources that can be embedded into a portable document format ( PDF) for sharing with agents, prosecutors, and presentation in court Ability to know if the incident involved a single round or multiple rounds of gunfire Ability to determine if the incident involved one or multiple shooters Ability to infer type( s) of firearm( s) involved in gunfire incidents Data for Investigative Follow- up, Crime Analysis, CompStat Only SoundThinking offers persistent storage of detailed incident information plus reports and analytics to support CompStat and violence suppression operations. ShotSpotter logs every detected incident and associated data in a database for secure and persistent storage. This data can be mined and analyzed to reveal patterns and trends to successfully drive intelligence - based tactical and strategic operations. Standard reports and an industry standard Structured Query Language ( SQL) database feed ongoing intelligence with a comprehensive awareness of what is transpiring within specific areas. This data allows agencies to proactively and effectively apply resources when and where they' r most needed; justify specific increases in assets and resources; and save costs. Securely stored incident data is invaluable for forensic purposes to support investigative efforts and fortify prosecution cases, especially when complemented with ShotSpotter acoustic and gunfire specialists providing expert testimony. SoundThinking is the only company which can aggregate gunfire data from over 135 U. S. cities and over 1, 000 square miles of coverage to develop a national gunfire index to identify national trends of gunfire behavior.

SoundThinking 2023 3
Open API for Interfacing with Complementary Systems and Technologies Only SoundThinking includes a simple and open data networking API for interfacing with video surveillance systems, Common Operating Picture systems, and Computer Aided Dispatch ( CAD).

Unique Level of Experience and Customer Support
The ShotSpotter gunshot detection, location, and forensic analysis service is the only system of its type to be successfully deployed since 1995 to leading law enforcement agencies across the US, as well as other federal agencies. Many customers have directly attributed the following results to the use of ShotSpotter:

Significant reduction of gun related crimes
Significant reduction of overall and random gunfire
Increased number of arrests and gun confiscations
Conviction of criminals with data available from ShotSpotter Conclusion
No vendor other than SoundThinking possesses the comprehensive, field -proven, and patent - protected product offering, as well as the professional services and support, domain knowledge, expertise, longevity, and customer references. Only SoundThinking can provide a true wide -area gunshot detection, location, and forensic analysis solution, as well as future expansions and ongoing maintenance and support. We have achieved sole source status in every state we operate in.

Based on all of the above factors, the overwhelming majority of our customers have been able to proceed with confidence in sole sourcing our wide -area gunshot location solution and support services.

We are honored to support your efforts to combat gun related crimes and appreciate the opportunity to serve you. If we can answer any questions or provide additional support information, please let us know.

Sincerely,
Ralph Clark
President / CEO
SoundThinking, Inc.

Phone: 510- 794- 3158
rclark@soundthinking. com
SoundThinking 2023 4
To: Mayor and City Council
From: City Manager
Meeting Date: January 28, 2025
Subject: SECOND QUARTER TREASURER’S REPORT AND THE

MONTHLY INVESTMENT TRANSACTION REPORT AS OF
DECEMBER 31, 2024 – FISCAL YEAR 2024-2025
Recommendation:

1. Receive and file the Treasurer’s Report for the quarter ending December 31, 2024, which represents balances and activities for the second quarter (October through December) of the 2024-25 fiscal year; and

2. Receive and file the Treasurer’s Monthly Investment Transaction Report as of December 31, 2024.

Fiscal Impact:

There is no fiscal impact to the General Fund from this item. On a quarterly basis, the Administrative Services Department staff allocates the appropriate interest income to the various funds. This shows as revenues to the respective funds.

Discussion:

The Treasurer's Report (Enclosure 1) provides a synopsis of cash and investment activity for the City of Pico Rivera’s (City) cash and investment portfolio for the fiscal year (FY) 2024-25 second quarter ending December 31, 2024. The report provides information on assets, allocations, average maturities, yields, and valuations for each of the three (3) portfolios. A discussion of market conditions is included to give additional perspective to these measurements.

As of December 31, 2024, the City's cash and investment portfolios are in full compliance with the City's Investment Policy, California Government Code Section 53601, and have sufficient cash flow from a combination of liquid and maturing securities, bank deposits, and income to meet the City's expenditure requirements. The paragraphs below provide a summary of the investment results from the second quarter.

Total Pooled Cash and Investments during the quarter totaled $121,421,759. This total amount consisted of $4,550,418 in the City’s operating accounts with its banking partner 9 CITY COUNCIL AGENDA REPORT – MEETING OF JANUARY 28, 2025 SECOND QUARTER TREASURER’S REPORT AND THE MONTHLY INVESTMENT TRANSACTION REPORT AS OF DECEMBER 31, 2024 – FISCAL YEAR 2024-2025