West Sacramento City Council
January 15, 2025

WEST SACRAMENTO CITY COUNCIL AND WEST SACRAMENTO REDEVELOPMENT SUCCESSOR

AGENCY & WEST SACRAMENTO FINANCING AUTHORITY
City Council Regular Meeting
JANUARY 15, 2025 AGENDA
Martha Guerrero, Mayor
Dawnté Early, Mayor Pro Tem
Quirina Orozco, Council Member
Norma Alcala, Council Member
Verna Sulpizio Hull, Council Member
Aaron Laurel, City Manager
Jeffrey Mitchell, City Attorney
6:00 PM Closed Session Call to Order
7:00 PM Regular Meeting Call to Order
Pledge of Allegiance
Land Acknowledgment
The meeting will be held at City Hall, City Council Chambers, 1110 West Capitol Avenue, West Sacramento GENERAL ADMINISTRATION FUNCTION – PART I

1. PRESENTATIONS BY THE PUBLIC ON MATTERS NOT ON THE AGENDA WITHIN THE

JURISDICTION OF THE COUNCIL
The Council is prohibited from discussing issues not on the agenda brought to them at this time.

According to State Law (the Brown Act), items must first be noticed on the agenda before any discussion or action.

PRESENTATIONS
NONE.

CONSENT AGENDA

2. Capital Projects
CONSIDERATION OF ADOPTION OF RESOLUTION 25-7 AMENDING THE CAPITAL

IMPROVEMENT PROGRAM BUDGET AND APPROVAL OF A PROFESSIONAL SERVICES

CONTRACT WITH KIMLEY HORN AND ASSOCIATES FOR ENGINEERING SERVICES ON THE STONE BLVD EXTENSION PROJECT (CIP 10053)
Objective: The objective of this report is to provide the City Council with sufficient information to adopt Resolution 25-7 amending the Capital Improvement Program (CIP) budget and approve a professional services contract with Kimley Horn and Associates, Inc. for engineering services on the Stone Blvd Extension Project (CIP 10053) Project.

Anyone wishing to address the Council, or any agenda item, may fill out the Request to Speak card and present it to the City Clerk prior to the completion of staff presentation. Items on the Consent Agenda will be considered in one motion and the Request to Speak card should be turned in prior to the first item on Consent.
1 Recommendation: Staff respectfully recommends that the City Council: (1) Adopt Resolution 25-7 amending the Capital Improvement Program Budget, (2) Award a professional services contract with Kimley Horn and Associates, Inc. for engineering design of the Stone Blvd Extension Project, (3) Delegate authority to the City Manager, or his designee, to execute a professional services contract with Kimley Horn and Associates, Inc. on the Stone Blvd Extension Project for an amount not to exceed $1,429,906, (4) Authorize the City Manager, or his designee, to make contract amendments up to 10% ($143,000) of the total contract value on Stone Blvd Extension Project, (5) Authorize the City Manager, or his designee, to execute non-substantive changes or modifications to these professional services contracts, with approval from the City Attorney, and (6) Authorize the City Manager, or his designee, to execute amendments to extend the term of these contracts, if necessary.

3. Capital Projects

CONSIDERATION OF ADOPTION OF APPROVAL OF A PROFESSIONAL SERVICES CONTRACT WITH WOOD RODGERS, INC. FOR ENGINEERING SERVICES FOR THE NORTH 5TH STREET COMPLETE STREETS AND CONNECTIVITY PROJECT (CIP 16013) Objective: The objective of this report is to provide the City Council with sufficient information to approve a professional services contract with Wood Rodgers, Inc. (Wood Rodgers) for Engineering Services for the North 5th Street Complete Streets and Connectivity Project (CIP 16013).

Recommendation: Staff respectfully recommends that the City Council: 1) Find that approval of a professional services contract with Wood Rodgers is not subject to the California Environmental Quality Act (CEQA) as it is not an activity that may cause either a direct or reasonably foreseeable indirect physical change in the environment pursuant to CEQA guidelines section 15060(c) and 15378(a); 2) Approve a professional services contract for engineering services with Wood Rodgers for the North 5th Street Complete Streets and Connectivity Project (CIP 16013); 3) Authorize the City Manager, or his designee, to execute a professional services contract with Wood Rodgers for an amount not to exceed $614,814.72; 4) Authorize the City Manager, or his designee to execute non-substantive changes or modifications to the professional services contract, with approval from the City Attorney; 5) Authorize the City Manager, or his designee, to execute amendments up to 20% ($122,962.94) of the total contract amount; and 6) Delegate authority to the City Manager, or his designee, to execute amendments to extend the term of the contract, if necessary, and to approve and incorporate additional tasks.

4. Capital Projects
CONSIDERATION OF APPROVAL OF CONTRACT AMENDMENT NO. 3 WITH CONSOR NORTH AMERICA, INC. FOR THE SYCAMORE TRAIL EXTENSION PHASE II PROJECT (CIP 14021) Objective: The objective of this report is to provide the City Council with sufficient information to approve Contract Amendment No. 3 of the professional services contract with Consor North America, Inc. (Consor) for construction management services for the Sycamore Trail Extension Phase II Project (CIP 14021).

Recommendation: Staff respectfully recommends that the City Council: 1) Approve and authorize the City Manager, or his designee, to execute Amendment No. 3 to the construction management 2 contract with Consor in the amount of $300,000 and extend the term of the contract to December 31, 2025, for the Sycamore Trail Extension Phase II Project; 2) Authorize the City Manager or his designee to execute amendments or change orders up to 15% of the contract amendment amount $45,000; 3) Authorize the City Manager to execute non-substantive changes or modifications, with approval from the City Attorney; and 4) Authorize the City Manager or his designee to execute amendments to further extend the term of the contract, if necessary.

5. Capital Projects
CONSIDERATION OF RESOLUTION 25-09 APPROVING THE 2024 SEWER MASTER PLAN UPDATE, RESOLUTION 25-10 AMENDING THE CAPITAL IMPROVEMENT PROGRAM (CIP), AND BLACK AND VEATCH AMENDMENT 2 FOR ENGINEERING SERVICES FOR THE CITY OF WEST SACRAMENTO SEWER MASTER PLAN UPDATE (CIP 31008)
Objective: The objective of this report and presentation is to provide the City Council with sufficient information to adopt Resolution 25-09 approving the Sewer Master Plan Update and adopt Resolution 25-10 amending the Capital Improvement Program (CIP) and amendment 2 with Black & Veatch for the City of West Sacramento Sewer Master Plan Update (CIP 31008).

Recommendation: Staff respectfully recommends that the City Council: (1) Find that the 2024 Sewer Master Plan Update is within the scope of the previously certified Environmental Impact Report (EIR) prepared for the General Plan 2035, and no new or substantially more adverse impacts would occur through implementation of the proposed project. As a result, no new environmental document or analysis is required consistent with State of California Environmental Quality Act (CEQA) Guidelines Sections 15162 and 15168(c)(2); (2) Adopt Resolution 25-09 approving the Sewer Master Plan Update; (3) Adopt Resolution 25-10 amending the Capital Improvement Program; (4) Delegate authority to the City Manager or his designee to execute amendment 2 to the contract with Black & Veatch for $67,590; (5) Authorize the City Manager, or his designee, to execute non-substantive changes or modifications to the construction contract, with approval from the City Attorney; and (6) Authorize the City Manager or his designee to execute amendments to extend the term of the contract.

6. Capital Projects
CONSIDERATION OF RESOLUTION 25-11 APPROVING THE 2024 WATER MASTER PLAN UPDATE AND RESOLUTION 25-12 AMENDING THE CAPITAL IMPROVEMENT PROGRAM (CIP) AND AMENDMENT 3 WITH ZANJERO FOR ENGINEERING SERVICES FOR THE CITY OF WEST SACRAMENTO WATER MASTER PLAN UPDATE (CIP 21037)
Objective: The objective of this report and presentation is to provide the City Council with sufficient information to adopt Resolution 25-11 approving the 2024 Water Master Plan Update, adopt Resolution 25-12 amending the Capital Improvement Program (CIP), and approve amendment 3 to the contract with Zanjero for the Water Master Plan Update (CIP 21037).

Recommendation: Staff respectfully recommends that the City Council: (1) Find that the 2024 Water Master Plan Update is within the scope of the previously certified Environmental Impact Report (EIR) prepared for the General Plan 2035, and no new or substantially more adverse impacts would occur through implementation of the proposed project. As a result, no new environmental document or analysis is required consistent with State of California Environmental 3 Quality Act (CEQA) Guidelines Sections 15162 and 15168(c)(2); (2) Adopt Resolution 25-11, approving the 2024 Water Master Plan Update; (3) Adopt Resolution 25-12, amending the Capital Improvement Program; (4) Delegate authority to the City Manager or his designee to execute Zanjero contract Amendment 3 for $45,000; (5) Authorize the City Manager, or his designee, to execute non-substantive changes or modifications to the contract, with approval from the City Attorney; and (6) Authorize the City Manager or his designee to execute amendments to extend the term of the contract.

7. Capital Projects

CONSIDERATION OF REJECTION OF ALL BIDS FOR THE B STREET TOWER PARKLET PROJECT (CIP 15056)
Objective: The objective of this report is to provide the City Council with sufficient information to reject all bids for the B Street Tower Parklet Project (CIP 15056).

Recommendation: Staff respectfully recommends that the City Council reject all bids for the B Street Tower Parklet Project (24-027-ITB).

8. Capital Projects
CONSIDERATION OF ADOPTION OF RESOLUTION 25-2 AMENDING THE CAPITAL IMPROVEMENT PROGRAM BUDGET AND APPROVAL OF CHANGE ORDERS 10-12 TO THE CONSTRUCTION CONTRACT FOR TORRES PROJECT MANAGEMENT, INC. FOR THE FIRE STATION 43 TENANT IMPROVEMENT PROJECT (CIP 51031)
Objective: The objective of this report is to provide the City Council with sufficient information to adopt Resolution 25-2 amending the Capital Improvement Program (CIP) and approval of Change Orders 10-12 to the Torres Project Management, Inc. contract for the Fire Station 43 Tenant Improvement Project (CIP 51031).

Recommendation: Staff respectfully recommends that the City Council: (1) Adopt Resolution 25-2 amending the Capital Improvement Program budget; (2) Approve Change Orders 10-12 to the construction contract with Torres Project Management, Inc. in the amount of $28,295.13 for the Fire Station 43 TI Project; (3) Authorize the City Manager, or his designee, to execute change orders 10-12; (4) Authorize the City Manager, or his designee, to execute contract amendments or change orders for up to an additional $10,000 in contingency; and (5) Authorize the City Manager, or his designee, to execute non-substantive changes or modifications to the construction contract, with approval from the City Attorney.

9. Capital Projects
CONSIDERATION OF AWARD OF CONTRACT TO FIRESTATIONFURNITURE.COM FOR THE

PURCHASE OF NEW STORAGE LOCKERS AND ASSEMBLY FOR STORAGE LOCKERS FOR FIREFIGHTER PPE PROJECT (CIP 51045)
Objective: The purpose of this report is to provide the City Council with sufficient information to award a contract to FireStationFurniture.com for the procurement, delivery, and assembly of new storage lockers for the Storage Lockers for Firefighter PPE Project (CIP 51045). 4 Recommendation: Staff respectfully recommends that the City Council: 1) Find that the Storage Lockers for Firefighter PPE project is exempt from CEQA review pursuant to the Categorical Exemption under California Code of Regulations, Title 14, Division 6, Chapter 3 (“CEQA Guidelines”), Article 19, Section 15301 (Existing Facilities); 2) Authorize the City Manager or his designee to approve and execute a services contract with FireStationFurniture.com in an amount not to exceed $55,783.38; 3) Authorize the City Manager, or his designee to execute nonsubstantive changes or modifications to the services contract, with approval from the City Attorney; 4) Authorize the City Manager, or his designee, non-substantive changes or modifications, amendments, change orders, agreements, and/or purchases up to 15% ($8,367.50) of the total contract amount; and 5) Delegate authority to the City Manager, or his designee, to execute amendments to extend the term of the contract, if necessary.

10. Capital Projects
CONSIDERATION OF ADOPTION OF RESOLUTION 25-5 AMENDING THE CAPITAL IMPROVEMENT PROGRAM BUDGET AND APPROVAL OF CHANGE ORDERS 11-14 TO THE CONSTRUCTION CONTRACT FOR TORRES PROJECT MANAGEMENT, INC. FOR THE POLICE DEPARTMENT TENANT IMPROVEMENT PROJECT (CIP 51033) Objective: The objective of this report is to provide the City Council with sufficient information to adopt Resolution 25-5 amending the Capital Improvement Program (CIP) and approval of Change Orders 11-14 to the Torres Project Management, Inc. contract for the Police Department Tenant Improvement Project (CIP 51033).

Recommendation: Staff respectfully recommends that the City Council: 1) Adopt Resolution 25-5 amending the Capital Improvement Program budget; 2) Approve Change Orders 11-14 to the construction contract with Torres Project Management, Inc. in the amount of $31,372.86 for the Police Department TI Project; 3) Authorize the City Manager, or his designee, to execute change orders 11-14; 4) Authorize the City Manager, or his designee, to execute any contract amendments or change orders up to an additional $10,000 in contingency; and 5) Authorize the City Manager, or his designee, to execute non-substantive changes or modifications to the construction contract, with approval from the City Attorney

11. Community Development
CONSIDERATION OF RESOLUTION 25-4 APPROVING THE FINAL MAP FOR SUBDIVISION 5223, INDEPENDENCE IN WEST SACRAMENTO
Objective: This item seeks City Council adoption of Resolution 25-4 approving the Final Map for Subdivision 5223, Independence in West Sacramento.

Recommendation: Staff respectfully recommends that the City Council adopt Resolution 25-4, approving the Final Map for Independence in West Sacramento, Subdivision 5223.

12. Police
5 CONSIDERATION OF FINDING OF PUBLIC CONVENIENCE OR NECESSITY FOR A TYPE 48 ALCOHOLIC BEVERAGE CONTROL LIQUOR LICENSE AT 2220 LAKE WASHINGTON BLVD. #120 (ROCO WINE & SPIRITS)
Objective: The objective of this report is to provide the City Council with information regarding the issuance of an Alcoholic Beverage Control Type 48 on-sale liquor license for consideration of a determination of a Public Convenience or Necessity to allow on-site service and consumption of distilled spirits at an existing taproom at 2220 Lake Washington Blvd. #120 (RoCo Wine & Spirits).

Recommendation: Staff respectfully recommends that the City Council: 1) Find that Public Convenience or Necessity would be served by the issuance of an Alcoholic Beverage Control Type 48 License at 2220 Lake Washington Blvd. #120; and 2) Authorize the submission of a letter of determination of a Public Convenience or Necessity to the State Department of Alcoholic Beverage Control.

13. City Manager's Office

CONSIDERATION OF UPDATES TO PUBLICLY AVAILABLE PAY SCHEDULE AND AUTHORIZED POSITION LIST FOR FISCAL YEAR 2024/25, AND CONSIDERATION OF RESOLUTION 25-13 AMENDING THE O&M BUDGET FOR FY 2024/25 Objective: The purpose of this report is to seek City Council approval for updates to the publicly available pay schedule for FY 2024/25 and Authorized Position List for FY 2024/25, and consideration of Resolution 25-13 amending the O&M budget for FY 2024/25 to fund the proposed changes.

Recommendation: Staff respectfully recommends that the City Council: (1) Approve the amended and updated publicly available pay schedule (Classification Plan) for Fiscal Year 2024/25; (2) Approve the amended and updated Authorized Position List (APL) for Fiscal Year 2024/25; and (3) Approve Resolution 25-13 amending the O&M Budget for FY 2024/25 to fund the proposed changes.

PUBLIC HEARINGS

14. Community Development
PUBLIC HEARING AND CONSIDERATION OF FIRST READING OF ORDINANCE 25-1 REGARDING PROPOSED AMENDMENTS TO TITLE 17 (ZONING) OF THE MUNICIPAL CODE

TO CREATE THE GRAND GATEWAY ZONING DISTRICT AND RELATED ACTIONS Objective: The item is a public hearing and consideration of first reading of Ordinance 25-1 regarding proposed amendments to Title 17 (Zoning) to create the Grand Gateway Zoning District and related actions to streamline future redevelopment of the Grand Gateway area.

Recommendation: Staff respectfully recommends that the City Council: (1) Conduct the public hearing; (2) Find that the Grand Gateway Zoning District is consistent with the General Plan required for Zoning Amendments; (3) Find that the Grand Gateway Zoning District project is exempt from California Environmental Quality Act (CEQA) review pursuant to §15183 (Projects Consistent with a Community Plan or Zoning) of the CEQA Guidelines; and 6 (4) Conduct the first reading of Ordinance 25-1 (Attachment 2) amending Title 17 (Zoning) of the Municipal Code regarding creating the Grand Gateway Zoning District and Related Actions.

15. Community Development
PUBLIC HEARING AND CONSIDERATION OF RESOLUTION 25-8, TO VACATE PUBLIC RIGHTOF-WAY KNOWN AS MIDDLE AVENUE, LOCATED AT 600 SUTTER STREET Objective: The objective of this item is to vacate public right-of-way, known as Middle Avenue, located at 600 Sutter Street.

Recommendation: Staff respectfully recommends that City Council conduct a public hearing and adopt Resolution 25-8 vacating public right-of-way, known as Middle Avenue, located at 600 Sutter Street.

REGULAR AGENDA

16. Capital Projects
CONSIDERATION OF APPROVAL OF UPDATED ADMINISTRATIVE POLICY IX-A-2: PARK AND

FACILITY NAMING
Objective: The purpose of this report is to present revisions to the Park and Facility Naming Policy (Administrative Policy IX-A-2) for the City Council's consideration and approval.

Recommendation: Staff respectfully recommends that the City Council approve the updates to the Park and Facility Naming Policy.

17. City Manager's Office

CONSIDERATION OF COUNCIL COMMITTEE APPOINTMENTS
Objective: The objective of this report is to provide the Mayor and members of the City Council with the information needed to conduct the biennial appointments of the members of the members of the City Council to the regional and multi-public agency committees which require a representative from the City of West Sacramento.

Recommendation: Staff respectfully recommends that the Mayor conduct the biennial Council Committee appointments.

GENERAL ADMINISTRATION FUNCTION – PART II

18. COUNCIL COMMUNICATIONS / ASSIGNMENTS
Bikeshare Policy Steering Committee --------------------------------------------Guerrero, Alternate - Early City/County 2x2 ----------------------------------------------------Guerrero/Orozco, Alternate – Sulpizio Hull City/School 2x2 ------------------------------------------------------Guerrero/Sulpizio Hull, Alternate - Alcala Executive Commission to Address Homelessness --------------------Sulpizio Hull, Alternate - Orozco EIFD Public Financing Authority-----------------------------------------------Guerrero, Alcala, Sulpizio Hull League of California Cities --------------------------------------------------- Alcala, Alternate – Sulpizio Hull 7 Local Agency Formation Commission ---------------------------------------------------------------------- Alcala Port District Commission ---------------------------------------------------------Guerrero, Early, Sulpizio Hull Remote Access Network ------------------------------------------------------------------------------------Guerrero River City Regional Stadium Financing Authority------------------------------------------Guerrero, Orozco Sacramento Area Council of Governments (SACOG) ------------------------Guerrero; Alternate - Early Sacramento Regional County Sanitation District Board --------------Orozco; Alternate - Sulpizio Hull West Sacramento Area Flood Control Agency JPA ----------------------------Alcala; Alternate - Orozco Yolo Animal Servies Planning Agency JPA----------------------------Guerrero; Alternate – Sulpizio Hull Yolo County Housing Authority-------------------------------------------------Early, Alternate - Sulpizio Hull Yolo Transportation District -----------------------------------------------------Early, Alternate - Sulpizio Hull Yolo Habitat Conservancy ------------------------------------------------------------------------------Sulpizio Hull Yolo-Solano Air Quality Management District ----------------------------Alcala; Alternate – Sulpizio Hull Yolo Subbasin Sustainable Groundwater Agency-------------------------Sulpizio Hull; Alternate - Early

COUNCIL INTERMEDIARY REPRESENTATIVES
Delta Protection Commission -------------------------------------------------------Vacant; Alternate - Vacant New Hope Community Development Corporation---------------------------------Early; Alternate - Alcala Yolo County Consolidated Redevelopment Successor Agency Oversight Board--------Sulpizio Hull

19. PART II
A. Council Calendar
B. City Manager Report
C. City Attorney Report
D. Staff Direction from City Council Members
E. Future Agenda Item Requests by Council
F. Adjourn
I, Jennifer Cusmir, City Clerk, declare under penalty of perjury that the foregoing agenda for the January 15, 2025 regular and closed session meetings of the West Sacramento City Council, Redevelopment Successor Agency and Financing Authority was posted January 10, 2025 at the rear entrance at City Hall, 1110 West Capitol Avenue, West Sacramento, CA and was available for public review. __________________________________________
Jennifer Cusmir, City Clerk
NOTE: If you challenge the nature of a proposed action in court, you may be limited to raising only those issues you or someone else raised at the public hearing described in this notice, or in written correspondence delivered to the City Council at, or prior to, the public hearing.

The agenda and agenda reports are also available on the City’s website at www.cityofwestsacramento.org City Council meetings are broadcast live on Wave Cable Channel 20 and rerun the next day at 12:00 PM and the following Saturday at 6:00 PM.

All public materials related to an item on this agenda submitted to the City Council after distribution of the agenda packet are also made available for public inspection on the City’s website at:
www.cityofwestsacramento.org. Any document provided at the meeting by staff or by the public will be provided by the City Clerk upon request by phone at (916) 617-4500, or by email at: [email protected]. 8 If you need assistance to participate in this meeting, including translation support, please contact the City Clerk’s Office at 916-617-4500 or [email protected]. Notifying the City Clerk’s Office at least 72 hours prior to the meeting will assist staff in assuring reasonable arrangements can be made to provide accessibility to the meeting. Assisted listening devices are available at this meeting.

Si necesita ayuda para participar en esta reunión o servicios de traducción, comuníquese con la Oficina del Secretario Municipal al 916-617-4500 o [email protected]. Notificar a la Oficina del Secretario Municipal al menos 72 horas antes de la reunión ayudará al personal a garantizar que se puedan hacer arreglos razonables para proporcionar accesibilidad a la reunión.

Los dispositivos de escucha asistida están disponibles en esta reunión. 9 CITY COUNCIL AGENDA REPORT
MEETING DATE: January 15, 2025 ITEM # 2
SUBJECT:

CONSIDERATION OF ADOPTION OF RESOLUTION 25-7 AMENDING THE CAPITAL

IMPROVEMENT PROGRAM BUDGET AND APPROVAL OF A PROFESSIONAL

SERVICES CONTRACT WITH KIMLEY-HORN AND ASSOCIATES FOR ENGINEERING SERVICES ON THE STONE BLVD EXTENSION PROJECT (CIP 10053) INITIATED OR REQUESTED BY: REPORT COORDINATED OR PREPARED BY:
[ ] Council [ X ] Staff
[ ] Other
David Wong, Principal Engineer
Capital Projects Department
ATTACHMENT [ X ] Yes [ ] No [ ] Information [ ] Direction [ X ] Action

OBJECTIVE
The objective of this report is to provide the City Council with sufficient information to adopt Resolution 25-7 amending the Capital Improvement Program (CIP) budget and approve a professional services contract with Kimley Horn and Associates, Inc. for engineering services on the Stone Blvd Extension Project (CIP 10053) Project.

RECOMMENDED ACTION
Staff respectfully recommends that the City Council:
1) Adopt Resolution 25-7 amending the Capital Improvement Program Budget; 2) Award a professional services contract with Kimley-Horn and Associates, Inc. for engineering design of the Stone Blvd Extension Project;
3) Delegate authority to the City Manager, or his designee, to execute a professional services contract with Kimley-Horn and Associates, Inc. on the Stone Blvd Extension Project for an amount not to exceed $1,429,906;
4) Authorize the City Manager, or his designee, to make contract amendments up to 10% ($143,000) of the total contract value on Stone Blvd Extension Project;
5) Authorize the City Manager, or his designee, to execute non-substantive changes or modifications to these professional services contracts, with approval from the City Attorney; and 6) Authorize the City Manager, or his designee, to execute amendments to extend the term of these contracts, if necessary.

BACKGROUND
Pioneer Bluff consists of approximately 125 acres of riverfront property situated along a one-mile stretch of South River Road. It is part of the City’s planned urban waterfront and is one of the prime riverfront redevelopment opportunities in the region. The area developed first as a regional petroleum storage hub and distribution point and subsequently expanded to include other industrial uses. The City began implementing its urban riverfront vision in the 1990s and has extended de-industrialization activities into Pioneer Bluff through relocation of the Cemex facility, decommissioning the City’s wastewater treatment plant, and construction of the Mike McGowan Bridge.

Volume 1 of the Pioneer Bluff Transition Plan was approved by City Council in December 2014 and conceptually summarized the Pioneer Bluff District’s transition processes, scope and projected costs. The Pioneer Bluff Stone Lock Reuse Master Plan, completed in June 2018, is considered as Volume II and Volume III and expanded on as well as modified some of the analysis contained in the 2014 document. As part of the transition of Pioneer Bluff from industrial uses to urban mixed-use development, a critical project identified within the master plan is to extend Stone Blvd. from the existing rail crossing at Jefferson Blvd. to South River Road, to provide the first east-west connection into Pioneer Bluff.

The extension of Stone Blvd. is contingent upon coordination with the railroad and approval to cross the existing railroad tracks at the intersection of Stone Blvd. and Jefferson Blvd. Until the design has advanced sufficiently to identify the conditions that the railroad operator will impose on the City as part of their approval process, the construction costs for this roadway extension remain unknown. This project will secure the necessary regulatory approvals and develop shovel-ready plans, which is a crucial step in identifying the funding gap for construction and developing a funding strategy for project construction. Once completed, the extension of Stone Blvd. will provide a critical multimodal network component, essential for encouraging development and growth in this highly anticipated riverfront real estate area.
10 Consideration of Adoption of Resolution 25-7 for the Stone Blvd. Extension Project (CIP 10053) January 15, 2025

ANALYSIS
Staff issued a Request for Proposals (RFP) for Engineering Design Services for the Stone Blvd. Extension Project on OpenGov, the City’s eProcurement system. This solicitation (24-071-RFP) was issued on October 8, 2024, with proposals due by October 29, 2024. This RFP was sent out to all 1,853 vendors that were on the City’s procurement distribution system. Of the vendors contacted, only one firm, Kimley-Horn and Associates, Inc., submitted a proposal. To encourage additional competition, the City contacted vendors that had followed the RFP to encourage the submittal of additional proposals and also notified vendors that the proposal due date would be extended to November 12, 2024. Following the close of the extended due date, Kimley-Horn & Associates, Inc. remains the sole proposer, and justification for sole sourcing has been met in accordance with the City’s procurement procedures.

The proposal by Kimley-Horn and Associates, Inc. was evaluated by a three-person panel in accordance with the City’s purchasing policy. Proposals were evaluated based on qualifications, proven ability, experience, and technical approach. After reviewing the consultant’s qualifications, experience, and proposed work plan, the staff selection panel determined that Kimley-Horn and Associates, Inc. has a strong understanding of the work to be performed and is a qualified firm. The attached contract includes the negotiated scope and fees to complete the assignment.

Environmental Considerations
This action is not a “project” for the purposes of the California Environmental Quality Act, Public Resources Code section 21000 et seq. (“CEQA”), because it is not an activity that may cause either a direct or reasonably foreseeable indirect physical change in the environment and, therefore, pursuant to Public Resources Code section 21065 and CEQA Guidelines sections 15060(c) and 15378(a), it is not subject to environmental review.

Environmental documentation require for the project will be conducted during the project development.

Commission Recommendation
The Stone Blvd. Extension Project is a critical project identified by the adopted Pioneer Bluff Master Plan. No policy decision requiring Transportation, Mobility and Infrastructure Commission review is required for this item.

Strategic Plan Integration
The Stone Blvd. Extension Project addresses the guiding principle of Local Economic Development of the West Sacramento Strategic Plan.

Alternatives
Staff recommends that the City Council:
1) Approve the recommended actions as stated above.
2) Make adjustments to the recommended actions.
3) Decline to approve recommended action or delay the project.

Alternatives 2 and 3 are not recommended because they would delay the City from catalyzing development in riverfront areas.

Coordination and Review
This report was prepared by the Capital Projects Department in coordination with and review by the Finance Department.

Budget/Cost Impact
The Stone Blvd Extension Project is included in the City’s current Capital Improvement Program as CIP 10053, with a current appropriated budget of $1,100,000 from the Measure G Community Investment Fund. To complete the environmental, design, and right-of-way phases will require an additional appropriation of $700,000, which is also proposed to be funded from Measure G funds. This would result in a total project budget of $1,800,000 which would fully fund the consultant’s scope of work, required City staff resources, project contingency and result in a shovel-ready set of construction documents. Shovel ready plans would assist in the pursuit of future grant opportunities by increasing project competitiveness, and a future appropriation for construction funding will be required once the appropriate funding strategy for construction has been developed.

ATTACHMENTS

1. Resolution 25-7

2. Vicinity Map

3. CPE24-361 Kimley-Horn and Associates, Inc. Contract
11 Attachment 1
RESOLUTION 25-7

A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF WEST SACRAMENTO

APPROVING AN AMENDMENT TO THE CAPITAL IMPROVEMENT PROGRAM BUDGET FOR THE STONE BLVD EXTENSION PROJECT (CIP 10053)
WHEREAS, the Stone Blvd Extension Project (Project) will provide a critical multimodal network component necessary to encourage development and growth in the Pioneer Bluff riverfront real estate area; and
WHEREAS, the Project will extend Stone Blvd from the existing railroad crossing at Jefferson Blvd to South River Road to provide the first east-west connection into Pioneer Bluff; and
WHEREAS, the Project is included in the City’s Capital Improvement Program with a current appropriated budget of $1,100,000 of Measure G funds; and WHEREAS, to fund the consultant’s scope of work, required City staff resources and project contingency would require an additional appropriation in the amount of $700,000, which staff proposes to also be funded with Measure G funds; and WHEREAS, the City Council has considered all information related to this matter, as presented at the public meetings of the City Council identified herein, including any supporting reports by City staff, and any other information provided during public meetings.

NOW, THEREFORE BE IT RESOLVED, by the City Council of the City of West Sacramento, as follows:

1. The City Council hereby approves amendments to the Capital Improvement Program (CIP) for the 2024-25 fiscal year as listed below:

SOURCES
$700,000 106-0000-3085 Measure G fund balance
$700,000 400-9900-4990/10053-4990 Transfer into Project CIP 10053 $700,000 TOTAL SOURCES
USES
$700,000 400-9900-5530/10053-5800 Project Budget
$700,000 106-9020-5950 Transfer out to CIP 10053
$700,000 TOTAL USES

2. The City Council hereby finds that the facts set forth in the recitals to this Resolution are true and correct and establish the factual basis for the City Council’s adoption of this Resolution.

3. This resolution shall take effect immediately upon its adoption.

PASSED AND ADOPTED by the City Council of the City of West Sacramento, this 15th day of January 2025, by the following vote:

AYES:

NOES:
12 Resolution 25-7

ABSENT:

Martha Guerrero, Mayor
ATTEST:

Jennifer Cusmir, City Clerk
13 t;
w
z
c:::J Project Limit - Interstate - Major Road
-- Minor Road
N
A
Kl K KlJ
0 25
FEET

STONE BLVD
50 17TH s-,-

STONE BLVD EXTENSION PROJECT

VICINITY MAP
Located along the west side of the river between S River Road and the intersection of Jefferson Blvd and Stone Blvd
CITY�- OF -
WEST

SACRAMENTO
Attachment 2
Prepared on 12/16/2024
by alejandros
Capital Projects Department
14 City of West Sacramento
Kimley Horn and Associates, Inc.

CPE24-361 Engineering Design Services Stone Blvd. Extension Expires on 1/15/28
1 11.4.2024

CONTRACT FOR SERVICES
THIS CONTRACT is made on January 15, 2025, by and between the CITY OF WEST SACRAMENTO (“City”), and Kimley Horn and Associates, Inc. (“Consultant”).

WITNESSETH:

WHEREAS, the City proposes Professional Engineering Design Services for the Stone Blvd Extension Project;
WHEREAS, the Consultant has presented a proposal for such services to the City, dated November 27, 2024, (attached hereto as Exhibit “A”) and is duly licensed, qualified and experienced to perform those services;
NOW, THEREFORE, the parties hereto mutually agree as follows:

1. SCOPE OF SERVICES:

A. Consultant shall do all work, attend all meetings, produce all reports and carry out all activities necessary to completion of the services described in the Scope of Work, attached hereto and incorporated herein by this reference as Exhibit “B”. This Contract and its exhibits shall be known as the “Contract Documents.” Terms set forth in any Contract Document shall be deemed to be incorporated in all Contract Documents as if set forth in full therein. In the event of conflict between terms contained in these Contract Documents, the more specific term shall control. If any portion of the Contract Documents shall be in conflict with any other portion, provisions contained in the Contract shall govern over conflicting provisions contained in the exhibits to the Contract.

B. Consultant enters into this Contract as an independent contractor and not as an employee of the City. The Consultant shall have no power or authority by this Contract to bind the City in any respect. Nothing in this Contract shall be construed to be inconsistent with this relationship or status. All employees, agents, contractors or subcontractors hired or retained by the Consultant are employees, agents, contractors or subcontractors of the Consultant and not of the City. The City shall not be obligated in any way to pay any wage claims or other claims made against Consultant by any such employees, agents, contractors or subcontractors, or any other person resulting from performance of this Contract. In the event that Consultant or any employee, agent, or subcontractor of Consultant providing services under this Agreement claims or is determined by a court of competent jurisdiction or the California Public Employees Retirement System (PERS) to be eligible for enrollment in PERS as an employee of the City, Consultant shall indemnify, defend, and hold harmless City for the payment of any employee and/or employer contributions for PERS benefits on behalf of Consultant or its employees, agents, or subcontractors, as well as for the payment of any penalties and interest on such contributions, which would otherwise be the responsibility of City. Notwithstanding any other agency, state or federal policy, rule, regulation, law or ordinance to the contrary, To the greatest extent permitted by law, Consultant and its employees, agents, and subcontractors shall not qualify for or become entitled to, and hereby agree to waive any claims to, any compensation, benefit, or any incident of employment by City, including but not limited to eligibility to enroll in PERS as an employee of City and entitlement to any contribution to be paid by City for employer contribution and/or employee contributions for PERS benefits.
15 Kimley Horn and Associates, Inc.

CPE24-361 Engineering Design Services Stone Blvd. Extension Expires on 1/15/28
2 11.4.2024
C. The Consultant agrees it has satisfied itself by its own investigation and research regarding the conditions affecting the work to be done and labor and materials needed, and that its decision to execute this Contract is based on such independent investigation and research.

2. TERM OF CONTRACT
A. The services of Consultant are to commence upon receipt of written notice to proceed by the City, and shall be undertaken and completed in accordance with the Schedule of Performance attached hereto and incorporated herein by this reference as Exhibit “C” and terminate on January 15, 2028.

B. Consultant’s failure to complete work in accordance with the Schedule of Performance may result in delayed compensation as described in Section 3.

C. The City Manager or his or her designee may, by written instrument signed by the Parties, extend the duration of this Contract for two (2) additional one-year extensions in the manner provided in Section 5, provided that the extension does not require the payment of compensation in excess of the Council approved budget.

3. COMPENSATION:

A. The Consultant shall be paid monthly for the actual fees, costs and expenses, but in no event shall total compensation exceed One Million Four Hundred Twenty Nine Thousand Nine Hundred and Six Dollars ($1,429,906.00), without City’s prior written approval.

Consultant's fees shall be as specified in the Schedule of Fees, which is attached hereto an incorporated herein as Exhibit "D".

B. Said amount shall be paid upon submittal of a monthly billing showing completion of the tasks that month. Consultant shall furnish City with invoices for all expenses as well as for all materials authorized by this Contract. The invoices shall be submitted with the monthly billings.

If Consultant’s performance is not in conformity with the Schedule of Performance, payments may be delayed or denied, unless the Consultant’s failure to perform in conformity with the Schedule of Performance is a documented result of the City’s failure to conform with the Schedule of Performance, or if the Schedule of Performance is extended pursuant to Section 5.

C. If the work is halted at the request of the City, compensation shall be based upon the proportion that the work performed bears to the total work required by this Contract, subject to Section 4.

4. TERMINATION:

A. This Contract may be terminated by either party, provided that the other party is given not less than 30 calendar days’ written notice (delivered by certified mail, return receipt requested) of intent to terminate.

B. The City may temporarily suspend this Contract, at no additional cost to City, provided that the Consultant is given written notice (delivered by certified mail, return receipt requested) of temporary suspension. If City gives such notice of temporary suspension, Consultant shall immediately suspend its activities under this Contract. 16 Kimley Horn and Associates, Inc.

CPE24-361 Engineering Design Services Stone Blvd. Extension Expires on 1/15/28
3 11.4.2024
C. Notwithstanding any provisions of this Contract, Consultant shall not be relieved of liability to the City for damages sustained by the City by virtue of any breach of this Contract by Consultant, and the City may withhold any payments due to Consultant until such time as the exact amount of damages, if any, due the City from Consultant is determined.

D. In the event of termination, the Consultant shall be compensated as provided for in this Contract, except as provided in Section 4C. Upon termination, the City shall be entitled to all work, including but not limited to, appraisals, inventories, studies, analyses, drawings and data estimates performed to that date in accordance with Section 7 hereof.

5. AMENDMENTS, CHANGES OR MODIFICATIONS:

Amendments, changes or modifications in the terms of this Contract may be made at any time by mutual written agreement between the parties hereto and shall be signed by the persons authorized to bind the parties hereto.

6. EXTENSIONS OF TIME:

Consultant may, for good cause, request extensions of time to perform the services required hereunder. Such extensions shall be authorized in advance by the City in writing and shall be incorporated in written amendments to this Contract or the attached Work Program in the manner provided in Section 5.

7. PROPERTY OF CITY:

A. It is mutually agreed that all materials prepared by the Consultant under this Contract shall become the property of the City, and the Consultant shall have no property right therein whatsoever. Immediately upon termination, the City shall be entitled to, and the Consultant shall deliver to the City, all data, drawings, specifications, reports, estimates, summaries and other such materials as may have been prepared or accumulated to date by the Consultant in performing this Contract which is not Consultant’s privileged information, as defined by law, or Consultant’s personnel information, along with all other property belonging exclusively to the City which is in the Consultant’s possession.

B. The reuse of any of the materials or documents described in Paragraph 7.A by the City on any other project without the written permission of the Consultant, shall be at the City's sole risk and the City agrees to defend, indemnify and hold harmless the Consultant from all claims, damages and expenses, including attorney's fees, arising out of such unauthorized reuse by the City or by others acting through the City. The Consultant is not responsible and liability is waived by the City as against the Consultant for use by the City or any other person of any data, reports, plans or drawings not signed by the Consultant.]

8. COMPLIANCE WITH ALL LAWS:

A. Consultant shall comply with all applicable laws, ordinances, and codes of federal, State and local governments, and shall commit no trespass on any public or private property in performing any of the work authorized by this Contract. It shall be City’s responsibility to obtain all rights of way and easements to enable Consultant to perform its services hereunder.

Consultant shall assist City in providing the same.
17 Kimley Horn and Associates, Inc.

CPE24-361 Engineering Design Services Stone Blvd. Extension Expires on 1/15/28
4 11.4.2024
B. Consultant warrants to the City that it is licensed by all applicable governmental bodies to perform this Contract and will remain so licensed throughout the progress of the Work, and that it has, and will have, throughout the progress of the Work, the necessary experience, skill and financial resources to enable it to perform this Contract.

C. The work contemplated under this Contract is a public work for the purposes of Labor Code section 1720, and is subject to the payment of prevailing wages. Accordingly, Consultant shall comply with the provisions of Exhibit "F".

9. WARRANTIES AND RESPONSIBILITIES - CONSULTANT:

A. Consultant agrees and represents that it is qualified to properly provide the services set forth in Exhibit “B” in a manner which is consistent with the generally accepted standards of Consultant’s profession.

B. Consultant agrees and represents that the work performed under this Contract shall be in accordance with applicable federal, State and local law in accordance with Section 17A hereof.

C. Consultant shall designate a project manager who at all times shall represent the Consultant before the City on all matters relating to this Contract. The project manager shall continue in such capacity unless and until he or she is removed at the request of the City, is no longer employed by Consultant, or is replaced with the written approval of the City, which approval shall not be unreasonably withheld.

D. Consultant shall provide corrective services without charge to the City for services which fail to meet the above professional and legal standards and which are reported to Consultant in writing within sixty (60) days of discovery. Should Consultant fail or refuse to perform promptly its obligations, the City may render or undertake performance thereof and the Consultant shall be liable for any expenses thereby incurred.

10. SUBCONTRACTING:

None of the services covered by this Contract shall be subcontracted without the prior written consent of the City, which will not be unreasonably withheld. Consultant shall be as fully responsible to the City for the negligent acts and omissions of its contractors and subcontractors, and of persons either directly or indirectly employed by them, as it is for the negligent acts and omissions of persons directly employed by Consultant.

11. ASSIGNABILITY:

Consultant shall not assign or transfer any interest in this Contract whether by assignment or novation, without the prior written consent of the City which will not be unreasonably withheld.

However, claims for money due or to become due Consultant from the City under this Contract may be assigned to a financial institution, or to a trustee in bankruptcy, without such approval.

Notice of any assignment or transfer whether voluntary or involuntary shall be furnished promptly to the City.

12. INTEREST IN CONTRACT:

Consultant covenants that neither it, nor any of its employees, agents, contractors, 18 Kimley Horn and Associates, Inc.

CPE24-361 Engineering Design Services Stone Blvd. Extension Expires on 1/15/28
5 11.4.2024
subcontractors has any interest, nor shall they acquire any interest, direct or indirect, in the subject of the Contract, nor any other interest which would conflict in any manner or degree with the performance of its services hereunder. Consultant shall make all disclosures required by the City’s conflict of interest code in accordance with the category designated by the City, unless the City Manager determines in writing that Consultant’s duties are more limited in scope than is warranted by the category designated by the City code and that a narrower disclosure category should apply. Consultant also agrees to make disclosure in compliance with the City conflict of interest code if, at any time after the execution of this Contract, City determines and notifies Consultant in writing that Consultant’s duties under this Contract warrant greater disclosure by Consultant than was originally contemplated. Consultant shall make disclosures in the time, place and manner set forth in the conflict of interest code and as directed by the City.

13. MATERIALS CONFIDENTIAL:

All of the materials prepared or assembled by Consultant pursuant to performance of this Contract are confidential and Consultant agrees that they shall not be made available to any individual or organization without the prior written approval of the City, except by court order.

14. LIABILITY OF CONSULTANT-NEGLIGENCE:

Consultant shall be responsible for performing the work under this Contract in a manner which is consistent with the generally-accepted standards of the Consultant’s profession and shall be liable for its own negligence and the negligent acts of its employees, agents, contractors and subcontractors. The City shall have no right of control over the manner in which the work is to be done but only as to its outcome, and shall not be charged with the responsibility of preventing risk to Consultant or its employees, agents, contractors or subcontractors.

15. INDEMNITY AND LITIGATION COSTS:

Consultant shall protect, hold free and harmless, defend and indemnify the City, its consultants, and each of their officers, employees and agents, from any and all liability, penalties, costs, losses, damages, expenses, causes of action, claims or judgments, including attorney’s fees and expenses of litigation arising out of, pertaining to, or relating to the negligence, recklessness, or willful misconduct of the Consultant, its employees or anyone else employed by the Consultant in the performance of professional design services under this agreement, to the extent of the Consultant’s proportionate percentage of fault.

To the extent permitted by Civil Code section 2782.8, for all other claims unrelated to the provision of professional design services, the Consultant shall protect, hold free and harmless, defend and indemnify the City, its consultants, and each of their officers, employees and agents, from any and all liability, penalties, costs, losses, damages, expenses, causes of action, claims or judgments, including attorney’s fees and expenses of litigation, which arise out of or are in any way connected with the Consultant’s, or its subcontractors’ or suppliers’, performance under this agreement or failure to comply with any of the obligations contained in the agreement. This indemnity shall imply no reciprocal right of the Consultant in any action on the agreement pursuant to California Civil Code section 1717 or section 1717.5. To the fullest extent legally permissible, this indemnity, defense and hold harmless agreement by the Consultant shall apply to any and all acts or omissions unrelated to the provision of professional design services, whether active or passive, on the part of the Consultant or its agents, employees, representatives, or subcontractor’s agents, employees and representatives, resulting in claim or liability, irrespective of whether or not any acts or omissions of the parties to be indemnified hereunder may also have 19 Kimley Horn and Associates, Inc.

CPE24-361 Engineering Design Services Stone Blvd. Extension Expires on 1/15/28
6 11.4.2024
been a contributing factor to the liability, except such loss or damage which was caused by the active negligence, the sole negligence, or the willful misconduct of the City.

16. CONSULTANT TO PROVIDE INSURANCE:

A. Consultant shall not commence any work before obtaining, and shall maintain in force at all times during the duration and performance of this Contract, the policies of insurance specified in this Section. Such insurance must have the approval of the City as to limit, form, and amount, and shall be placed with insurers with a current A.M. Best’s rating of no less than A VII (an NR rating is acceptable for Worker’s Compensation insurance written with the State Compensation Insurance Fund of California).

B. Prior to execution of this Contract and prior to commencement of any work, the Consultant shall furnish the City with certificates of insurance and copies of endorsements providing evidence of coverage for all policies required by the Contract. The Consultant and its contractors and subcontractors shall, at their expense, maintain in effect at all times during the performance of work under the Contract not less than the following coverage and limits of insurance, which shall be maintained with insurers and under forms of policy satisfactory to the City. The maintenance by Consultant and its contractors and subcontractors of the following coverage and limits of insurance is a material element of this Contract. The failure of Consultant or of any of its contractors or subcontractors to maintain or renew coverage or to provide evidence of renewal may be treated by the City as a material breach of this Contract. Approval of the insurance by the City shall not relieve or decrease any liability of Consultant.

1. Worker’s Compensation and Employer’s Liability Insurance

a. Worker’s Compensation - Insurance to protect the Consultant, its contractors and subcontractors from all claims under Worker’s Compensation and Employer’s Liability Acts, including Longshoremen’s and Harbor Worker’s Act (“Acts”), if applicable. Such coverage shall be maintained, in type and amount, in strict compliance with all applicable state and Federal statutes and regulations.

The Consultant shall execute a certificate in compliance with Labor Code Section 1861, on the form provided in the Contract Documents.
b. Consultant shall provide a Waiver of Subrogation endorsement in favor of the City, its officers, officials, employees, agents and volunteers for losses arising from work performed by the Consultant.

2. Commercial General Liability Insurance
a. The insurance shall be provided on form CG0001, or it’s equivalent, and shall include coverage for claims for bodily injury or property damage arising out of premises/operations, products/completed operations, contractual liability, and subconsultant’s work and personal and advertising injury resulting from actions, failures to act, or operations of the insured, or by its employees or agents, or by anyone directly or indirectly employed by the insured. The amount of insurance coverage shall not be less than $1,000,000.00 per occurrence and $2,000,000 general and products/completed operations aggregates. b. The commercial general liability insurance shall also include the following:
20 Kimley Horn and Associates, Inc.

CPE24-361 Engineering Design Services Stone Blvd. Extension Expires on 1/15/28
7 11.4.2024
i. Endorsement equivalent to CG 2010 0714 naming the City, its officers, officials, employees, agents, and volunteers as additional insureds. The endorsement shall contain no special limitations on the scope of protection afforded to the City, its officers, officials, employees or volunteers.
ii. Endorsement stating insurance provided to the City shall be primary as respects the City, its officers, officials, employees and any insurance or self insurance maintained by the City, its officers, officials, employees or volunteers shall be in excess of the Consultant’s insurance and shall not contribute with it, to the payment or satisfaction of any defense expenses, loss, or judgment.
iii. Provision or endorsement stating that the Consultant’s insurance shall apply separately to each insured against whom claim is made or suit is brought, except with respect to the limits of the insurer’s liability.

3. Commercial Automobile Insurance
a. The insurance shall include, but shall not be limited to, coverage for claims for bodily injury or property damage for owned, non-owned, and hired automobiles resulting from actions, failures to act, or operations of the insured, or by its employees or agents, or by anyone directly or indirectly employed by the insured. The amount of insurance coverage shall not be less than $1,000,000.00 per accident.
b. The commercial automobile insurance shall include the same endorsements required for the commercial general liability policy (see Section

16.B.2.b).

4. Professional Liability. The Consultant and its contractors and subcontractors shall secure and maintain in full force, during the term of this Contract and for five years thereafter, professional liability insurance policies appropriate to the respective professions and the work to be performed as specified in this Contract. The limits of such professional liability insurance coverage shall not be less than $1,000,000 per claim.

C. In addition to any other remedy the City may have, if Consultant fails to maintain the insurance coverage as required in this Section, the City may obtain such insurance coverage as is not being maintained, in form and amount substantially the same as is required herein, and the City may deduct the cost of such insurance from any amounts due or which may become due Consultant under this Contract.

D. No policy required by this Contract shall be suspended, cancelled, terminated by either party, or reduced in coverage or in limits unless Consultant has provided thirty (30) days prior written notice by certified mail, return receipt requested, to the City.

E. Any deductibles or self-insured retentions in excess of $10,000 must be declared to, and approved by, the City.
21 Kimley Horn and Associates, Inc.

CPE24-361 Engineering Design Services Stone Blvd. Extension Expires on 1/15/28
8 11.4.2024

F. The requirement as to types, limits, and the City’s approval of insurance coverage to be maintained by Consultant are not intended to, and shall not in any manner, limit or qualify the liabilities and obligations assumed by Consultant under the Contract.

17. MISCELLANEOUS PROVISIONS:

A. Consultant shall keep itself fully informed of, shall observe and comply with, and shall cause any and all persons, firms or corporations employed by it or under its control to observe and comply with, applicable federal, state, county and municipal laws, ordinances, regulations, orders and decrees which in any manner affect those engaged or employed on the work described by this Contract or the materials used or which in any way affect the conduct of the work.

B. Consultant shall not engage in unlawful employment discrimination. Such unlawful employment discrimination includes, but is not limited to, employment discrimination based upon a person’s race, religious creed, color, national origin, ancestry, physical handicap, medical condition, marital status, gender, citizenship, or sexual orientation.

C. Consultant shall maintain and make available for inspection by the City and its auditors accurate records of all of its costs, disbursements and receipts with respect to any work under this Contract. Such inspections may be made during regular office hours at any time until six (6) months after the final payments under this Contract are made to the Consultant.

D. This Contract constitutes the entire agreement between the parties relative to the services specified herein and no modification hereof shall be effective unless and until such modification is evidenced by a writing signed by both parties to this Contract. There are no understandings, agreements, conditions, representations, warranties or promises, with respect to this Contract, except those contained in or referred to in the writing.

E. All notices that are required to be given by one party to the other under this Contract shall be in writing and shall be deemed to have been given if delivered personally or enclosed in a properly addressed envelope and deposited in a United States Post Office for delivery by registered or certified mail addressed to the parties at the following addresses:

City: City of West Sacramento
Attn to: David Wong
1110 West Capitol Avenue
West Sacramento, CA 95691
Email: [email protected]

Consultant:

Kimley Horn and Associates, Inc.

Attn to: Sherina Lam
555 Capitol Mall, Suite 300
Sacramento, CA 95814
Email: [email protected]

22 Kimley Horn and Associates, Inc.

CPE24-361 Engineering Design Services Stone Blvd. Extension Expires on 1/15/28
9 11.4.2024
F. This Contract shall be interpreted and governed by the laws of the State of California.

G. Any action arising out of this Contract shall be brought and maintained in Yolo County California, regardless of where else venue may lie.

H. In any action brought by either party to enforce the terms of this Contract, each party shall be bear responsibility for its attorney’s fees and all costs regardless of whether one party is determined to be the prevailing party.

I. ELECTRONIC TRANSMISSION OF CONTRACT AND SIGNATURE. By electronically signing this document in electronic form, Parties agree that this Agreement may be transmitted and signed electronically by all Parties, and that such signatures shall have the same force and effect as original signatures, in accordance with California law and regulations, including but not limited to Civil Code Section 1633.7
[Signatures on following page]
23 Kimley Horn and Associates, Inc.

CPE24-361 Engineering Design Services Stone Blvd. Extension Expires on 1/15/28
10 11.4.2024

CITY OF WEST SACRAMENTO
By: __________________________
Amanda Berlin, Assistant City Manager
ATTEST:

By: _______________________
Jennifer Cusmir, City Clerk
APPROVED AS TO FORM:

By: _______________________
Jeffrey Mitchell, City Attorney
Kimley-Horn and Associates, Inc.

By: _________________________
Parag Mehta, PE, Vice President
24 Kimley Horn and Associates, Inc.

CPE24-361 Engineering Design Services Stone Blvd. Extension Expires on 1/15/28

EXHIBIT A
Consultant Proposal
25 Prepared by:

Prepared for:

Engineering Services for the
Design of Stone Boulevard
Extension Project
#24-071-RFP

PROPOSAL FOR
26 City of West Sacramento | RSCASACR002789.2024
Table of Contents
A. Proposal Transmittal Letter .................................................................................................................. 1 B. Proposer’s Mandatory Qualifications and Experience ......................................................................... 3 C. Proposer’s Project Understanding ...................................................................................................... 13 D. Technical Project Approach ................................................................................................................ 17 Project Schedule ....................................................................................................................................... i E. Cost Proposal ..................................................................................................... Separate Upload per RFP Appendix ...................................................................................................................................................... iv Signatory Authority .................................................................................................................................. iv Business License ..................................................................................................................................... v 27 City of West Sacramento | RSCASACR002789.2024 Page 1 A.Proposal Transmittal Letter
November 27, 2024
David Wong, Principal Engineer
City of West Sacramento
1110 W Capitol Ave
West Sacramento, CA 95691
RE: Proposal for Engineering Services for the Design of Stone Boulevard Extension Project; #24-071-RFP
Dear Mr. Wong and Members of the Selection Committee:

The City of West Sacramento (City) intends to develop the Stone Boulevard Extension project to provide a critical multimodal network component that would encourage development and growth in this riverfront real estate area. One of the primary challenges is the required railroad approval for the new road extension segment over an existing railroad track at the Jefferson Boulevard/Stone Boulevard intersection. Kimley-Horn offers a dedicated, multidisciplinary team with proven capabilities to meet the technical and managerial challenges of advancing railroad-involved multimodal transportation projects that minimizes footprint and impacts while addressing current environmental regulations for clearance. Our team members have been involved in the successful completion of numerous at-grade crossing and multimodal improvement projects across the state involving all phases of the project life cycle. Our success is built on developing innovative solutions, strong local partnerships that engage stakeholders, managing project risks, and indepth knowledge of the project delivery and railroad approval processes.

Our team’s project manager, Sherina Lam, P.E., QSD/P, is a professional engineer with 20 years of experience working on transportation projects of various sizes and complexity, including railroad crossings, such as the 24th Street Bridge Replacement and Rainier Avenue Cross-Town Connector.

She will be supported by Kevin Aguigui, PE, TE, EE, CSEP, on Railroad Crossing Design and Coordination, who brings his unique combination of expertise specifically on railroad at-grade crossings and his hands-on railroad preemption and traffic signal design experience. Our Environmental Lead, Alex Jewell, AICP, LEED AP, recently completed the Initial Study/Mitigated Negative Declaration with Sherina for the Adobe Road and Main Street Intersection Improvements in Sonoma County and our Lead for Utilities, Drainage and Water Quality, Tyler Whaley, PE, QSD/P, ENVSP, has experience in both public improvements and private development projects so he will understand and work with the City to balance the needs of the developing parcels with public expenditures when it comes to constructing underground facilities of an extension with planned future connections. Ravi Puttagunta, our Traffic Lead, has expertise in modeling at-grade crossing intersections for approval and is a leader in developing traffic management within constrained environments.

Sherina will work proactively with the Kimley-Horn team and subconsultant partners to allocate staffing and appropriate team members to meet project milestones and adapt to project changes. Parag Mehta, P.E., our Principal-in-Charge, is a trusted team partner who will coordinate with Sherina to make sure that she receives the appropriate support at every project phase.

The following subsections address each of the City’s required responses in the order in which they were requested.

A. Proposer’s Name and Contact.

Kimley-Horn & Associates, Inc. is pleased to provide this proposal. Please contact our proposed project manager, Sherina Lam, PE, Civil Engineer, at 916.859.3657 or [email protected] or at the address listed on the above regarding our submittal.

B. Statement of Offer.

Kimley-Horn is pleased to offer this proposal, including our cost proposal (rates and budget) to compete the scope of services for this project. Our proposal remains valid for ninety (90) business days.

C. Conflict of Interest.

To the best of our knowledge, Kimley-Horn does not have any financial, business, or other relationship with the City of West Sacramento that may have an impact on the outcome of this contract. In addition, to the best of our knowledge, Kimley-Horn does not have any current clients who may have a financial interest in the outcome of this contract or any City construction project that will follow. Should we become aware of any conflict of interest, we will immediately advise the City.

D. City Contract Terms.

Kimley-Horn has reviewed and accepts the City’s standard contract and insurance without qualification. 555 Capitol Mall
Suite 300
Sacramento, CA 95814
TEL 916.585.8500
28 City of West Sacramento | RSCASACR002789.2024 Page 2 E. Subcontractors
Aim Consulting, Inc. (AIM)
Outreach Support
2600 Capitol Ave, Suite 440
Sacramento, CA 95816
[email protected]
916.442.1168
Blackburn Consulting
Geotechnical Engineering and Geo-Environmental
2491 Boatman Avenue
West Sacramento, CA 95691
[email protected]
916.849.1732
ICF
Environmental
980 9th Street, Suite 1200
Sacramento, CA 95814
[email protected]
916.737.3000
Monument
Right of Way Services and Utility Coordination
3626 Fair Oaks Blvd, Suit 100
Sacramento, CA 95864
[email protected]
916.397.8893
UNICO Engineering
Survey and Right of Way Documents
80 Blue Ravine Rd, Suite 250
Folsom, CA 95630
[email protected]
530.417.6722
F. Signature and Authority.

Parag Mehta is empowered to bind Kimley-Horn to the provisions of the RFP and any contract awarded pursuant to it. Evidence of his authority is provided in the Appendix.

Sincerely,
KIMLEY-HORN AND ASSOCIATES, INC.

Sherina Lam, PE, QSD/P Parag Mehta, PE
Project Manager Associate with binding authority
29 City of West Sacramento | RSCASACR002789.2024 Page 3 B. Proposer’s Mandatory Qualifications and Experience

ORGANIZATION
Kimley-Horn is a privately held corporation, fully owned by individuals who are current employees of the firm. Founded in 1967, Kimley-Horn has grown from a small group of traffic engineers and transportation planners to a firm of more than 8,200, with 134 offices nationwide, including 13 in California. Our growth is the result of the firm’s commitment to integrity and dedication to providing quality services. We provide our clients with the local knowledge and responsiveness of a small organization, backed by the depth of resources only a national firm could offer.

The map to the right depicts our office locations statewide and identifies our project office location in Sacramento, just two miles from the City’s offices. Kimley-Horn holds a City of West Sacramento business license, State of California business license, and each of our key staff hold licenses that can be found on their resumes as part of the Personnel section in this proposal.

EXPERIENCE
As demonstrated in our similar project experience section below, Kimley-Horn team has been performing the services required for similar scope of services in Sacramento area and throughout CA. We are well prepared to address all aspects of the contract to enable the successful completion of this project. Our key personnel assigned to perform the Scope of Services have a minimum of five years of professional experience in California.

Public Agency Experience

SAN JOAQUIN COUNTY DEPARTMENT OF PUBLIC WORKS
(SJCDPW), BOGGS TRACT SUSTAINABLE TRANSPORTATION
IMPROVEMENTS, STOCKTON, CA. 2023 – ONGOING
Kimley-Horn completed the environmental clearance and is developing the final design for the bicycle and pedestrian network from the Board-adopted Boggs Tract Sustainable Transportation Plan that Kimley-Horn led in collaboration with SJCDPW, City of Stockton, Port of Stockton, Caltrans and involvement from the Boggs Tract Community that became the roadmap for the non-vehicular mobility network in the community. The plan established a shared vision for transforming a community historically isolated by highways and industrial areas into a community that is connected via multi-modal pathways to amenities, education and job opportunities, and other important local destinations to enhance the quality of life for the residents of Boggs Tract. The plan includes two key components, bicycle and pedestrian infrastructure for access to key destinations such as the community center and school, and a planned greenspace within the SR 4 airspace for community gathering. The current plans, specifications and estimates (PS&E) focuses on the much-needed bicycle and pedestrian improvements for enhancing the residents' quality of life and access to opportunities. In parallel, the project has submitted an ATP grant application for the construction. From planning to construction, the project phases have been delivered under the requirements of Caltrans Local Assistance.

Key Staff: Sherina Lam, Parag Mehta, Ravi Puttagunta, Katie DeMaio (AIM), Ryan Ming (Unico)

ALAMEDA COUNTY TRANSPORTATION

COMMISSION, RAIL SAFETY ENHANCEMENT
PROGRAM (RSEP), ALAMEDA COUNTY, CA. 2020 -

ONGOING
Kimley-Horn is providing environmental clearance and design services for Alameda CTC’s RSEP, which includes designing safety improvements for pedestrians, bicyclists, and vehicles at 45 UPRR at-grade crossings in eight local jurisdictions in Alameda County, from Berkeley to Hayward and Livermore as well as working closely with UPRR, CPUC, Federal Railroad Administration (FRA), the program management consultant, and the local agencies. The program has an aggressive schedule that Alameda CTC is targeting to put the project forward to meet funding grant deadlines. This is one of the most significant grade crossing programs in the state conceived to accommodate the significant growth of rail traffic and includes significant safety improvements and upgrades to all of the crossings, including the installation of the latest railroad standards and best practices. Working closely with the UPRR, CPUC and FRA, Kimley-Horn is in the final 30 City of West Sacramento | RSCASACR002789.2024 Page 4 design stages for this high priority program which includes extensive safety improvements, railroad preemption, queue cutters, and bringing all of the crossings up to current railroad standards and CA MUTCD requirements at some of the most impacted crossings in the country.

Key Staff: Kevin Aguigui, Alex Jewell, Ace Malisos, Tyler Whaley CITY OF PASO ROBLES, 24TH STREET BRIDGE

REPLACEMENT PROJECT (OVER UNION PACIFIC RAILROAD),

EAST/WEST PEDESTRIAN IMPROVEMENTS AND SEWER
RELOCATION, PASO ROBLES, CA.
2022 – ONGOING
This federally funded bridge replacement project includes environmental and engineering services for bridge over UPRR and roadway design, intersection improvements, geotechnical investigation, preliminary right of way engineering, railroad coordination, and environmental documentation and permitting. The replacement project has been environmentally cleared and is in the final design and right of way phase. Project requires coordination with the Caltrans Division of Local Assistance, State Event Center and Union Pacific Railroad (UPRR), and has received conditional approval from UPRR. Sherina, our proposed Project Manager, has been working on the replacement project since its inception and continues to support the City of Paso Robles as a subconsultant for project management, civil design, and right of way, utility and railroad coordination. The East/West Pedestrian Improvements and Sewer Relocation projects are contracts between the City and Kimley-Horn. Leveraging our understanding of the site, the bridge replacement project and City process, Kimley-Horn has completed design of pedestrian improvements on the east and west sides of the bridge project, and is currently scoped to assess the sewer relocation from the pump station east of the overhead bridge.

Key Staff: Sherina Lam, Parag Mehta, Tyler Whaley, Jennifer Cole (Monument) CITY OF SUNNYVALE, MARY AVENUE EXTENSION PROJECT, SUNNYVALE, CA. 2020 – ONGOING
Kimley-Horn is responsible for the preparation of an EIR, traffic analysis, and conceptual design for the new Mary Avenue Overcrossing. The overcrossing will extend from the existing terminus of Mary Avenue at Almanor Avenue, north over State Route 237 and U.S. Highway 101, to the existing intersection at 11th Avenue and Discovery Way. The EIR will evaluate four different design options that range from a four-lane Mary Avenue with sidewalks and pedestrian lanes to removing the roadway extension from the General Plan. The overcrossing will be required to have sufficient height to cross over the highways, connect to the existing VTA Light Rail station, and align with the existing intersections to create new intersections with appropriate geometries. All design options include modal design considerations. Key environmental issues include aesthetics, traffic and transportation, low impact design, and community outreach.

Key Staff: Alex Jewell
CITY OF STOCKTON, WEST LANE SECTION 130 UPRR AT-GRADE CROSSING IMPROVEMENTS, STOCKTON, CA 2023 – ONGOING
Kimley-Horn is preparing the detailed designs for UPRR at-grade crossing improvements on West Lane in the City of Stockton. The project, funded through the Section 130 Program includes new railroad warning devices, new track crossing panels, new sidewalks (based on UPRR’s latest sidewalk guidance and requirements), new signing and striping, modifications to the existing medians, and the installation of a queue cutter traffic signal with railroad preemption interconnect. The project involves close coordination with UPPR, CPUC, Caltrans (including their Section 130 team and Local Programs) and the City of Stockton.

Key Staff: Kevin Aguigui
CITY OF SAN RAFAEL, ANDERSEN DRIVE SONOMA MARIN AREA RAIL TRANSIT (SMART) ATGRADE CROSSING, SAN RAFAEL, CA. COMPLETED IN 2021 Kimley-Horn prepared the detailed designs for the modifications to an at-grade crossing to accommodate the Sonoma Marin Area Rail Transit (SMART) commuter rail extension into the City of Larkspur. Kimley-Horn’s services ranged from detailed designs through construction, railroad preemption testing and a quiet zone implementation for a new grade crossing along the SMART line working closely with the CPUC, SMART, the Federal Railroad Administration (FRA), Caltrans and the City of San Rafael. Kimley-Horn completed a detailed traffic operations analysis and identified the intersection and roadway geometry improvements, which included traffic signal modifications, re-striping, bike and pedestrian crossings, blank-out signs, video monitoring, and the installation of railroad preemption.

Key Staff: Kevin Aguigui
31 City of West Sacramento | RSCASACR002789.2024 Page 5 CITY OF SUNNYVALE, SECTION 130 MARY AND EVELYN AVENUE GRADE CROSSING IMPROVEMENTS (CALTRAIN AND UPRR GRADE CROSSING), SUNNYVALE, CA. COMPLETED IN 2023
Kimley-Horn worked with the City of Sunnyvale on a federally funded project to implement safety improvements at the intersection of Mary Avenue and Evelyn Avenue. The improvements included the reconstruction of existing sidewalk just north of Caltrain grade crossing, reconstruction of existing raised concrete median, installation of ADA-compliant curb ramps, realignment of the crosswalk to reduce pedestrian crossing distance, traffic signal modification necessary to accommodate crosswalk realignment and curb ramp upgrade, traffic signal phasing adjustment, and signal timing adjustment to accommodate advanced railroad preemption. Kimley-Horn’s services included the design of the improvements, calculation of advanced preemption timing, coordination with Caltrain, CPUC, Caltrans, and the City, and preparation of GO 88-B application for submittal to CPUC. BESS provided potholing services.

Key Staff: Kevin Aguigui
Additional City of West Sacramento Project Highlights

CITY OF WEST SACRAMENTO, CMSR FOR I STREET BRIDGE REPLACEMENT AND I STREET BRIDGE DECK CONVERSION, WEST SACRAMENTO, CA. 2024 – ONGOING As an extension of the City of West Sacramento Capital Projects Department, Kimley-Horn has been supporting the City with project management and submittal review for the two projects. The I Street Bridge Replacement is currently at 95% design and our team have been reviewing documents provided by the City of Sacramento's design consultant. The I Street Bridge Deck Conversion is currently at 30% design. As the City's CMSR for this project, our team collaborates with the City to advance the two projects with the City's interests in the forefront.

CITY OF WEST SACRAMENTO, HSIP TRAFFIC SAFETY

PROJECT, WEST SACRAMENTO, CA
Kimley-Horn supported the City to identify traffic safety improvements through extensive review of both the Statewide Integrated Traffic Records System (SWITRS) data and the City’s crash database. In examining the crash data, a general trend of crashes was observed at signalized intersections citywide making up more than half of all collisions that occurred within the City during the study time frame. The highest collision locations were ranked by their collision frequency and severity and then the top 20 locations were reviewed in greater detail for potential improvements which would address collision trends.

In addition to the projects showcased above, Kimley-Horn is pleased to have provided consulting services to the City of West Sacramento since 2019.

Existing contractual relationships and contracts within the past five years are listed below, as requested:
• Roadway Priority Matrix (2024)
• Neighborhood Pavement Preservation (2024)
• CMSR I Street Bridge Replacement (2024)
• CMSR I Street Bridge Deck Conversion (2024)
• Clarksburg Branch Line Trail Project (2024)
• Project Management Services for I Street Bridge Replacement (2023)
• On-Call Grant Writing Services (2022)
• Plug-In Partnership Program - EV Charging Stations Design (2021)
• HSIP Traffic Safety Improvements (2020)
• West Gateway Phase II - Traffic Analysis Services (2021) • West Sacramento On-Call Traffic and Transportation
Engineering (2020)
• Review of PG&E Plans (2020)
• Harbor Boulevard Retiming (2019)
32 City of West Sacramento | RSCASACR002789.2024 Page 6

PERSONNEL
The organizational chart below delineates the roles and responsibilities of Kimley-Horn’s staff. Our project team is unsurpassed in local knowledge and relevant experience and have been structured to provide strong support to the City’s project manager. On the following pages we have included brief resumes for our key staff, including our Project Manager, Sherina Lam, who will lead the day-to-day work effort and serve as the primary contact.
33 City of West Sacramento | RSCASACR002789.2024 Page 7 Resumes
Sherina Lam, PE, QSD/P
Project Manager
Sherina is an experienced civil engineer. Her experience includes management and design of projects ranging from CIP projects on a local level, bicycle and pedestrian improvements, Caltrans interchanges to bridge replacement projects, bridge and roadway widening projects, land development projects, CM/GC and designbuild projects. Project scopes have varied from design starting at the conceptual stage with trip generation and traffic reports, preliminary geometrics design, to complete PS&E and construction support.

RELEVANT EXPERIENCE
• San Joaquin County Department of Public Works, Boggs Tract Sustainable Transportation Improvements, Stockton, CA. 2023 – Current. Project Manager
• City of West Sacramento, CMSR for I Street Bridge Replacement and I Street Bridge Deck Conversion, West Sacramento, CA. 2024 – Current. Project Manager
• City of Paso Robles, 24th Street Bridge (over Union Pacific Railroad), East/West Pedestrian Improvements and Sewer Relocation, Paso Robles, California. 2022 – Current. Project Manager • County of Sonoma, Adobe Road and Main Street Intersection Improvements, Sonoma County, California. 2022 – Current.

Project Manager
• City of Tracy, I-205/Lammers Road/11th Street Interchange, Caltrans Local Assistance and Design Support, Tracy, CA. 2022 – Current. Project Manager
• City of Petaluma, Rainier Avenue Cross – Town Connector, Petaluma, CA. 2018 – 2022. Project Manager/Engineering Lead Parag Mehta, PE
Principal-in-Charge
Parag has 34 years of proven project management and
operational experience marketing and delivering large
consulting engineering contracts for transportation
infrastructure planning and design projects. Parag has
experience managing planning, design and construction
phases of various highway improvement projects involving interchange improvements, roadway design and bridge structures. His responsibilities have ranged from project manager to design engineer on feasibility studies, conceptual and preliminary engineering, construction documents preparation, and construction phase design support. He is a skilled manager of both people and projects. He enjoys working in a team environment and strives for a team approach to the management of project conceptualization, developments, and approval.

RELEVANT EXPERIENCE
• San Mateo County Transportation Authority (SMCTA), US 101/SR 92 Interchange Direct Connector, San Mateo and Foster City, CA. 2023 – Current. Project Manager
• Sonoma County Transportation Authority (SCTA), Category A: Project Development Services, Santa Rosa, CA. 2022 – Current.

Contracts Manager
• Napa Valley Transportation Authority (NVTA), Project Approval and Environmental Document (PA&ED) for American Canyon State Route 29 Corridor Improvement Project, American Canyon, CA. 2024 – Current. Project Manager • MTC, SR 37 PSR-PDS and Design Alternative Assessment (DAA), Marin/Sonoma/Solano/Napa Counties, CA. 2017 – 2019.

Project Manager
• Santa Clara Valley Transportation Authority (VTA), SR 237/Lawrence Expressway/Java Drive Interchanges Improvement Project, San Jose, CA. 2022 – Current. Project Manager
• Alameda CTC, I-880 Interchange Improvements (Winton Ave/A St) PID and PAED, Hayward and Union City, CA. 2018 – Current.

Project Manager

EDUCATION
• Bachelor of Science, Civil
Engineering, Concordia University
• Professional Engineer, California
#70994
• Qualified SWPPP Developer/
Practitioner, #23028
• WTS Sacramento Chapter,
Mentorship Chair, Board Member

EDUCATION
• Masters, Civil Engineering, University of
Michigan-Ann Arbor
• Masters, Management, Northwestern
University
• Bachelors, Civil Engineering, Manipal
Institute of Technology
• Professional Engineer in California
#66638
• American Council of Engineering
Companies (ACEC) Board Member
34 City of West Sacramento | RSCASACR002789.2024 Page 8 Kevin Aguigui, PE, TE, EE,
CSEP
Railroad Crossing Design and Coordination
Kevin is a Senior Project Manager with over 25 years of experience in the evaluation, planning, design, implementation oversight and testing of numerous traffic and transportation projects. His main focus is in the areas of railroad and light rail at-grade crossings and preemption systems, traffic engineering and design, intersection, roadway, and corridor safety improvements, ITS, electrical system design, traffic signal timing, communications systems, and BRT and transit signal priority systems. He has prepared and managed the PS&E documents for numerous at-grade crossings, traffic signal and intersection improvements, interchanges, and freeway managed lanes. He is an active member of the ITE Grade Crossing Committee, has served as a technical specialist for numerous municipalities, and is the Co-Chair, ITE Task Force on the updates to the Recommended Practice on Preemption of Traffic Signals Near Railroad Grade Crossings.

RELEVANT EXPERIENCE
• Alameda CTC, Rail Safety Enhancement Program (RSEP) (45 UPRR grade crossings), Alameda County, CA. 2020 – Current.

Project Manager
• Contra Costa County, Byron Highway/Camino Diablo Intersection Improvements (UPRR Grade Crossing), Contra Costa County, CA. 2013 – 2018. Lead Design Engineer/Project Manager • City of Stockton, West Lane UPRR Grade Crossing Improvements and Queue Cutter, Stockton, CA. 2023 – Current. Project Manager • City of San Rafael, Sonoma Marin Area Rail Transit (SMART) Andersen Drive Grade Crossing and Queue Cutter, San Rafael, CA. 2015 – 2019. Lead Design Engineer
• City of San Rafael, SMART Grade Crossings Queue Cutters at 2nd, 3rd, 4th, 5th, and Mission Streets (five crossing locations), San Rafael, CA. 2022 – Current. Project Manager
Ravi Puttagunta
Traffic and Intersection Operations
Ravi has more than 33 years of experience in traffic and transportation engineering. He has worked and managed
traffic impact studies to major transportation engineering projects. His experience includes traffic analysis, interchange operations, express lanes analysis, freeway simulation, traffic impact studies, preliminary planning studies, feasibility studies, signal coordination studies, and multimodal transit. Ravi has been project manager and technical lead for a wide variety of traffic/transportation engineering projects in California, Nevada, and Washington states, as well as other parts of the country. He has extensive experience and a thorough knowledge of traffic/ transportation engineering software, including, Synchro/Sim-Traffic, TRAFFIX VISTRO, HCS, CAPSI, VISSIM and CORSIM.

RELEVANT EXPERIENCE
• County of Sonoma, Adobe Road and Main Street Intersection Improvements, Sonoma County, California. 2022 – Current.

Traffic Lead
• City of Tracy, I-205/Lammers Road/11th Street Interchange, Traffic Support, Tracy, CA. 2023 – Current. Traffic Lead • City of Paso Robles, 24th Street Bridge (over Union Pacific Railroad), Paso Robles, California. 2022 – Current. Traffic Lead • San Mateo County Transportation Authority (SMCTA), US 101/SR 92 Interchange Direct Connector, San Mateo and Foster City, CA. 2023 – Current. Traffic Lead
• SJCOG, I-205 Managed Lanes PA&ED, Tracy, CA. 2020 – Current. Task Manager • Santa Clara VTA, US 101/SR 25 Interchange Improvements Phase 1 PS&E and SR 152 Trade Corridor, Santa Clara County, CA. 2023 – Current. Project Engineer
• Alameda CTC, San Pablo Avenue Multimodal Corridor Study, Oakland, CA. 2017 – Current. Project Engineer • TAM, NB US 101 and EB I-580 Direct Connector PID & PA&ED, Larkspur and San Rafael, CA. 2019- Current. Project Engineer

EDUCATION
• Master of Engineering, Structural
Engineering, Annamalai University, India
• Master of Science, Transportation
Engineering, University of Saskatchewan
• Bachelor of Engineering, Civil, Mysore
University, India

EDUCATION
• Bachelor of Science, Civil Engineering,
University of Hawaii at Manoa
• Professional Civil Engineer in California
#48732
• Professional Traffic Engineer in California
#1781
• Professional Electrical Engineer in
California #19888
• Certified Systems Engineering
Professional (CSEP) #00156
35 City of West Sacramento | RSCASACR002789.2024 Page 9 Alex Jewell, LEED AP
Environmental/CEQA
Alex has 25 years of experience in the preparation and review of environmental documents for a wide variety of public and private land development projects throughout California, including small subdivisions and larger single-family residential developments. He has specific experience with infill residential and industrial development projects, and the environmental issues common to that type of development, such as traffic, land use compatibility, air quality, and noise. As an Environmental Services Project Manager at Kimley-Horn, his responsibilities include the management of Environmental Impact Reports, Mitigated Negative Declarations, Initial Studies, and other environmental documents for adequacy under the California Environmental Quality Act (CEQA), and other federal, state, and local laws, as well as coordinating reviews of technical studies. In his role as project manager, he works closely with agency staff, project stakeholders, business and community interests, and decision makers to develop comprehensive, defensible environmental documents.

RELEVANT EXPERIENCE
• AC Transit, Alameda County, Rapid Corridor Design, San Pablo, CA. 2019 – Current. Environmental Task Manager • City of Rocklin, Rocklin Road/Pacific Street Roundabout, Rocklin, CA. 2016 – Current. Environmental Project Manager • City of Roseville, Washington Avenue/All American Avenue Roundabout, Roseville, CA. 2019 – Current.

Environmental Project Manager
• City of Marina, Imjin Parkway Widening Project, Marina, CA. 2016 – 2022. Environmental Planner • County of Stanislaus, HSIP Grant Design of Striping, Curve Assessments and Signage, Modesto, CA. 2019 – Current.

Environmental Task Lead
Tyler Whaley, PE, QSD/P,
ENV-SP
Utility & Drainage Design/Water Quality/SWPPP
Tyler has over 20 years of engineering experience on a wide range of projects in the private and public sector. He has managed numerous assignments over the years and has
knowledge in wastewater design, stormwater calculations, mitigation, and drainage design and has worked on a variety of projects utilizing these skills. He has provided technical advice for several sanitation districts and municipal utility departments to form wastewater improvement strategies. His technical expertise includes a broad variety of civil engineering design aspects including grading, drainage, utility design, along with extensive knowledge of hydrology and hydraulics, and water quality standards. His innovative approach to drainage and water quality design includes experience with low-impact development (LID), hydromodification, green streets, and large watershed studies.

RELEVANT EXPERIENCE
• Downtown Railyards Ventures, Railyards Drainage and Stormwater Quality Master Plans, Sacramento, CA. 2023 – Current.

Senior Engineer
• SmithGroup, Kaiser Sacramento Railyards Medical Center, Sacramento, CA. 2023 – Current. Project Manager • Downtown Railyards Ventures, Sacramento Railyards Unit No.1 Construction Documents, Sacramento, CA. 2023 – Current.

Senior Engineer
• VTA, Bascom Avenue Complete Streets Project, San Jose, CA. 2022 – Current. Senior Engineer • City of Union City, Union City Boulevard Bike Lane – Drainage and Bioretention Design, Union City, CA. 2019 – Current.

Senior Engineer
• City of Lincoln, Engineering Design Services on the East Joiner Parkway Widening Project, Lincoln, CA. 2018 – 2022.

Project Engineer
• City of Hollister, Trash Capture Projects H10 and I12, Hollister, CA 2023 – Current. Project Manager • Alameda CTC, Rail Safety Enhancement Program (RSEP), Alameda County 2020 – Current. – Senior Engineer • San Rafael Sanitation District, Third Street Sewer Repair, San Rafael, CA 2020 – Current. Project Manager

EDUCATION
• Bachelor of Arts, Environmental Studies,
University of California, Santa Barbara
• AICP #116000

EDUCATION
• Bachelor of Science, Civil and
Environmental Engineering, California
State University, Long Beach
• Professional Engineer in California
#74848
• Qualified SWPPP Developer/Practitioner
#74848
36 City of West Sacramento | RSCASACR002789.2024 Page 10 Subconsultants
In an effort to provide the City with the depth of resources necessary to seamlessly complete this project, Kimley-Horn has teamed with several skilled and experienced subconsultants to complement our in-house team. These firms are not only talented from a technical standpoint, but also have an understanding of the local environment and strong working relationships with members of the Kimley-Horn team. Brief profiles and relevant project experience of our teaming partners are provided below.

Firm Name/Role Overview and Related Experience
AIM Consulting, Inc. (AIM)
Outreach Support
AIM offers strategic communications and public participation consulting services. With over 30 years of experience, their team develop public participation programs that bring diverse community members together and creates a space for constructure dialogue through earned/paid media, social media, presentations, and grassroots awareness campaigns. AIM is experienced in right-sizing outreach efforts and appropriately project message for building consensus with stakeholders. • City of Sacramento, I Street Bridge Replacement
• West Sacramento, I Street Bridge Lantern Festival
• SACOG, Regional Mobility Hub Design Guidance
Blackburn Consulting
(Blackburn)
Geotechnical Engineering and
Geo-Environmental
Blackburn provides geotechnical, geo-environmental, materials testing, and construction inspection services. They specialize in roadways, bridges, public infrastructure, water/wastewater treatment plants, tanks, parks, buildings, landslide mitigation, levees, and dams. Blackburn has significant experience performing geotechnical engineering and hazardous material testing in the City of West Sacramento, and fully understands the requirements of both work and deliverables. • West Sacramento, Riverfront Street Extension
• West Sacramento, I Street Bridge Deck Conversion
• West Sacramento, Yolo Bypass Levee
ICF
Environmental - Biological and
Cultural Resources
Global consulting and technology services provider, ICF prepares environmental documentation for CEQA and NEPA and permit applications prior to construction. They have provided environmental consulting and planning services to local agencies and governments, and state and federal agencies for more than 50 years, and has worked for the City of West Sacramento for decades. • West Sacramento, Broadway Bridge
• West Sacramento, Pioneer Bluff
• West Sacramento, I Street Bridge Replacement
Monument
Right of Way Services and Utility
Coordination
Monument is a full-service right of way company who services local, state and federal agencies, transportation authorities and engineering partners with public infrastructure projects. • West Sacramento, Riverfront Street Extension
• West Sacramento, I Street Bridge Replacement
• West Sacramento, South Riverwalk Extension Project
Unico Engineering (Unico)
Survey and Right of Way
Documents
Unico provides high quality construction management, engineering and land surveying services. Their team has the technology and experience to address any survey needs, including, topographic mapping, hydrographic surveys, ALTAs, boundary surveys, construction staking, easements, aerial surveys, right of ways, terrestrial LiDAR scanning and drone surveying. • West Sacramento, Sidewalks and Transportation Equity Program • West Sacramento, Southport Parkway Truck Route Pavement Rehabilitation • West Sacramento, West Capitol Avenue Roadway Rehabilitation 37 City of West Sacramento | RSCASACR002789.2024 Page 13 C.Proposer’s Project Understanding
The Stone Boulevard Extension Project is an exciting opportunity for the City to develop critical infrastructure that supports development of sustainable community growth in the Pioneer Bluff and Stone Lock Districts. This extension was identified as a key circulation component by the Pioneer Bluff Transition Plan and the Pioneer Bluff and Stone Lock Reuse Master Plan, and in January 2024, it was added to the City of West Sacramento General Plan (GP) 2035 Policy Document's Mobility Element Document. A California Environmental Quality Act (CEQA) Findings of Fact and Statement of Overriding Considerations amendments to the Circulation Diagram in the Mobility Element was prepared in the 2024 Mobility Element that included specific goals that they City have established for their new and modified roadways. Major elements of this mobility document include more complete streets, "greening" opportunities and consideration for access to public transit.

The City's vision for Pioneer Bluff and Stone Lock is a vibrant waterfront of mixed land uses achieved through the steps of deindustrialization of the existing brownfield, repurposing the site for land development and promoting building development.

The strategy to accomplish the City’s vision aims to balance public and private interests while adding value to the Districts' real estate. Advancing the Stone Boulevard extension under Phase II of the Master Plan would be an important step in the City's efforts to provide connections to the Pioneer Bluff area. The extension would be a new access into and out of the southern Pioneer Bluff area from the east side of Jefferson Boulevard crossing the UPRR track along the westerly limits of the District.

SITE OVERVIEW
Whereas both Jefferson Boulevard and South River Road on both ends of the extension are City truck routes that allow California Legal vehicles, Stone Boulevard is not identified as a truck access route. At the locations where the new roadway connects to the existing network, Jefferson Boulevard is signalized while South River Road is not. On the east side of South River Road where the new intersection would be formed, there is an existing driveway that provides access to the City Parks Operations office, a City-owned parcel (APN 058-260-019). In fact, the City of West Sacramento own three more parcels to the north which could benefit the project when coordinating potential access modifications. There is an existing signal on South River Road approximately 200 feet south of this connection point that serves the gated access of Taylor Heavy Hauling (APN 058-260-001 and 058- 260-002) that would be impacted due to its proximity to the new intersection. See the Constraints and Opportunities Overview Exhibit on the next page for locations of above elements and discussions in this section.

MOBILITY AND MULTIMODAL CONNECTIVITY
The extended Stone Boulevard is classified as an east-west 2-lane Collector with a speed limit of 25 to 35 mph that should consists of:
• Bike lanes and parking lanes
• Sidewalks on both sides with landscaping
• An 80-foot right of way
The extension is part of a comprehensive and connected roadway network that considers the needs of all users that include pedestrians, bicyclists, transit riders and automobiles. According to the 2018 West Sacramento Bicycle, Pedestrian, and Trails Master Plan (2024 Update), one bicycle-vehicle involved collision occurred between 2011 and 2016. Since that time, there was one pedestrian-vehicle involved collision that resulted in fatality with pedestrian violation cited as the reason from our search of the UC Berkeley Transportation Injury Mapping System (TIMS) database. The Kimley-Horn team recognizes the emphasis the City places on connectivity and safety for pedestrian and bicycle access, especially within this area where the Clarksburg Branch Line Trail located south of this project is planned to ultimately connect with the Riverwalk Trail, Tower Bridge, Washington District and the future converted I Street Bridge that will only serve pedestrians and bicyclists crossing the Sacramento River.

According to the Reuse Master Plan Appendix S,
Mobility Network Cross-Sections, Stone Boulevard
was intended to include a parking lane adjacent to a
bike lane with one travel lane in each direction.

However, the City has provided new guidance since
the development of this plan under the Mobility
Element Document Goal M-7 where access for
people and goods movement should be prioritized
over parking. Our team will collaborate with the
City to establish a cross section that could
improve multimodal access by reconsidering
on-street parking at this time of the Pioneer
Bluff development when there are no
storefronts. We recognize that it is generally
easier to add park than remove parking.
38 City of West Sacramento | RSCASACR002789.2024 Page 14 39 City of West Sacramento | RSCASACR002789.2024 Page 15 Public Transit
While the Capitol Corridor rail service traverses through the West Sacramento, there are no stations in the City and the nearest one is the Sacramento Valley Station in downtown Sacramento. YoloBus is the local transit operator in the City. Route 37 runs Jefferson Boulevard south of the project and on Stone Boulevard to the west of the project intersection as shown on the Constraints and Opportunities Overview Exhibit. This route's key destination is downtown Sacramento where travelers have additional choices to the Bay Area via rail or direct bus (FlixBus).

The Kimley-Horn team will coordinate with YoloBus to discuss future route plans, potential stop locations or relocations, and access for the extended Stone Boulevard. With a new road segment, we will support the City and YoloBus to implement design features that would foster increased transit use.

Overall, the extended Stone Boulevard and modified intersection of Jefferson Boulevard and Stone Boulevard would increase multimodal travel options to the riverfront and transit hubs.

INTERSECTIONS AND ACCESSIBILITY
As part of the design process, our traffic team, led by Ravi Puttagunta, proposes to perform an evaluation of the intersection control types for the new Stone Boulevard connection with South River Road. The intersection control types will include stopcontrolled, signal and roundabout, consistent with Mobility Element Document's Goal M-3.

The project is anticipated to impact Taylor Heavy Hauling's operations due to the need for right of way from the parcel, so we will work closely with the City in early discussions to better understand the owner's options for this land immediately post-construction which would help with identifying right of way and access impacts.

On the west side of the extension, Jefferson Boulevard is relinquished State Route 84 that serves as a 4-lane arterial with direct access to Highway U.S. (US) 50 approximate 1 mile north of the project. The existing pedestrian curb ramps and median refuges do not meet the requirements of the Americans with Disabilities Act (ADA) and they would be upgraded to be compliant. There is an existing Sierra Northern Railway (SERA) track that traverses from the east side of Jefferson Boulevard diagonally southwest then parallels the Barge Canal on the west side of the project. The SERA track also splits into a spur that continues to run adjacent to Jefferson Boulevard and ends approximately 1,200 feet south of the separation. A short segment was part of the abandonment authority in January 2005 and the City owns the parcel (APN 067-180- 005) 400 feet south of the intersection. Across the region, the agencies in Yolo County have developed a potential rail realignment plan that would remove the Sierra Northern Railway (SERA) segment within the project limits.

RAILROAD COORDINATION AND APPROVAL
Our team recognizes that successful delivery of this project will be how the modification of the existing traffic signal at Jefferson Boulevard/Stone Boulevard is handled, particularly the involvement and coordination with SERA and possibly Union Pacific Railroad (UPRR).

The existing signalized T-intersection consists of sidewalks on both sides of Stone Boulevard and the west side of Jefferson Boulevard with crosswalks on the west and south legs of the intersection while the active railroad track (SERA) traverses diagonally between the northeast and the southwest corners. The east leg extension would create a crossing over the existing north-south track that runs on the east side of Jefferson Boulevard. Our strategy will leverage the planned removal of existing tracks immediately adjacent to Jefferson Boulevard that currently show signs of unuse or abandonment and propose to remove the rails and ties as part of this project in order to design for the ultimate configuration of the east leg extension. This would require the placement of new automatic gates, cantilevers and traffic signal poles.

Additionally, modifications to the traffic signal phasing and the railroad preemption will be necessary. We will coordinate this effort directly with the railroad operators and the California Public Utilities Commission (CPUC).

Kevin Aguigui, our Railroad Crossing Design and Coordination Lead, not only possesses extensive railroad at-grade crossing experience, but his expertise also includes hands-on signal design requiring railroad preemption phasing and railroad equipment where he has worked extensively with the UPRR and CPUC preemption 40 City of West Sacramento | RSCASACR002789.2024 Page 16 specialists. Based on our understanding of the site and operations, our approach would be a request to modify an existing railroad crossing through the CPUC under a General Order 88-B (GO 88-B).

UTILITIES AND RIGHT OF WAY
The Reuse Master Plan included recommendations for sewer, water and drainage infrastructure for the redevelopment area. Tyler Whaley will be leading our team's efforts on utility design and working with the City to verify the master plan recommendations. He has delivered projects for both public agencies and private developers so he is able to consider utility improvements needs from both perspective that will benefit the future expansion of the districts.

In addition to the utilities under the Reuse Master Plan, our team will work with the City to install conduits for fiber optics along the new roadway for future City connection. The project will include street lighting along Stone Boulevard. Our objective is to strategically place streetlights in a pattern that accommodates the two planned intersections and minimizes rework when the two intersections are constructed.

It is our team's understanding that improvements should be limited to primarily within the Taylor Heavy Hauling parcels along the extension with impacts to the northern parcel at the intersection and the railroad corridor. Within Taylor Heavy Hauling, there are two buildings that will likely be affected and require testing for asbestos and lead paint. Ground hazardous material testing is anticipated given the industrial nature of this area.

We have partnered with two firms who are very familiar with this location, Blackburn Consulting to perform contaminant testing and ICF to support the City with tribal consultation with any ground-disturbance activities, consistent with many City public projects that involve subsurface work.

ENVIRONMENTAL IMPACTS
It is our assessment that the appropriate level of documentation under the California Environmental Quality Act (CEQA) is the Initial Study/Mitigated Negative Declaration (IS/MND). Our environmental led, Alex Jewell, will partner with ICF for assessment of biological resources and cultural resources along with Assembly Bill (AB) 52 tribal consultation. The project is anticipated to incur over 2 acres of impervious new surface, as such, our team will review and incorporate low impact development (LID) elements and post-construction best management practices (BMPs) that comply with the requirements of the City and Central Valley Regional Water Quality Control Board (CVRWQCB) Phase II Small Municipal Separate Storm Sewer System (MS4) Program. A comprehensive environmental approach is described in the Technical Approach section.

FUTURE IMPROVEMENTS, OPERATIONS AND MAINTENANCE (O&M)
We understand that the City's goal is to establish the roadway network that encourages development. It is important to identify, at the early stage, the various elements of this new extension that the City would like to construct immediately, which components will be delivered by the developers, and what the short-term and long-term O&M requirements are. Items such as landscaping, trees planting and fencing should be discussed with the internal departments that include Public Works, Community Development and Parks & Recreation, so concerns, recommendations and considerations for developer responsibilities could be part of the project's design strategy. 41 Kimley Horn and Associates, Inc.

CPE24-361 Engineering Design Services Stone Blvd. Extension Expires on 1/15/28

EXHIBIT B
Scope of Work
42 DETAILED SCOPE OF SERVICES FOR STONE BOULEVARD EXTENSION PROJECT Task 1. Project Management & Coordination
This scope of services is developed based on an 18-month project schedule from project kick-off to final plans, specifications and estimate (PS&E).

Task 1.1. Project Meetings
Consultant will hold a virtual kick-off meeting, with the City and Consultant to review and refine the work scope, schedule, and fee, identify critical milestones, and determine appropriate paths of communication prior to beginning work.

Consultant project manager will prepare a baseline schedule of work and conduct monthly halfhour meetings (up to 14) with the City to discuss progress and address upcoming tasks. Baseline schedule will be updated to reflect project progress on a monthly basis.

Consultant will setup and facilitate monthly virtual Project Development Team (PDT) meetings with the City Project Manager and Department representatives that may include Real Estate, Community Development and Public Works. The monthly meeting may be repurposed for interagency meetings, field reviews, stakeholder meetings, technical, design review and other project meetings. Consultant will prepare agendas, meeting material, minutes, and sign-in sheets for these meetings for distribution to the attendees (up to 14 meetings with project manager and two leads for specific discussions).

Consultant will attend up to ten (10) general coordination meetings. These meetings include City Council meetings and two (2) City Commission meetings as well as separate meetings for local neighborhoods and interested community groups, including existing ad-hoc committee. Outreach meetings will be held to address public concerns and ideas for the design and implementation of the project.

Task 1.2. Reporting and Invoicing
Consultant will submit monthly invoices with progress reports and project schedules consistent with City requirements. The invoices will itemize the costs by tasks and subtasks, including identification of each employee or subconsultant staff that provided services during the period of the invoice, number of hours and hourly rates for each employee or subconsultant staff member, authorized travel expenses with receipts, receipts for authorized materials or supplies, and subcontractor invoices. The progress reports will include the following information:
• Status of work completed to date
• Work anticipated to be completed in the next reporting period • Key findings and decisions made
• Problems/Obstacles identified during the reporting period • Estimated percentage of completion for each deliverable 43 Task 1.3. Agency/Subconsultant Coordination and QC/QA Consultant will coordinate with subconsultants and involved agencies to support the timely flow of information for each task activity. Consultant will establish QC/QA procedures and make sure that subconsultants are adhering to the process.

Task 1 Deliverables
- Meeting agendas, materials, minutes and sign-in sheets - Monthly invoices and progress reports
- Project schedule and updates
Task 2. Data Collection and Review
Consultant will request, collect and review existing available data that includes as-built drawings, adopted plans and policies, prepared and approved documents in-progress work products and information of other projects in the project vicinity. Consultant will highlight conditions that may impact the final design and work with the City on potential solutions during this project phase.

Task 3. Topographic and Right of Way Mapping
Consultant will perform topographic and right of way mapping and utility research, develop existing utility mapping and positively identify utility locations.

Survey Control
For mapping, Consultant will work with the City to identify the approved project control consistent with current and future projects in the vicinity. Local City of West Sacramento horizontal (NAD83), and vertical (NGVD29) control derived from City of West Sacramento Geodetic Control Network – GPS Static Survey Recorded in Book 13 at Pages 61-69, Yolo County Records will be used. Control research will be conducted to tie the survey and mapping services for this project into the desired control. A project control sheet will be prepared which will include the primary horizontal and vertical control. Control sheet will include northings, eastings, elevations, basis of bearing, datum and utilized benchmarks.

Topographic Surveys and Mapping
Consultant will perform detailed (non-aerial) topographic surveying for an approximately 1800-footlong strip along the existing and proposed portion of Stone Boulevard from approximately 500 feet west of the Jefferson Boulevard intersection to South River Road. The width of the strip will be sufficient for design of the Stone Boulevard extension and will include topographic surveys and mapping along two private properties between Jefferson Boulevard and South River Road and sufficient information at the South River Road intersection for conform. Features to locate will include roadway improvements, sidewalks, curbs, gutters, lip of gutter, edge of pavement, crowns, grade breaks and drainage. Roadway cross-sections will be located at 50’ intervals or closer to include grade breaks and curve points. Consultant will locate conforms, drainage facilities, fences, driveways, poles, roadway signs and streetlights. Visible utilities within the limits such as water, 44 sanitary sewer, storm drain, petroleum, gas, electric, telecommunication, fiber, and other visible utilities will be surveyed. Consultant will provide measurements to all sewer and drainage facilities to include pipe size, invert elevation and flow direction. Topographic surveys and mapping along the railroad corridor will be performed to locate rails and railroad features for the proposed extension. Consultant will mobilize to locate potholes following excavation and map locations into the main base file. UNICO will perform base mapping of topographic information to include planimetrics, 1’ contours and digital 3D surface. The topographic data will be mapped in AutoCAD, including a digital terrain model (DTM) and 3D surface of the existing ground surface and survey points in ASCII format.

During the design phase, additional supplemental topographic surveys may be necessary for conforms, utilities, or for other final design purposes. Consultant will assume 2 days of field work for supplemental surveys and mapping.

Right of Way Mapping
Consultant will obtain mapping and documentation from City and Yolo County to survey and map the right of way and adjoining properties along the project alignment. Recorded survey maps, deeds, corner records and other necessary documentation will be researched. A right of way and boundary base map will be prepared to assist with searching for monuments and right of way boundaries. GPS and conventional surveys will be performed to locate right of way monuments, pipes, street monument wells, pins and other boundary markers necessary to resolve and map the right of way and adjoining parcels. An overall (LAND NET) base map will be prepared as the basis of the right of way and parcel boundaries that will include ownership and parcel information. Base map will be prepared with sufficient detail and accuracy to be applicable to the development of plats and legal descriptions during later phases of the project. Consultant will purchase four (4) title reports as needed for the project for properties that may be impacted by the project to fully understand right of way, dedications and easement concerns.

Task 3 Deliverables
- Survey Control Report and Control Sheet
- Topographic Base Files in AutoCAD Civil 3D and Points Files - Right of Way and Boundary Base Map
- Title reports (4)
Task 4. CEQA Environmental Documentation
Consultant will prepare an Initial Study/Mitigated Negative Declaration (IS/MND) under the California Environmental Quality Act (CEQA) with supporting technical studies and support the City with tribal consultant under AB 52.

Technical Studies
Consultant will prepare the following technical studies. 45 Biological Resources
Aquatic Resources Delineation
The project area has potential to support wetland and non-wetland water bodies (aquatic resources) along the east side of the railroad alignment.

Consultant will conduct a delineation of waters of the United States (U.S.) and waters of the State to map any aquatic resources in the project area using the routine on-site determination method described in the 1987 USACE Wetlands Delineation Manual, incorporating supplemental guidance provided in the 2008 Regional Supplement to the Corps of Engineers Wetland Delineation Manual:

Arid West Region. The delineation will be conducted by two staff during the field day for the reconnaissance-level survey. Delineation of any non-wetland waters of the U.S. will be conducted in accordance with the 2008 Field Guide to the Identification of the Ordinary High-Water Mark (OHWM) in the Arid West Region of the Western United States.

Consultant will delineate, map, and document the boundaries of potential waters of the U.S. be in accordance with the Sacramento District’s Minimum Standards for Acceptance of Preliminary Wetland Delineations Aquatic Resources Delineation Reports (January 2016) and the Updated Map and Drawing Standards for the South Pacific Division Regulatory Program (February 10, 2016). If any aquatic resources are identified in the project area, Consultant will compile and present the collected data in an aquatic resources delineation report in compliance with Sacramento U.S. Army Corps of Engineers’ (USACE) standards at the time the delineation is conducted. Consultant will submit its final report to USACE for verification with a request for a Preliminary Jurisdictional Delineation in accordance with Regulatory Guidance Letter 16-01. A copy of the submittal request will be sent to the City. Consultant will attend one (1) field meeting with USACE to verify the delineation results and respond to comments from USACE.

Biological Study
Consultant will obtain a list of federally listed species with potential to occur in the project area from the U.S. Fish and Wildlife Service (USFWS) Information for Planning and Conservation website.

Lists of special-status species from the California Natural Diversity Database and California Native Plant Society Online Database will also be obtained.

Consultant will conduct a reconnaissance-level survey in the project area to determine the potential for special-status wildlife species based on existing habitats present. Consultant will conduct a botanical survey in the project area in April of 2025 to capture the blooming periods of spring-blooming special-status plant species with potential to occur in the project area. If the area is determined to have potential for summer-blooming special-status plants, we will conduct an additional, half-day botanical survey in July.

In conjunction with the reconnaissance-level surveys, Consultant will characterize vegetation communities and map all elderberry shrubs (if present) in the project area in accordance with the USFWS 2017 Framework for Assessing Impacts to the Valley Elderberry Longhorn Beetle.

Consultant will complete an inventory of trees that could be removed or trimmed for project construction. The City of West Sacramento tree ordinance requires a permit for trimming or 46 removal of all street trees, regardless of size, as well as native oak and heritage trees (trees with a circumference of 75 inches or more). The west end of the proposed project alignment at the intersection of Stone Boulevard and Jefferson Boulevard and along the railroad contains trees that could be protected by the ordinance. For the inventory, ICF will map, tag, identify species, and measure the diameter of all trees in the project impact limits.

Consultant’s field surveys will be conducted by one wildlife biologist and one botanist/wetland ecologist for one partial day to conduct the reconnaissance field survey and aquatic resources delineation (described above); one botanist for one partial field day to conduct one round of botanical surveys; two botanists for one partial day to conduct a second botanical survey, if necessary; and two staff for one partial field day to conduct the tree survey.

Consultant will summarize the results of the aquatic resources delineation, botanical surveys, wildlife habitat assessment, and tree inventory in a technical report. The report will include an assessment of impacts on biological resources from one build alternative and recommend mitigation measures where appropriate.

Permitting is dependent on the results of the biological surveys and can be added as an amendment once the determination is made.

Cultural Resources
Consultant will define the limit of study for cultural resources based on the engineer-provided limits of temporary and permanent ground disturbance for the build alternative, other project activities, and the proximity of potentially sensitive resources to the project footprint. The study area will define the limits of the record search, archaeological survey, built-environment survey, and CEQA analysis.

Consultant will request that the Northwest Information Center at Sonoma State University conduct a records search and submit its results to ICF in PDF and GIS shape files. ICF will request a search of the Native American Heritage Commission (NAHC) Sacred Lands database. If needed, the City will contact the Yolo County Assessor to facilitate access to the building characteristic and appraisal records. ICF will conduct up to one day of archival research.

Consultant will prepare tribal consultation request letters for City review. Consultant will prepare letters to be mailed by the City to initiate AB 52 consultation with up to three (3) tribes that have requested such consultation. Consultant will participate in up to two (2) meetings with tribal representatives, and will conduct follow-up emails and phone calls to tribal representatives to help facilitate consultation, as appropriate.

It is assumed that the City will lead and keep a log of all tribal consultations under AB 52, and that the City will provide all results of AB 52 Tribal Consultation needed to inform the Tribal Cultural Resources section of the CEQA document.

Cultural Resources Survey and Inventory Report
Consultant will conduct an archaeological survey of the project study area and a review for built resources. If no archaeological resources are identified from the records search or during the 47 survey (the assumed outcome), we will document in the report the “negative” results. No supplemental documentation or subsurface investigations will be conducted and we will determine the project has no adverse effects on archaeological resources.

Based on a preliminary review of the project area, it appears that up to four properties will require evaluation or an updated evaluation for listing in the California Register of Historical Resources (CRHR): the Union Pacific Railroad, two industrial properties, and the water treatment facility.

Consultant will complete three historic context statements for the evaluation of the resources and complete Department of Parks and Recreation (DPR) 523 form sets to evaluate the CRHR eligibility, summarize previous findings of significance and establish historic boundaries, and identify contributing elements and character-defining features. Additional research and mapping will be performed up to the hours provided. The information provided in the report will be written for use in the Cultural Resources section of the CEQA document.

The scope assumes that no historical resources eligible for listing will be identified as a result of the work conducted.

Hazardous Materials
Consultant will prepare a Phase I Environmental Site Assessment (ESA) that follows ASTM E1527- 21, Standard Practice for Environmental Site Assessment: Phase I Environmental Site Assessment Process, to assess whether potential sources or indications of hazardous materials conditions are present within or adjacent to the project corridor.

Consultant will review published literature for geology and groundwater conditions within the project limits, available information by others, and on-line regulatory databases GeoTracker (State Water Resources Control Board) and EnviroStor (Department of Toxic Substances Control (DTSC)) for known impacts and/or previous environmental data that exists in the project area. Consultant will research historical material that include aerial photography, maps and commercial databases for indications of sources for hazardous and/or potentially hazardous materials.

Consultant will conduct a site reconnaissance to observe current land use and indications of potential hazardous material contamination on or adjacent to the project limits. This includes documentation of areas showing evidence of surface staining, storage, dumping, handling, and mixing areas for hazardous materials (such as pesticides and fuel products), and apparent locations of fuel tanks and wells.

Consultant will prepare a Phase I ESA that includes:
• General site description
• General geology, groundwater, and surface/subsurface conditions • Findings of our document reviews, owner interviews, site reconnaissance, historical evaluations, and regulatory records reviews
• Location and general extent of known or suspected contamination on or adjacent to the project limits, as applicable
• Recommendations for further investigation and analysis, if necessary 48 Air Quality (AQ)/Greenhouse Gas (GHG) Emissions
The assessment of air quality emissions will be conducted in accordance with the Yolo-Solano Air Quality Management District’s (YSAQMD’s) recommended methodologies set forth in the District’s Handbook for Assessing and Mitigating Air Quality Impacts. The following outlines our approach:

Construction Emissions. Consultant will calculate construction emissions using the most current version of the California Emissions Estimator Model (CalEEMod). Emissions will be calculated based on the scope of the project, applicant-provided assumptions regarding construction equipment and scheduling, and associated vehicle trips. The air pollutant emissions during construction will be compared to the YSAQMD thresholds of significance. Construction-related emissions reduction practices will be identified as necessary.

Operational Emissions. Consultant will quantify operational emissions associated with occasional worker trips and maintenance activities. Project emissions will be compared to the YSAQMD’s thresholds of significance.

Plan Consistency. Consistency of the project’s regional emissions will be evaluated against the YSAQMD’s clean air plan. The determination of Clean Air Plan consistency is primarily concerned with the long-term influence of a project on air quality in the Yolo-Solano area.

Odors. Consultant will provide a qualitative odor analysis from construction and operation of the proposed project.

GHG Reduction Plan Consistency. The GHG analysis will evaluate the project’s potential contribution to cumulative impacts environmental effects of climate change and whether the project would affect the state’s ability to achieve established GHG reduction goals. The analysis will discuss the potential global climate change impacts, the effects of GHG emissions, and GHG emissions regulations in California. The analysis will evaluate consistency with the City’s Climate Action Plan and compliance with the latest applicable policies in the Climate Action Plan, and other applicable regional/statewide GHG emissions reduction strategies such as the California Air Resources Board (CARB) Scoping Plan.

No public meeting or hearing is anticipated.

Noise and Vibration
Consultant will prepare the noise and vibration assessment which will quantify both construction and operational noise levels as follows:

Existing Conditions/Regulatory Framework. Noise standards regulating noise impacts will be discussed for land uses on and adjacent to the project site. Consultant will conduct a site visit throughout the project site and short-term (i.e. ten minute) noise level measurements will be taken along the project area. The noise monitoring survey will be conducted at up to six separate locations to establish baseline noise levels in the project area.

Construction Noise. Noise impacts from construction sources will be analyzed based on the anticipated equipment to be used, length of a specific construction task, equipment power type (gasoline or diesel engine), horsepower, load factor, and percentage of time in use. The 49 construction noise impacts will be evaluated in terms of maximum levels (Lmax) and hourly equivalent continuous noise levels (Leq) and the frequency of occurrence at adjacent sensitive locations.

Vibration. An analysis of construction vibration impacts will be based on the Federal Transit Administration’s vibration analysis guidance. Analysis requirements will be based on the sensitivity of the area, specific construction activities, and Noise Ordinance specifications.

Operational Noise. On-site noise impacts will be assessed against the City’s Safety Element of the General Plan. Stationary noise sources will be quantitatively assessed. On- and off-site noise impacts from vehicular traffic will be assessed using the U.S. Federal Highway Traffic Noise Prediction Model (FHWA-RD-77-108). The 24-hour weighted Community Noise Equivalent Levels (CNEL) will be presented in a tabular format. On-site noise generating activities will also be addressed and analyzed for potential impacts to the adjacent uses. Mitigation measures will be identified, if necessary.

Energy Impacts
Consultant will evaluate if the proposed project changes would result in energy implications of the project pursuant to Public Resources Code Section 21100(b)(3) and Appendix F of the CEQA Guidelines and CEQA Guidelines Section 15126.2(b). These statutes and guidelines require the analysis to describe, where relevant, the wasteful, inefficient, and unnecessary consumption of energy caused by a project. The analysis will analyze energy consumption associated with shortterm construction activities, long-term operations, and transportation related energy during construction and operation. Project energy consumption related to electricity, natural gas, and transportation fuel for vehicle trips as well as the fuel necessary for project construction will be quantified.

This analysis will be discussed in the IS/MND.

CEQA Documentation – Initial Study/Mitigated Negative Declaration (IS/MND) Administrative Draft IS/MND. Consultant will complete the Initial Study (IS) in accordance with CEQA Guidelines Section 15063 and IS Checklist (Appendix G) in the CEQA Guidelines and in accordance with City of West Sacramento format/procedural requirements.

The IS and environmental checklist will form the basis for the environmental analysis discussion and will provide the necessary background for determining the potential for significant environmental effects associated with the proposed project.

Each of the topics identified on the environmental assessment form contained in the State CEQA Guidelines will be evaluated to document the nature and extent of any potential environmental consequences and the need for mitigation. Many of the issue areas addressed in the IS will not have the potential for significant effects (i.e., “No Impact” or “Less than Significant Impact”) due to the type and size of the proposed project. The document will address any potential impacts under all environmental issues. The specific purpose of the analysis in the IS will be to identify all potential significant adverse environmental impacts and incorporate mitigation measures to reduce or eliminate any adverse consequences.
50 The IS and environmental checklist will include the following 21 environmental issue areas included in the CEQA Guidelines Environmental Checklist:

1. Aesthetics

2. Agricultural and Forest Resources

3. Air Quality

4. Biological Resources

5. Cultural Resources/Tribal Cultural Resources

6. Energy

7. Geology and Soils

8. Greenhouse Gas Emissions

9. Hazards and Hazardous Materials

10. Hydrology and Water Quality

11. Land Use and Planning

12. Mineral Resources

13. Noise

14. Population and Housing

15. Public Services

16. Recreation

17. Transportation/Traffic

18. Tribal Cultural Resources

19. Utilities

20. Wildfire

21. Mandatory Findings of Significance
Technical studies prepared for the project will be provided as appendices.

Draft IS/MND. Based on the results of the analysis in the Administrative Draft by the City, Consultant will revise the IS/MND and prepare a Screencheck Draft IS/MND for final approval prior to public review. Consultant will respond up to two (2) rounds of City comments received on the Administrative Draft IS/MND.

Consultant will address final comments on the document and prepare the document the Draft IS/MND for public review.

Public Review/Public Distribution. Consultant will prepare the Office and Planning and Research Notice of Completion, Summary Form, and Notice of Intent as part of this task. This task assumes that City staff will distribute the Notices and Draft IS/MND to City departments, responsible agencies, and other interested parties to initiate the public review period and that City staff would be responsible for posting and/or noticing in the local newspaper. Consultant can assist in submitting to the State Clearinghouse.

Response to Letters of Comment. Upon completion of the 30-day public review period, Consultant will prepare written responses to the letters of comment received. All comments received in response to the IS/MND will be discussed with the City and an approach to the responses will be agreed upon prior to preparation of the responses. Draft responses to comments 51 will be submitted for City review. Once finalized, Consultant will provide copies of the responses to agencies and parties that provided written comments on the IS/MND. Consultant will revise the IS/MND in accordance with City requirements and prepare the final document. The Final IS/MND will include the necessary agreed upon revisions requested by staff or as a result of the public review process, letters of comment and responses, and the MMRP. Our scope assumes 36 hours of staff time for responding to comments.

Environmental Meetings. Consultant will meet with City staff to discuss particular project parameters, as needed, for the environmental documentation. We have included 40 hours of meeting time for the CEAQ document.

Mitigation Monitoring and Reporting Program (MMRP). In compliance with AB 3180 (PRC 21081.6), which requires the monitoring of mitigation measures and reporting their implementation to ensure compliance as part of specific project approvals, Consultant will prepare the Mitigation Monitoring and Reporting Program for the project. Implementation of the mitigation measures and the required monitoring would be linked to specific stages of project development to ensure that all mitigation measures are implemented.

Task 4 Deliverables
- Draft and Final CEQA Initial Study/Mitigated Negative Declaration (IS/MND) - Draft and Final Biological Resources Report with Aquatic Resources Delineation attached - Draft and Final Cultural Resources Inventory Report
- Draft and Final Phase I Environmental Site Assessment (ESA) - Draft and Final Air Quality and GHG Emissions Memorandum - Draft and Final Noise and Vibration Assessment Memorandum - Administrative Draft Initial Study/Mitigated Negative Declaration and Appendices - Draft Initial Study/Mitigated Negative Declaration and Appendices - Responses to Public Comments
- Final Initial Study/Mitigated Negative Declaration
- Notice of Completion/Notice of Intent/State Clearinghouse Summary Form - Mitigation Monitoring and Reporting Program
Task 5. Engineering Studies and Reports
Task 5.1. Geotechnical Engineering
Consultant will review readily available relevant geotechnical data for the project.

Consultant will perform subsurface exploration with the support of a private utility contractor to identify utilities at the proposed boring locations and obtain a Yolo County permit for the boring work. Consultant will drill two (2) borings to a total depth of 20 feet and one (1) boring to a total depth of 10 feet. Borings will be logged, and soil samples collected at 2 to 5 feet intervals. The borings will be backfilled with grout and drill cuttings will be disposed of offsite. Borings performed in paved areas will be patched with rapid set concrete dyed black. 52 Consultant will prepare a Geotechnical Report that includes:
• Subsurface soil and groundwater conditions
• Laboratory testing
• Expansive soil considerations
• Grading recommendations for site clearing and over-excavation (if necessary), subgrade preparation, compaction and over-optimum soil moisture considerations/mitigation • Hot Mix Asphalt (HMA) pavement design recommendations for roadway improvements for traffic indexes provided
• Foundation recommendations for railroad gate crossing structure for either spread footing or pier foundations
• Trench backfill including bedding and shading, re-use of site soil for backfill, import requirements (if needed), and relative compaction
• Trench excavatability and stability considerations and preliminary OSHA soil type • Pipe loading for both flexible and rigid pipe (as required) • Soil corrosion potential
• Risk management and limitations
It is assumed that:
• Written permission to enter/access private properties will be secured prior to marking and drilling borings on private property
• Access to the site is open Monday through Friday from 7 am to 5 pm to perform the marking for USA and perform subsurface exploration
• Site is accessible by a truck mounted drill rig and support trucks • Rapid set concrete dyed black is acceptable to repair pavement where borings are drilled • Saw cutting and hot mix asphalt concrete patches are not required for bore holes in pavement areas
• Consultant will be present to observe actual subsurface conditions exposed during construction to finalize recommendations
Task 5.2. Phase II Environmental Site Assessment (ESA)
Consultant will prepare a Phase II ESA that follows ASTM E1903-19, Standard Practice for Environmental Site Assessment: Phase II Environmental Site Assessment Process, to determine whether potential hazardous materials are present at the acquisition parcel at concentrations that require construction mitigation recommendations and/or soil management.

Consultant will perform soil sampling using a Photoionization Detector (PID) to monitor boreholes during subsurface exploration for up to four (4) locations on the western end of the site adjacent to the railroad tracks. Two (2) discrete samples will be collected in each boring, one each from 0 to 6 inches and 2.5 to 3 feet below ground surface (bgs), or until practical refusal at each sample location with hand auger equipment. Consultant will backfill hand auger borings with cuttings. Up to eight (8) soil samples will be tested for TPH gasoline/diesel/motor oil, Title 22 metals and chlorinated herbicides.
53 For the underground storage tank (UST) and groundwater sampling, Consultant will drill three (3) borings to a depth of 20 feet bgs or until first groundwater is encountered and collect soil samples at 5-foot intervals. Consultant will notify the Yolo County/City Inspector 48 hours in advance of drilling. Up to nine (9) soil samples and three (3) groundwater samples will be tested for TPH gasoline/diesel/motor oil, volatile organic compounds (VOCs) and LUFT metals (soil only).

For drains/shed structure soil sampling, Consultant will drill two (2) borings to a depth of 10 feet bgs, collect soil samples at 5-foot intervals and collect two (2) discrete samples in each boring, one each from 5 and 10 feet bgs. Consultant will notify the Yolo County/City Inspector 48 hours in advance of drilling. Up to four (4) soil samples will be tested for TPH gasoline/diesel/motor oil, VOCs and lead.

Consultant will prepare a Phase II Report that includes:
• Subsurface conditions
• Analytical laboratory test results
• Site plan showing approximate boring locations and boring logs • Conclusions and recommendations
Task 5.3. Not Used
Task 5.4. Drainage and Stormwater Analysis
Consultant will prepare a drainage report to document the proposed drainage design and potential impacts to the existing systems. This task includes the hydrologic and hydraulic analysis of the proposed storm drain line, assumed to be 24” in diameter based upon the Reuse Master Plan.

This task will also include the preparation of a Post-Construction Standard Plan to address runoff mitigation. As the project will create over 2 acres of new impervious surface, the design will be required to address post-construction stormwater requirements for water quality per the Central Valley Phase II MS4 program. It is assumed the roadway geometry will include bioretention planters to address the structural treatment measure requirements.

Consultant will prepare the risk assessment and bid item description for the Storm Water Pollution Prevention Plan (SWPPP). Based upon the new 2023 Construction General Permit we recommend that the preparation of the report and all associated field activities are carried by the contractor for compliance at the time of construction.

Task 5 Deliverables
- Draft and Final Geotechnical Report
- Draft and Final Phase II Environmental Site Assessment - Draft and Final Drainage Analysis Report
- Draft and Final Storm Post-Construction Standard Plan - SWPPP Risk Assessment and Bid Items
54 Task 6. Permits, Agreements and Coordination
Consultant will support the City in securing a Construction and Maintenance (C&M) agreement with the railroad owner, SERA. It is assumed that C&M Agreement will be between the City and SERA, and the agreement support will consist of, but not be limited to, the preparation of plat maps delineating the existing and new installations of infrastructure on railroad property as part of any license agreements for the new encroachments. Consultant will prepare the GO 88-B application package which will include the CPUC requirements such as existing and proposed railroad equipment, roadway profiles, applicable exhibits, railroad preemption calculations and related exhibits. The draft GO 88-B application will be prepared and submitted for review on or prior to the submittal of the 100% design submittal to the railroad and CPUC.

Consultant will support the City in securing agreements with non-City utility providers that include PG&E, Century Link, Comcast, Level 3, Verizon, XO Communications and Kinder Morgan, utilities which are known to operate in West Sacramento, if their facilities are impacted by the project.

Task 6 Deliverables
- Draft and Final GO 88-B Application Package
- Draft and Final Utility Agreements
Task 7. Utility Coordination
Consultant will coordinate with utility providers within the project limits that include Pacific Gas & Electric (PG&E), Comcast, AT&T, Wave Broadband, City of West Sacramento and Kinder Morgan.

Consultant will prepare required forms for owner notifications. Consultant will prepare utility conflict maps for development of utility potholing under Task 2. Consultant will prepare utility conflict maps, City relocation claim letters (up to 2), determine if utility companies hold prior rights for each conflicting utility, determine liability for facilities conflicting with the project (up to 2), prepare notice to owner to relocate (up to 2), prepare no-conflict letters for facilities not impacting proposed improvements and deliver close-out files. Consultant will attend coordination meetings (up to 5) to discuss potential impacts, relocations and liability.

No dry utility design will be prepared.

Task 7 Deliverables
- Utility Research Records
- Relocation Claim Letters (2)
- Liability Determination for Conflicting Facilities (2) - Notice to Owner to Relocation (2)
- No-Conflict Letters
55 Task 8. Railroad and CPUC Coordination
Consultant will lead coordination with the City, SERA, UPRR and CPUC for review and approval of the railroad crossing modifications. Initial step will be a virtual diagnostic meeting to discuss the proposed project, proposed approach to reviews and approvals and other items that are more appropriate in an office environment. Once the virtual meeting is conducted a field diagnostic meeting with all parties onsite will follow. This field meeting will focus on the field issues and any other items that will need to be considered in the design.

Consultant will lead efforts on documentation, review, approval and agreements between all parties, including any necessary right of entry permits to perform field work and technical studies surveys.

Task 9. Quiet Zone Coordination
Because the existing grade crossing is part of a Quiet Zone, Consultant will diligently preserve this designation by avoiding improvements that may jeopardize that designation. For this reason, Consultant will lead the coordination with the City, SERA/UPRR, CPUC and the Federal Railroad Administration (FRA), in order to maintain the existing quiet zone designation. This will include development of design elements and layouts that will be required as part of the intersection modification, and will serve to enhance and not inhibit the quiet zone designation.

Task 10. Right of Way Services
Plats and Legal Descriptions
Consultant will prepare plats and legal descriptions as needed for right of way, easements and temporary construction easements (TCE). The exact locations and number will be better understood upon design needs. It is assumed that a total of six (6) plats and legal descriptions will be needed. Consultant will prepare plats, legal descriptions and closure calculations for review.

Once approved, Consultant will prepare final signed and stamped PDF plats and legal descriptions.

Consultant will prepare all plats and legal descriptions according to City of West Sacramento standards.

Appraisals
Consultant will prepare appraisals for the acquisition of real property in accordance with the 49 CFR Part 24 and with the Uniform Standards of Professional Appraisal Practice (USPAP). A single “self-contained” appraisal report will be prepared for each property acquisition that will contain relevant project-related data, subject property information, market comparables, and an analysis of the appraiser’s value conclusions.

During the appraisal process, Consultant will perform the following tasks:
• Prepare appraisal scope, fees, and timing on a property-by-property basis. • Issue appraisal notices to property owners. Conduct field reviews of property issues with appraisers.
56 • Make weekly contact with appraisers to update progress. • Review appraisals for quality; request changes/additions as necessary or based on preliminary communication with the City.

All appraisals will contain the following requirements, at minimum:
• Adequate description of the physical characteristics of the property being appraised (and, in the case of a partial acquisition, an adequate description of the remaining property). • Items identified as personal property.
• Statement of location, zoning and present use, an analysis of highest and best use, a fiveyear sales history, and any known or observed encumbrances. • All relevant and reliable approaches to value consistent with established federal and federally assisted program appraisal practices. If the appraiser uses more than one approach, there is to be an analysis and reconciliation of approaches to value used that is sufficient to support the appraiser’s opinion of value. • A description of comparable sales, including a description of all relevant physical, legal, and economic factors such as parties to the transaction, source, and method of financing, and verification by a party involved in the transaction. • Statement of the value of the real property to be acquired and, for a partial acquisition, a statement of value of the damages and benefits, if any, to the remaining real property where appropriate.
• The effective date of valuation, date of appraisal, signature, and certification of the appraiser.

Appraisal fee for railroad property excludes any cost to obtain safety training that may be required by the Railroad.

Optional Standard Appraisal Reports (2). If rights are donated, an appraisal is still required unless the property owner explicitly releases the agency from their obligation to appraise the property rights. Two standard appraisal reports are included but listed as an optional service and Consultant will not appraise private properties without authorization from the City.

Acquisition and Negotiation
It is assumed that City of West Sacramento staff will conduct all acquisition/negotiation and escrow coordination activities .

Task 10 Deliverables
- Plats and Legal Descriptions (6)
- Appraisal Report Railroad Crossing (1)
- Standard Appraisal Reports (2 parcels) - Optional
57 Task 11. Design
Task 11.1. Preliminary Design (30%)
Consultant will prepare basic preliminary geometric approval drawings for City concurrence including layout, profile, typical sections, signal and lighting pole locations advanced to a 30% design level. Signal design will include modification of the Jefferson Boulevard/Stone Boulevard intersection. A minor street stop-controlled intersection is proposed at the South River Road/Stone Boulevard intersection, with roadway elements designed at the ultimate location for future signalization. A Preliminary Design Memorandum will be prepared to include brief narrative describing design criteria, railroad requirements, final design exceptions, if any, and decisions made by the PDT. We will perform a lighting analysis at the intersections and along the corridor.

We will prepare an engineer's opinion of probable costs.

Consultant will develop a landscape concept plan and preliminary materials palette based on the project theme, goals, objectives, site conditions and the requirements of the City. The plan will adequately describe the landscape concept and design intent, including written descriptions, graphics, and photographs to communicate the overall vision, theme, location and character of the project.

Consultant will hold one meeting with City staff on comments received on the 30% submittal package.

This scope assumes a budget for twenty (20) potholes under the base scope, and an additional ten (10) potholes under optional tasks, across the project intersections and corridor, separated into two sets of costs.

Task 11.2. Initial Design Submittal (60%)
Upon confirmation of the 30% geometric approval drawings, Consultant will proceed with design and preparation of a draft set of plans complete to the 60% level. We anticipate the following basic plan sheets will be provided.

Design Plans
Title Sheet
Project Control Sheet
General Notes
Typical Sections
Layout
Profile (crowned section)
Construction Details
Contour Grading
Drainage and Water Pollution Control
Utility Relocations (private utilities)
City Utilities
Construction Area Signs
Pavement Delineation and Signing
Quantities
58 Landscape and Irrigation
Signal and Lighting
Lighting and Fiber Optics
Consultant will incorporate and address comments received from 30% review, perform a constructability review and coordinate with PG&E for new service connection, if needed. Our goal will be to utilize existing City service cabinets if available. Consultant will prepare draft technical specifications and engineer's opinion of probable costs. Detailed stage construction is not anticipated.

Consultant will hold one meeting with City staff on comments received on the 60% submittal package.

Task 11.3. Revised Design Submittal (90%)
Consultant will proceed with design and preparation of a set of plans complete to the 90% level.

Consultant will incorporate and address comments received from 60% review. The 90% design submittal is a complete design submittal. Consultant will prepare draft final technical specifications and engineer's opinion of probable costs.

Consultant will hold one meeting with City staff on comments received on the 90% submittal package.

Task 11.4. Final Design Submittal (100%)
Consultant will proceed with design and preparation of a set of plans complete to the 100% level.

Consultant will incorporate and address comments received from 90% review. The 100% design submittal is a construction document submittal. The submittal includes two (2) half-size stamped and signed plans, one (1) full-size stamped and signed plans. Consultant will prepare final signed technical specifications and engineer's opinion of probable costs.

Digital files will be provided to the City.

Task 11 Deliverables
- 30% Preliminary Geometric Approval Drawings, Preliminary Design Memorandum, Lighting Analysis and Engineer's Opinion Of Probable Costs
- Utility Pothole Report
- Responses to 30% Review Comments
- 60% Plan, Draft Technical Specifications and Engineer's Opinion Of Probable Costs - Responses to 60% Review Comments
- 90% Plans, Draft Final Technical Specifications and Engineer's Opinion Of Probable Costs - Responses to 90% Review Comments
- 100% (Final) Plans, Final Technical Specifications and Engineer's Opinion Of Probable Costs 59 Task 12. Traffic Analysis
Consultant will perform traffic data collection as follows:
• AM and PM peak period intersection turning movement volumes at the proposed study intersections (up to 6) during a typical midweek day (Tuesday through Thursday), non-holidays, when schools are in session
• Perform field observations on the same day the intersection counts are conducted for existing intersection performance, congestion, queue lengths, and travel patterns • 24-hour hose counts for key segments (5 locations) during the same week for entire weekdays Consultant will prepare a traffic operation analysis methodology memorandum that document the approach for traffic data collection, existing conditions, developing volumes for opening year 2030 no build and build scenarios and selection of the software that will be used for performing the operational analysis.

Consultant will utilize Synchro/SimTraffic simulation software for am and pm weekday peak hour analysis. The recommended weekday peak hours will be finalized after we review the traffic counts collected for peak period (6-9 am and 4-7 pm). The peak hour will be selected based on highest volume hour within the peak period data collected. The proposed SimTraffic simulation model is capable of capturing the field conditions to match the served volumes, intersection operations (LOS and delay) and average/95th percentile queue lengths for each movement. SimTraffic simulation software is capable of analyzing pedestrian/bike conflicts, as well as oversaturated operating conditions caused by queue spillback from downstream segments/intersections. Even though SimTraffic may not capture the railroad crossing delay, Consultant will adjust parameters in the software to portray the delays caused by train operations. After completing the existing conditions analysis, memorandum will be prepared that includes analysis assumptions, intersection turning movement volumes, heavy vehicles, bicycles, pedestrians, and train frequency with gate downtime during both am and pm peak periods.

After approval of the existing conditions memorandum, Consultant will use the current SACOG SACSIM Travel Demand model (TDM) for assessing the potential impacts of vehicle miles traveled (VMT) the extension will have as part of the CEQA documentation. It is anticipated that the project will not induce VMT since the new road will likely redistribute the traffic and reduce some trip distances. Consultant will prepare a VMT assessment memo as part of CEQA documentation for agency review and approval. No verification of the existing SACSIM TDM is anticipated. The Build Condition is assumed to analyze project opening year no build and build conditions. The proposed Stone Boulevard extension was approved as a General Plan update and the project focus is on the change in travel pattern within the project influence area. The proposed analysis will focus on am and pm peak hours only.

Consultant will prepare an intersection control evaluation with the opening year volumes for the South River Road/Stone Boulevard intersection to determine the appropriate type of control, which includes stop-controlled, signal or roundabout. It is anticipated that a minor street (Stone 60 Boulevard) stop-controlled intersection will suffice for the opening year. A right-in/right-out may be needed at this location to operate as a stop-controlled intersection.

Consultant will utilize the calibrated Synchro/SimTraffic simulation software to perform AM/PM weekday peak hour analysis. Consultant will input the approved volumes for opening year no build and build conditions. In the opening year analysis, we will study the proposed lane geometry that incorporates bike lanes, pedestrian crossings, separate crossing gates for vehicular and bicycle traffic, and signal timing/phasing modifications. Consultant will collaborate with the City, Railroad and CPUC regarding intersection safety and operational improvements evaluation. The memorandum will include traffic counts, existing conditions calibration, and final results. No VISSIM simulation model will be performed. Consultant will prepare a traffic operational memorandum to summarize the operational analysis results.

Task 12 Deliverables
- Raw traffic count data
- Draft and Final Traffic Operation Analysis Methodology Memorandum - Draft and Final Existing Operations Calibration/Validation Memorandum - Draft and Final Intersection Control Evaluation
- Draft and Final VMT Assessment Memorandum
- Draft and Final Traffic Operational Analysis Memorandum Task 13. Building Asbestos-Containing Materials & Lead Testing (Optional) A California Certified Asbestos Consultant (CAC) and California Department of Public Health Certified Lead Inspector (CLI) will be retained to evaluate the presence of asbestos-containing materials (ACM) and lead at the existing structures. A visual assessment of each structure will be performed. ACM will be evaluated with the collection of up to 76 bulk samples analyzed by polarized light microscopy (PLM) and 160 samples analyzed by 400-point count for asbestos. Lead paint will be evaluated with the collection of up to 21 bulk paint chip samples that will be analyzed for lead by flame atomic absorption spectroscopy (AAS). Consultant will prepare a written report that identifies type, location, and estimated quantity of identified suspect ACM or lead materials that includes an abatement specifications for each structure identified as containing ACM and lead.

Consultant will not perform work under this task without authorization from the City.

Task 13 Deliverables
- Summary of Asbestos-Containing Materials and Lead Findings 61 Kimley Horn and Associates, Inc.

CPE24-361 Engineering Design Services Stone Blvd. Extension Expires on 1/15/28

EXHIBIT C
Schedule of Performance
62 ID Task Name Duration Start Finish
1 Notice to Proceed 0 days Mon 2/3/25 Mon 2/3/25
2 Final Environmental Document 0 days Fri 12/12/25 Fri 12/12/25 3 Preliminary Design (30%) 0 days Fri 5/30/25 Fri 5/30/25 4 PS&E 60% 0 days Fri 11/28/25 Fri 11/28/25
5 PS&E 90% 0 days Thu 4/16/26 Thu 4/16/26
6 PS&E Final (100%) 0 days Fri 9/18/26 Fri 9/18/26
7 Right of Way Acquisition 195 days Mon
11/24/25
Fri 8/21/26
8 Advertise for Construction 0 days Fri 2/5/27 Fri 2/5/27 9 Task 1 Project Management &
Coordination
650 days Mon 2/3/25 Fri 7/30/27
10 Task 2 Data Collection and Review 20 days Mon
2/10/25
Fri 3/7/25
11 Data Collection and Review 20 days Mon 2/10/25 Fri 3/7/25 12 Task 3 Topographic and Right of
Way Mapping
20 days Mon
2/10/25
Fri 3/7/25
13 Surveying and Utility Research 20 days Mon 2/10/25 Fri 3/7/25 14 Task 4 CEQA Environmental
Documentation
190 days Mon
3/24/25
Fri 12/12/25
15 Technical Studies 160 days Mon 3/24/25 Fri 10/31/25
16 Perform Field Surveys and
Record Searches
20 days Mon 3/24/25 Fri 4/18/25
17 Conduct Native American
Consultation
150 days Mon 4/7/25 Fri 10/31/25
18 Prepare Draft Cultural
Resources Study
30 days Mon 4/21/25 Fri 5/30/25
19 Draft Cultural Resources Study
Review
10 days Mon 6/2/25 Fri 6/13/25
20 Final Cultural Resources Study 15 days Mon 6/16/25 Fri 7/4/25 21 Phase I ESA 40 days Mon 4/21/25 Fri 6/13/25
22 Biological Resources 60 days Mon 4/21/25 Fri 7/11/25 23 Aquatic Resources Delineation 30 days Mon 5/5/25 Fri 6/13/25 24 Draft Environmental Document 115 days Mon 7/7/25 Fri 12/12/25 25 Prepare Draft CEQA Initial
Study/MND (ED)
20 days Mon 7/7/25 Fri 8/1/25
26 Submit Admin Draft ED to City 10 days Mon 8/4/25 Fri 8/15/25 27 Revise Admin Draft 10 days Mon 8/18/25 Fri 8/29/25
28 Submit Draft ED to City 10 days Mon 9/1/25 Fri 9/12/25 29 Revise Draft ED and Prepare for
Public Circulation
10 days Mon 9/15/25 Fri 9/26/25
30 Public Circulation of Draft ED 30 days Mon 10/6/25 Fri 11/14/25 31 Revise and Finalize ED with
MMPR
20 days Mon
11/17/25
Fri 12/12/25
32 Task 5 Engineering Studies and
Reports
200 days Mon 6/2/25 Fri 3/6/26
2/3/2025
Final Environmental Document 12/12/2025
5/30/2025
11/28/2025
4/16/2026
9/18/2026
Right of Way Acquisition
2/5/2027
Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec Jan Feb Mar 2025 2026

STONE BOULEVARD EXTENSION
City of West Sacramento
Draft Project Schedule (Through Final Design)
December 2024

ID Task Name Duration Start Finish
33 Geotechnical Engineering 60 days Mon 6/2/25 Fri 8/22/25 34 Phase II Environmental Site
Assessment
60 days Mon 12/15/25 Fri 3/6/26
35 Drainage and Stormwater Analysis 50 days Mon 8/11/25 Fri 10/17/25 36 Task 6 Permits, Agreements and
Coordination
80 days Mon
9/21/26
Fri 1/8/27
37 Railroad C&M and CPUC GO 88-B 80 days Mon 9/21/26 Fri 1/8/27 38 Task 7 Utility Coordination 250 days Mon
3/10/25
Fri 2/20/26
39 Utility Coordination 250 days Mon 3/10/25 Fri 2/20/26 40 Task 8 Railroad Coordination and
Design
240 days Mon
4/21/25
Fri 3/20/26
41 Diagnostic Team Meetings 10 days Mon 4/21/25 Fri 5/2/25 42 Railroad Coordination and Design 160 days Mon 6/2/25 Fri 1/9/26 43 Exhibits and Forms 30 days Mon 2/9/26 Fri 3/20/26
44 Task 9 Quiet Zone Coordination 45 days Mon
7/13/26
Fri 9/11/26
45 Quiet Zone Coordination 45 days Mon 7/13/26 Fri 9/11/26 46 Task 10 Right of Way Services 165 days Mon
11/24/25
Fri 7/10/26
47 Legal Descriptions and Plat Maps 30 days Mon
11/24/25
Fri 1/2/26
48 Appraisal and Acquisition 150 days Mon
12/15/25
Fri 7/10/26
49 Right of Way Meetings 120 days Mon
12/15/25
Fri 5/29/26
50 Record of Survey 10 days Mon 6/1/26 Fri 6/12/26
51 Task 11 Design 400 days Mon
3/10/25
Fri 9/18/26
52 Preliminary Design (30%) 60 days Mon 3/10/25 Fri 5/30/25 53 Initial Design Submittal (60%) 120 days Mon 6/16/25 Fri 11/28/25 54 Revised Design Submittal (90%) -
Complete Design
120 days Mon 1/5/26 Fri 6/19/26
55 Final Design Submittal (100%) 40 days Mon 7/27/26 Fri 9/18/26 56 Task 12 Traffic Analysis 95 days Mon
2/17/25
Fri 6/27/25
57 Traffic Counts and Field
Verification
15 days Mon 2/17/25 Fri 3/7/25
58 Existing Conditions 20 days Mon 3/10/25 Fri 4/4/25
59 Analysis Volumes 25 days Mon 4/7/25 Fri 5/9/25
60 Operational Analysis 30 days Mon 5/19/25 Fri 6/27/25 61 VMT Assessment and Memo 30 days Mon 5/19/25 Fri 6/27/25 62 Task 13 Building ACM & Lead Testing
(Optional)
60 days Mon
12/15/25
Fri 3/6/26
63 ACM and Lead Testing 60 days Mon
12/15/25
Fri 3/6/26
Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec Jan Feb Mar 2025 2026

STONE BOULEVARD EXTENSION
City of West Sacramento
Draft Project Schedule (Through Final Design)
December 2024

Kimley Horn and Associates, Inc.

CPE24-361 Engineering Design Services Stone Blvd. Extension Expires on 1/15/28

EXHIBIT D
Schedule of Fees
65 Sherina
Lam
Parag
Mehta
Category/Title Project Manager Principal-in- Charge
Billing Rate $325 $420 $420 $360 $325 $260 $235 $205 $180 $165 $155 $105 $140 Task 1 Project Management and Coordination 114 6 18 30 28 0 20 20 0 60 0 0 40 336 $ 91,330

1.1 Meetings and Consultation 74 4 18 10 16 0 20 0 0 40 0 0 0 182 $ 53,390 1.2 Reporting and Invoicing 20 20 20 40 100 $ 19,500 1.3 Agency/Subconsultant Coordination and QC/QA 20 2 20 12 54 $ 18,440 Task 2 Data Collection and Review 6 0 2 0 0 0 2 829 49 0 0 096 $ 18,205 Data Collection 4 2 8 20 40 74 $ 13,610 Field Reconnaissance 22 9 9 22 $ 4,595 Task 3 Topographic and Right of Way Mapping 0 0 0 0 0 0 7 8 020 0 0 035 $ 6,585 Surveying 28 10 $ 2,110 Utility Research and Positive Identification 5 20 25 $ 4,475 Task 4 CEQA Environmental Documentation 10 0 0 22 0 40 76 0 134 40 0 0 0 322 $ 70,150 CEQA IS/MND 28 80 40 130 $ 24,530
Biological Resources 22 4 8 $ 2,090 Cultural Resources 22 4 8 $ 2,090 Hazardous Materials 22 6 10 $ 2,450 AQ/GHG/Noise/Energy 2 8 40 76 40 166 $ 38,990 Task 5 Engineering Studies and Reports 6 0 0 0 9 063049 0 0 0 0127 $ 28,500

5.1 Geotechnical Engineering 2 2 4 $ 1,120 5.2 Phase II Environmental Site Assessment 2 2 4 $ 1,120 5.3 Not Used 0 $ - 5.4 Drainage and Stormwater Analysis 2 0 0 0 9 059049 0 0 0 0119 $ 26,260 Task 6 Permits, Agreements and Coordination 18 0 24 0 0 18 58 0 24 20 0 0 0 162 $ 41,860 Railroad C&M Agreement and CPUC GO 88-B 824 18 48 24 122 $ 32,960 Utility Agreements 10 10 20 40 $ 8,900 Task 7 Utility Coordination 140 0 0 0 0 4 0 838 0 0 064 $ 13,200 Letters A, B and C 2 2 $ 330
Documentation 2 10 12 $ 2,300
Utility Conflict Maps 2 4 8 26 40 $ 7,320
Utility Coordination Meetings 10 10 $ 3,250
Task 8 Railroad Coordination and Design 300620 068 1300136 0 0 0 0426 $ 108,500 Diagnostic Team Meetings 8 18 8 32 32 98 $ 25,520
Railroad Coordination and Design 18 36 60 80 80 274 $ 69,770 Exhibits and Forms 4 8 18 24 54 $ 13,210
Task 9 Quiet Zone Coordination 0 0130 017 36 0 0 0 0 0 066 $ 18,340 Design Coordination 99 18 36 $ 10,350 Documentation 48 18 30 $ 7,990 Task 10 Right of Way Services 160 2 0 0 0 2 4 036 0 0 060 $ 13,270 Utility and Construction Easements 2 0 2 12 16 $ 3,040
Legal Descriptions and Plat Maps 2 0 2 10 14 $ 2,710 Appraisal and Acquisition 2 2 10 14 $ 2,770 Right of Way Meetings 82 4 14 $ 4,100 Record of Survey 2 2 $ 650
Task 11 Design 139 0 28 4 103 0 465 70 460 1504 0 0 0 2773 $ 546,435

11.1 Preliminary Design (30%) 18 0 4 4 14 0 56 0 0 246 0 0 0 342 $ 67,270 11.2 Initial Design Submittal (60%) 43 0 11 0 47 0 180 20 192 540 0 0 0 1033 $ 203,930 11.3 Revised Design Submittal (90%) - Complete Design 62 0 9 0 31 0 169 50 228 630 0 0 0 1179 $ 228,960 11.4 Final Design Submittal (100%) 16 0 4 0 11 0 60 0 40 88 0 0 0 219 $ 46,275 Task 12 Traffic Analysis 4 0 0 064 1860 0 0280 0 0 0534 $ 116,660 Traffic Data Collection 428 32 $ 8,580
Traffic Operational Analysis 4 0 0 060 1580 0 0280 0 0 0502 $ 108,080 Task 13 Building ACM & Lead Testing (Optional) 5 0 0 8 0 012 0 0 8 0 0 033 $ 8,645 Building ACM & Lead Testing (Requires Authorization) 5 8 12 8 33 $ 8,645 TOTAL HOURS 362 6 149 64 204 329 875 110 840 2055 0 0 40 5034 Subtotal Labor: $117,650 $2,520 $62,580 $23,040 $66,300 $85,540 $205,625 $22,550 $151,200 $339,075 $0 $0 $5,600 $ 1,081,680 Other Direct Costs $ 83,542 Escalation* $ 27,042 Traffic Counts $ 6,500 Potholing (10) $ 50,000 Subconsultants $ 264,684 AIM (Outreach Support) $ 17,375 Blackburn (Geotechnical and Phase I & II ESA) $ 59,254 Blackburn (Building Material Testing) - OPTIONAL Task 13 $ 13,585 ICF (Biology, Cultural and AB 52) $ 70,207 Monument (Railroad Appraisal and Utility Coordination) $ 33,100 Monument (Two Private Parcel Appraisals) - OPTIONAL $ 9,000 Unico (Survey and R/W Legal Documents) $ 62,163 TOTAL COST: $ 1,429,906
Sr.

Professional II
* Rates subject to up to 5% escalation on 7/1/25.

CITY OF WEST SACRAMENTO
Design of Stone Boulevard Extension Project
Kimley-Horn and Associates, Inc.

Sr.

Professional II
Sr.

Professional I
Sr.

Professional I Professional Analyst II Technical Support Project Support TOTAL

HOURS TOTAL COST
Analyst II Analyst I Analyst I
66 Kimley Horn and Associates, Inc.

CPE24-361 Engineering Design Services Stone Blvd. Extension Expires on 1/15/28

EXHIBIT E
CERTIFICATE OF COMPLIANCE WITH LABOR CODE § 3700
[Labor Code § 1861]
I am aware of the provisions of Section 3700 of the Labor Code which require every employer to be insured against liability for workers’ compensation or to undertake self-insurance in accordance with the provisions of that code, and I will comply with such provisions before commencing the performance of the work of this contract.

Kimley-Horn
By: _________________________
Parag Mehta, Principal-in-Charge
67 Kimley Horn and Associates, Inc.

CPE24-361 Engineering Design Services Stone Blvd. Extension Expires on 1/15/28

EXHIBIT F

LABOR COMPLIANCE

1. PREVAILING WAGE
A. The Work contemplated herein constitutes a public work within the meaning of Labor Code sections 1720 and 1771. It shall be mandatory upon the Consultant and upon any Subcontractor, to pay not less than the said specified prevailing rates of wages to all workers employed by them under the Contract in accordance with Labor Code section 1774. The Director of the Department of Industrial Relations ("DIR") of the State of California has determined the general prevailing rate of wages of per diem wages in the locality in which the work is to be performed for each craft or type of worker needed to execute the Contract. The Consultant acknowledges that it has examined the prevailing rate of per diem wages as established by the DIR. Copies of the current schedules for prevailing wages are on file at City Hall, and the contents of those schedules are incorporated herein as if set forth in full. The Consultant shall post a copy of the applicable prevailing wage determinations at each job site, along with any other work place posters required by law.

B. The City will not recognize any claims for additional compensation because of the payment of prevailing wages. The possibility of wage increases is one of the elements to be considered by the Consultant in determining its proposal, and will not under any circumstances be considered as the basis of a claim against the City.

C. By executing this Contract Consultant warrants that it has registered with the Department of Industrial Relations in accordance with Labor Code section 1725.5.

2. PREVAILING WAGE RECORDS
A. The Consultant and each subcontractor shall keep an accurate payroll record which shows the name, address, social security number, correct work classification (in accordance with the wage decision), both straight and overtime worked each day and week, and hourly rate of pay, gross wages earned, deductions made and net wages paid to each journeyman, apprentice, worker or other employee paid by the Consultant /subcontractor in connection with the Work. These payroll records shall be certified and shall be made available at Consultant's principal office. These records shall be maintained during the course of the Work.

The Consultant and all subcontractors shall make the certified payroll records available for inspection by City representatives upon request and shall permit such representatives to interview employees during the work hours on the job site.

B. The City shall notify the Consultant in writing of any discrepancies or violations that are discovered during such inspections. Written notification pursuant to this Section shall include the actions that will be necessary to resolve the discrepancies and/or violations. The Consultant shall be held entirely responsible for the prompt resolution of all non-compliances with the prevailing wage laws, including those pertaining to all subcontractors and any lower-tier subcontractors. The Consultant shall forfeit as penalty to the City the amount specified by law for each calendar day or portion thereof for each worker (whether employed by the Consultant or any subcontractor) paid less than the stipulated prevailing rates for any work done under the Contract in violation of the provisions of the Labor Code and in particular, Section 1775. 68 Kimley Horn and Associates, Inc.

CPE24-361 Engineering Design Services Stone Blvd. Extension Expires on 1/15/28
C. To the extent applicable, Consultant and subcontractors shall maintain and furnish to the Department of Industrial Relations ("DIR"), a certified copy of each weekly payroll (but no less often than monthly), with a statement of compliance signed under penalty of perjury. Such certified payroll reports shall be transmitted electronically to the DIR.

D. The City will not recognize any claims for additional compensation because of the payment of the prevailing wages. The possibility of wage increases is one of the elements to be considered by the Consultant in entering into the Contract, and will not under any circumstances, other than delays caused by the City, or the City’s agents, be considered as the basis of a claim against the City.

3. Labor Discrimination
Attention is directed to Section 1735 of the Labor Code, which reads as follows:
“No discrimination shall be made in the employment of persons upon public works because of their race, color, national origin or ancestry, physical handicap, mental condition, marital status, or sex of such person, except as provided in Section 12940 of the Government Code, and every General Contractor for public works violating this section is subject to all the penalties imposed for a violation of this chapter.”
4 Eight-Hour Day Limitation
(a) In accordance with the provisions of the Labor Code, and in particular, Sections 1810 to 1815 thereof, inclusive, incorporated herein by reference, eight hours labor shall constitute a day's work, and no worker in the employ of Consultant, or any Subcontractor, doing or contracting to do any part of the work contemplated by the Contract, shall be required or permitted to work more than eight (8) hours in any one calendar day and forty (40) hours in any one calendar week in violation of those provisions; provided that subject to Labor Code Section 1815, a worker may perform work in excess of either eight (8) hours per day or forty (40) hours during any one week upon compensation for all hours worked in excess of eight (8) hours per day or forty (40) hours during any one week at not less than one and one-half times the basic rate of pay.
(b) The Consultant and each Subcontractor shall also keep an accurate record showing the names and actual hours worked of all workers employed by them in connection with the Contract. This record shall be open at all reasonable hours to the inspection of the City. It is hereby further agreed that, except as provided in (a) above, the Consultant shall forfeit as a penalty to the City the sum of twenty-five dollars ($25) for each worker employed in the performance of the Contract by the Consultant or by any of its Subcontractors for each calendar day during which such worker is required or permitted to labor more than eight (8) hours in and one calendar day and forty (40) hours in any one calendar week in violation of Sections 1810 through 1815.

5. Compliance with State Requirements for Employment of Apprentices (a) The Consultant's attention is directed to Section 1777.5 of the Labor Code.

Provisions of said Section pertaining to employment of registered apprentices are hereby incorporated by reference into this Contract. As applicable, the Consultant or any Subcontractor 69 Kimley Horn and Associates, Inc.

CPE24-361 Engineering Design Services Stone Blvd. Extension Expires on 1/15/28
employed by the Consultant in the performance of this Contract shall take such actions as necessary to comply with the provisions of Section 1777.5. 70 CITY COUNCIL AGENDA REPORT
MEETING DATE: January 15, 2025 ITEM #3
SUBJECT:

CONSIDERATION OF ADOPTION OF APPROVAL OF A PROFESSIONAL SERVICES CONTRACT WITH WOOD RODGERS, INC. FOR ENGINEERING SERVICES FOR THE NORTH 5TH STREET COMPLETE STREETS AND CONNECTIVITY PROJECT (CIP 16013) INITIATED OR REQUESTED BY: REPORT COORDINATED OR PREPARED BY:
[ ] Council [ x ] Staff
[ ] Other
Christian Asuncion, Associate Civil Engineer
Joanna Ortiz, Assistant Civil Engineer
Capital Projects Department
ATTACHMENT [X ] Yes [ ] No [ ] Information [ ] Direction [X ] Action

OBJECTIVE
The objective of this report is to provide the City Council with sufficient information to approve a professional services contract with Wood Rodgers, Inc. (Wood Rodgers) for Engineering Services for the North 5th Street Complete Streets and Connectivity Project (CIP 16013).

RECOMMENDED ACTION
Staff respectfully recommends that the City Council:
1) Find that approval of a professional services contract with Wood Rodgers is not subject to the California Environmental Quality Act (CEQA) as it is not an activity that may cause either a direct or reasonably foreseeable indirect physical change in the environment pursuant to CEQA guidelines section 15060(c) and 15378(a);
2) Approve a professional services contract for engineering services with Wood Rodgers for the North 5th Street Complete Streets and Connectivity Project (CIP 16013); 3) Authorize the City Manager, or his designee, to execute a professional services contract with Wood Rodgers for an amount not to exceed $614,814.72
4) Authorize the City Manager, or his designee to execute non-substantive changes or modifications to the professional services contract, with approval from the City Attorney; 5) Authorize the City Manager, or his designee, to execute amendments up to 20% ($122,962.94) of the total contract amount; and
6) Delegate authority to the City Manager, or his designee, to execute amendments to extend the term of the contract, if necessary, and to approve and incorporate additional tasks.

BACKGROUND
Currently, 5th Street is a four-lane, divided arterial with Class II bike facilities between C Street and Fountain Drive/Watercolor Lane. There is on-street parking on 5th Street between A Street and C Street: however, this segment has a gap in bicycle infrastructure and unsafe, unsignalized, pedestrian crossings. Additionally, there are sidewalk gaps along 5th Street and C Street.

The North 5th Street Complete Street and Connectivity Project will include a traffic analysis to review a proposed road diet and intersection safety improvements on 5th Street/Lighthouse Drive between C Street and Fountain Drive. The road diet will include enhanced Class II parking-protected bike lanes and safe pedestrian crossings on 5th Street between A Street and C Street, and on C Street between 3rd Street and 6th Street. Additionally, a proposed bike/pedestrian connection from A & 5th Street to the Riverwalk Trail will be analyzed.

The City recently completed the North Riverwalk Trail Extension, which extended the Riverwalk Trail from E Street/2nd Street to the Broderick Boat Ramp at 4th Street. The connection at 5th Street and A Street to 4th Street/Broderick Boat Ramp will provide an ADA-accessible connection to the Riverwalk Trail. The City is also in design and seeking construction funding for the I Street Bridge Deck Conversion Project, and the City of Sacramento will soon begin construction of the I Street Bridge Replacement Project. These regionally important projects may foster recreation opportunities, and it is important to develop a safe network to reach these destinations.
71 North 5th St. Complete Streets – Wood Rodgers Contract January 15, 2025

When constructed, the North 5th Street Complete Street and Connectivity Project will increase safety, close gaps in the active transportation system, and provide people of all abilities with safe connections to walk or roll to their destinations. Furthermore, this project is located entirely within an SB-535 disadvantaged community and is adjacent to several senior and low-income housing developments. The project will create a safe and low-stress active transportation network for the surrounding community, students, and visitors of all ages and abilities.

On June 28, 2023, the City was awarded a State Active Transportation (ATP) Grant under Cycle 6 in the amount of $638,000 for the Project Approval & Environmental Document (PA&ED), Plans, Specifications, and Estimate (PS&E), and Right-of-Way (ROW) phases. On March 14, 2024, the City requested a fund allocation for the PA&ED phase in the amount of $89,000. The California Transportation Commission (CTC) allocated these funds at their May 17, 2024, meeting.

ANALYSIS
On November 5, 2024, staff issued a Request for Proposals for the North 5th Street Complete Streets and Connectivity Project (24-064-RFP) through the City’s online procurement system, OpenGov, to obtain proposals from engineering firms to conduct surveying, engineering reports preparation, environmental analysis and permitting, public outreach, utility coordination, right-of-way activities, PS&E, and design and support services during construction. After extended outreach, the City received two proposals from the following firms, listed in alphabetical order:
 KPFF, Inc.
 Wood Rodgers, Inc.

The proposals were evaluated by a three-person panel of City staff, consistent with the City’s purchasing policy.

Proposals were evaluated based on qualifications, proven ability, experience, and technical approach. After reviewing Wood Rodgers’ qualifications, experience, and proposed work plan, the staff selection panel determined that Wood Rodgers has a strong understanding of the work to be performed and is the most qualified firm. The attached contract includes the negotiated scope and fees to complete the scope.

Environmental Considerations
The current action is not subject to CEQA because it is not an activity that may cause either a direct or reasonably foreseeable indirect physical change in the environment. (Pub. Resources Code, § 21065; CEQA Guidelines §§ 15060(c), 15378(a).)
Commission Recommendation
Not Applicable
Strategic Plan Integration
Not Applicable
Alternatives
The City Council may choose among the following alternatives:
1) Approve the recommended actions as stated above.
2) Amend the recommended actions.
3) Decline to approve the recommended actions or cancel the project.

Staff recommends Alternative 1 in order to begin the project and keep it on schedule. Alternatives 2 and 3 are not recommended because they would delay the project.

Coordination and Review
This report was prepared by the Capital Projects Department in coordination with and review by the Finance Department.

Budget/Cost Impact
This project is included in the City’s current Capital Improvement Program (CIP) as CIP 16013: North 5th Street Complete Streets and Connectivity Project. There are currently sufficient funds in this CIP to award the contract to Wood Rodgers. The City will award additional tasks proposed by Wood Rodgers for the ROW and PS&E phase at a later date through an amendment to complete all preconstruction phases and work. This is due to the ATP allocation schedule as only the PA&ED phase is currently authorized and allocated. Table 1 provides a 72 North 5th St. Complete Streets – Wood Rodgers Contract January 15, 2025

breakdown of the current expenses and anticipated costs for this initial phase of design. Table 2 provides the current funding revenue and sources for the project.

Table 1 - Funding breakdown of current and anticipated project expenses Management and Engineering Contracts
& Amendments
City Staff & Misc. $54,023.41
Consultant - Wood Rodgers $614,814.72
Consultant - Wood Rodgers (20% Contingency, including future tasks) $122,962.94
Total Project Costs to Date $791,801.07
Table 2 - Funding revenue and sources
Funding Totals
Cycle 6 State ATP Grant $638,000
Grant Funds $638,000
Measure G (16013) $155,000
City Funds (Measure G) $155,000
Total Appropriated Funds (Grant & Measure G) $793,000
Funds Needed for Design Phase $791,801.07
Total Funds Remaining $1,198.93

ATTACHMENTS
1) Vicinity Map
2) CPE24-354 Wood Rodgers Contract
73 Road diet, high visibility
bike lanes, intersection
improvements
Future bike/ped
connection to
Riverwalk Trail
Sidewalk, high visibility
bike lanes, and frontage
improvements
Project Limits
1,000 feet
Appendix B: Project Maps
1 Wood Rodgers, Inc.

CPE24-354 North 5th Streets Complete Streets and Connectivity Expires on 6/30/2027
1 11.4.2024

CONTRACT FOR SERVICES
THIS CONTRACT is made on January 15, 2025, by and between the CITY OF WEST SACRAMENTO (“City”), and Wood Rodgers, Inc. (“Consultant”).

WITNESSETH:

WHEREAS, the City desires professional services for engineering design for the North 5th Street Complete Streets and Connectivity Project;
WHEREAS, the Consultant has presented a proposal for such services to the City, dated November 26, 2024, (attached hereto as Exhibit “A”) and is duly licensed, qualified and experienced to perform those services;
NOW, THEREFORE, the parties hereto mutually agree as follows:

1. SCOPE OF SERVICES:

A. Consultant shall do all work, attend all meetings, produce all reports and carry out all activities necessary to completion of the services described in the Scope of Work, attached hereto and incorporated herein by this reference as Exhibit “A”. This Contract and its exhibits shall be known as the “Contract Documents.” Terms set forth in any Contract Document shall be deemed to be incorporated in all Contract Documents as if set forth in full therein. In the event of conflict between terms contained in these Contract Documents, the more specific term shall control. If any portion of the Contract Documents shall be in conflict with any other portion, provisions contained in the Contract shall govern over conflicting provisions contained in the exhibits to the Contract.

B. Consultant enters into this Contract as an independent contractor and not as an employee of the City. The Consultant shall have no power or authority by this Contract to bind the City in any respect. Nothing in this Contract shall be construed to be inconsistent with this relationship or status. All employees, agents, contractors or subcontractors hired or retained by the Consultant are employees, agents, contractors or subcontractors of the Consultant and not of the City. The City shall not be obligated in any way to pay any wage claims or other claims made against Consultant by any such employees, agents, contractors or subcontractors, or any other person resulting from performance of this Contract. In the event that Consultant or any employee, agent, or subcontractor of Consultant providing services under this Agreement claims or is determined by a court of competent jurisdiction or the California Public Employees Retirement System (PERS) to be eligible for enrollment in PERS as an employee of the City, Consultant shall indemnify, defend, and hold harmless City for the payment of any employee and/or employer contributions for PERS benefits on behalf of Consultant or its employees, agents, or subcontractors, as well as for the payment of any penalties and interest on such contributions, which would otherwise be the responsibility of City. Notwithstanding any other agency, state or federal policy, rule, regulation, law or ordinance to the contrary, To the greatest extent permitted by law, Consultant and its employees, agents, and subcontractors shall not qualify for or become entitled to, and hereby agree to waive any claims to, any compensation, benefit, or any incident of employment by City, including but not limited to eligibility to enroll in PERS as an employee of City and entitlement to any contribution to be paid by City for employer contribution and/or employee contributions for PERS benefits.
75 Wood Rodgers, Inc.

CPE24-354 North 5th Streets Complete Streets and Connectivity Expires on 6/30/2027
2 11.4.2024
C. The Consultant agrees it has satisfied itself by its own investigation and research regarding the conditions affecting the work to be done and labor and materials needed, and that its decision to execute this Contract is based on such independent investigation and research.

2. TERM OF CONTRACT
A. The services of Consultant are to commence upon receipt of written notice to proceed from the City, and shall be undertaken and completed in accordance with the Schedule of Performance attached hereto and incorporated herein by this reference as Exhibit “B” and terminate on June 30, 2027.

B. Consultant’s failure to complete work in accordance with the Schedule of Performance may result in delayed compensation as described in Section 3.

C. The City Manager or his or her designee may, by written instrument signed by the Parties, extend the duration of this Contract for two (2) additional one-year extensions in the manner provided in Section 5, provided that the extension does not require the payment of compensation in excess of the Council approved budget.

3. COMPENSATION:

A. The Consultant shall be paid monthly for the actual fees, costs and expenses for all time and materials required and expended, but in no event shall total compensation exceed six hundred fourteen thousand, eight hundred fourteen dollars and seventy two cents ($614,814.72), without City’s prior written approval. Consultant's fees shall be as specified in the Schedule of Fees, which is attached hereto an incorporated herein as Exhibit "C".

B. Said amount shall be paid upon submittal of a monthly billing showing completion of the tasks that month. Consultant shall furnish City with invoices for all expenses as well as for all materials authorized by this Contract. The invoices shall be submitted with the monthly billings.

If Consultant’s performance is not in conformity with the Schedule of Performance, payments may be delayed or denied, unless the Consultant’s failure to perform in conformity with the Schedule of Performance is a documented result of the City’s failure to conform with the Schedule of Performance, or if the Schedule of Performance is extended pursuant to Section 5.

C. If the work is halted at the request of the City, compensation shall be based upon the proportion that the work performed bears to the total work required by this Contract, subject to Section 4.

4. TERMINATION:

A. This Contract may be terminated by either party, provided that the other party is given not less than 30 calendar days’ written notice (delivered by certified mail, return receipt requested) of intent to terminate.

B. The City may temporarily suspend this Contract, at no additional cost to City, provided that the Consultant is given written notice (delivered by certified mail, return receipt requested) of temporary suspension. If City gives such notice of temporary suspension, Consultant shall immediately suspend its activities under this Contract. 76 Wood Rodgers, Inc.

CPE24-354 North 5th Streets Complete Streets and Connectivity Expires on 6/30/2027
3 11.4.2024
C. Notwithstanding any provisions of this Contract, Consultant shall not be relieved of liability to the City for damages sustained by the City by virtue of any breach of this Contract by Consultant, and the City may withhold any payments due to Consultant until such time as the exact amount of damages, if any, due the City from Consultant is determined.

D. In the event of termination, the Consultant shall be compensated as provided for in this Contract, except as provided in Section 4C. Upon termination, the City shall be entitled to all work, including but not limited to, appraisals, inventories, studies, analyses, drawings and data estimates performed to that date in accordance with Section 7 hereof.

5. AMENDMENTS, CHANGES OR MODIFICATIONS:

Amendments, changes or modifications in the terms of this Contract may be made at any time by mutual written agreement between the parties hereto and shall be signed by the persons authorized to bind the parties hereto.

6. EXTENSIONS OF TIME:

Consultant may, for good cause, request extensions of time to perform the services required hereunder. Such extensions shall be authorized in advance by the City in writing and shall be incorporated in written amendments to this Contract or the attached Work Program in the manner provided in Section 5.

7. PROPERTY OF CITY:

A. It is mutually agreed that all materials prepared by the Consultant under this Contract shall become the property of the City, and the Consultant shall have no property right therein whatsoever. Immediately upon termination, the City shall be entitled to, and the Consultant shall deliver to the City, all data, drawings, specifications, reports, estimates, summaries and other such materials as may have been prepared or accumulated to date by the Consultant in performing this Contract which is not Consultant’s privileged information, as defined by law, or Consultant’s personnel information, along with all other property belonging exclusively to the City which is in the Consultant’s possession.

B. Additionally, it is agreed that the parties intend this to be a contract for services and each considers the products and results of the services to be rendered by Consultant hereunder (the “Work”) to be a work made for hire. Consultant acknowledges and agrees that the Work (and all rights therein, including, without limitation, copyright) belongs to and shall be the sole and exclusive property of the City. The reuse of any of the materials or documents described in Paragraph 7.A by the City on any other project without the written permission of the Consultant, shall be at the City's sole risk and the City agrees to defend, indemnify and hold harmless the Consultant from all claims, damages and expenses, including attorney's fees, arising out of such unauthorized reuse by the City or by others acting through the City. The Consultant is not responsible and liability is waived by the City as against the Consultant for use by the City or any other person of any data, reports, plans or drawings not signed by the Consultant.

8. COMPLIANCE WITH ALL LAWS:

A. Consultant shall comply with all applicable laws, ordinances, and codes of federal, State and local governments, and shall commit no trespass on any public or private property in 77 Wood Rodgers, Inc.

CPE24-354 North 5th Streets Complete Streets and Connectivity Expires on 6/30/2027
4 11.4.2024
performing any of the work authorized by this Contract. It shall be City’s responsibility to obtain all rights of way and easements to enable Consultant to perform its services hereunder.

Consultant shall assist City in providing the same.

B. Consultant warrants to the City that it is licensed by all applicable governmental bodies to perform this Contract and will remain so licensed throughout the progress of the Work, and that it has, and will have, throughout the progress of the Work, the necessary experience, skill and financial resources to enable it to perform this Contract.

C. The work contemplated under this Contract is a public work for the purposes of Labor Code section 1720, and is subject to the payment of prevailing wages. Accordingly, Consultant shall comply with the provisions of Exhibit "D" and “E”.

9. WARRANTIES AND RESPONSIBILITIES - CONSULTANT:

A. Consultant agrees and represents that it is qualified to properly provide the services set forth in Exhibit “A” in a manner which is consistent with the generally accepted standards of Consultant’s profession.

B. Consultant agrees and represents that the work performed under this Contract shall be in accordance with applicable federal, State and local law in accordance with Section 17A hereof.

C. Consultant shall designate a project manager who at all times shall represent the Consultant before the City on all matters relating to this Contract. The project manager shall continue in such capacity unless and until he or she is removed at the request of the City, is no longer employed by Consultant, or is replaced with the written approval of the City, which approval shall not be unreasonably withheld.

D. Consultant shall provide corrective services without charge to the City for services which fail to meet the above professional and legal standards and which are reported to Consultant in writing within sixty (60) days of discovery. Should Consultant fail or refuse to perform promptly its obligations, the City may render or undertake performance thereof and the Consultant shall be liable for any expenses thereby incurred.

10. SUBCONTRACTING:

None of the services covered by this Contract shall be subcontracted without the prior written consent of the City, which will not be unreasonably withheld. Consultant shall be as fully responsible to the City for the negligent acts and omissions of its contractors and subcontractors, and of persons either directly or indirectly employed by them, as it is for the negligent acts and omissions of persons directly employed by Consultant.

11. ASSIGNABILITY:

Consultant shall not assign or transfer any interest in this Contract whether by assignment or novation, without the prior written consent of the City which will not be unreasonably withheld.

However, claims for money due or to become due Consultant from the City under this Contract may be assigned to a financial institution, or to a trustee in bankruptcy, without such approval.

Notice of any assignment or transfer whether voluntary or involuntary shall be furnished promptly to the City.
78 Wood Rodgers, Inc.

CPE24-354 North 5th Streets Complete Streets and Connectivity Expires on 6/30/2027
5 11.4.2024

12. INTEREST IN CONTRACT:

Consultant covenants that neither it, nor any of its employees, agents, contractors, subcontractors has any interest, nor shall they acquire any interest, direct or indirect, in the subject of the Contract, nor any other interest which would conflict in any manner or degree with the performance of its services hereunder. Consultant shall make all disclosures required by the City’s conflict of interest code in accordance with the category designated by the City, unless the City Manager determines in writing that Consultant’s duties are more limited in scope than is warranted by the category designated by the City code and that a narrower disclosure category should apply. Consultant also agrees to make disclosure in compliance with the City conflict of interest code if, at any time after the execution of this Contract, City determines and notifies Consultant in writing that Consultant’s duties under this Contract warrant greater disclosure by Consultant than was originally contemplated. Consultant shall make disclosures in the time, place and manner set forth in the conflict of interest code and as directed by the City.

13. MATERIALS CONFIDENTIAL:

All of the materials prepared or assembled by Consultant pursuant to performance of this Contract are confidential and Consultant agrees that they shall not be made available to any individual or organization without the prior written approval of the City, except by court order.

14. LIABILITY OF CONSULTANT-NEGLIGENCE:

Consultant shall be responsible for performing the work under this Contract in a manner which is consistent with the generally-accepted standards of the Consultant’s profession and shall be liable for its own negligence and the negligent acts of its employees, agents, contractors and subcontractors. The City shall have no right of control over the manner in which the work is to be done but only as to its outcome, and shall not be charged with the responsibility of preventing risk to Consultant or its employees, agents, contractors or subcontractors.

15. INDEMNITY AND LITIGATION COSTS:

Consultant shall protect, hold free and harmless, defend and indemnify the City, its consultants, and each of their officers, employees and agents, from any and all liability, penalties, costs, losses, damages, expenses, causes of action, claims or judgments, including attorney’s fees and expenses of litigation arising out of, pertaining to, or relating to the negligence, recklessness, or willful misconduct of the Consultant, its employees or anyone else employed by the Consultant in the performance of professional design services under this agreement, to the extent of the Consultant’s proportionate percentage of fault.

To the extent permitted by Civil Code section 2782.8, for all other claims unrelated to the provision of professional design services, the Consultant shall protect, hold free and harmless, defend and indemnify the City, its consultants, and each of their officers, employees and agents, from any and all liability, penalties, costs, losses, damages, expenses, causes of action, claims or judgments, including attorney’s fees and expenses of litigation, which arise out of or are in any way connected with the Consultant’s, or its subcontractors’ or suppliers’, performance under this agreement or failure to comply with any of the obligations contained in the agreement. This indemnity shall imply no reciprocal right of the Consultant in any action on the agreement pursuant to California Civil Code section 1717 or section 1717.5. To the fullest extent legally permissible, this indemnity, defense and hold harmless agreement by the Consultant shall apply to any and 79 Wood Rodgers, Inc.

CPE24-354 North 5th Streets Complete Streets and Connectivity Expires on 6/30/2027
6 11.4.2024
all acts or omissions unrelated to the provision of professional design services, whether active or passive, on the part of the Consultant or its agents, employees, representatives, or subcontractor’s agents, employees and representatives, resulting in claim or liability, irrespective of whether or not any acts or omissions of the parties to be indemnified hereunder may also have been a contributing factor to the liability, except such loss or damage which was caused by the active negligence, the sole negligence, or the willful misconduct of the City.

16. CONSULTANT TO PROVIDE INSURANCE:

A. Consultant shall not commence any work before obtaining, and shall maintain in force at all times during the duration and performance of this Contract, the policies of insurance specified in this Section. Such insurance must have the approval of the City as to limit, form, and amount, and shall be placed with insurers with a current A.M. Best’s rating of no less than A VII (an NR rating is acceptable for Worker’s Compensation insurance written with the State Compensation Insurance Fund of California).

B. Prior to execution of this Contract and prior to commencement of any work, the Consultant shall furnish the City with certificates of insurance and copies of endorsements providing evidence of coverage for all policies required by the Contract. The Consultant and its contractors and subcontractors shall, at their expense, maintain in effect at all times during the performance of work under the Contract not less than the following coverage and limits of insurance, which shall be maintained with insurers and under forms of policy satisfactory to the City. The maintenance by Consultant and its contractors and subcontractors of the following coverage and limits of insurance is a material element of this Contract. The failure of Consultant or of any of its contractors or subcontractors to maintain or renew coverage or to provide evidence of renewal may be treated by the City as a material breach of this Contract. Approval of the insurance by the City shall not relieve or decrease any liability of Consultant.

1. Worker’s Compensation and Employer’s Liability Insurance

a. Worker’s Compensation - Insurance to protect the Consultant, its contractors and subcontractors from all claims under Worker’s Compensation and Employer’s Liability Acts, including Longshoremen’s and Harbor Worker’s Act (“Acts”), if applicable. Such coverage shall be maintained, in type and amount, in strict compliance with all applicable state and Federal statutes and regulations.

The Consultant shall execute a certificate in compliance with Labor Code Section 1861, on the form provided in the Contract Documents.
b. Consultant shall provide a Waiver of Subrogation endorsement in favor of the City, its officers, officials, employees, agents and volunteers for losses arising from work performed by the Consultant.

2. Commercial General Liability Insurance
a. The insurance shall be provided on form CG0001, or it’s equivalent, and shall include coverage for claims for bodily injury or property damage arising out of premises/operations, products/completed operations, contractual liability, and subconsultant’s work and personal and advertising injury resulting from actions, failures to act, or operations of the insured, or by its employees or agents, or by anyone directly or indirectly employed by the insured. The amount of 80 Wood Rodgers, Inc.

CPE24-354 North 5th Streets Complete Streets and Connectivity Expires on 6/30/2027
7 11.4.2024
insurance coverage shall not be less than $1,000,000 per occurrence and $2,000,000 general and products/completed operations aggregates. b. The commercial general liability insurance shall also include the following:
i. Endorsement equivalent to CG 2010 0714 naming the City, its officers, officials, employees, agents, and volunteers as additional insureds. The endorsement shall contain no special limitations on the scope of protection afforded to the City, its officers, officials, employees or volunteers.
ii. Endorsement stating insurance provided to the City shall be primary as respects the City, its officers, officials, employees and any insurance or self insurance maintained by the City, its officers, officials, employees or volunteers shall be in excess of the Consultant’s insurance and shall not contribute with it, to the payment or satisfaction of any defense expenses, loss, or judgment.
iii. Provision or endorsement stating that the Consultant’s insurance shall apply separately to each insured against whom claim is made or suit is brought, except with respect to the limits of the insurer’s liability.

3. Commercial Automobile Insurance
a. The insurance shall include, but shall not be limited to, coverage for claims for bodily injury or property damage for owned, non-owned, and hired automobiles resulting from actions, failures to act, or operations of the insured, or by its employees or agents, or by anyone directly or indirectly employed by the insured. The amount of insurance coverage shall not be less than $1,000,000 per accident.
b. The commercial automobile insurance shall include the same endorsements required for the commercial general liability policy (see Section

16.B.2.b).

4. Professional Liability. The Consultant and its contractors and subcontractors shall secure and maintain in full force, during the term of this Contract and for five years thereafter, professional liability insurance policies appropriate to the respective professions and the work to be performed as specified in this Contract. The limits of such professional liability insurance coverage shall not be less than $1,000,000 per claim.

C. In addition to any other remedy the City may have, if Consultant fails to maintain the insurance coverage as required in this Section, the City may obtain such insurance coverage as is not being maintained, in form and amount substantially the same as is required herein, and the City may deduct the cost of such insurance from any amounts due or which may become due Consultant under this Contract.
81 Wood Rodgers, Inc.

CPE24-354 North 5th Streets Complete Streets and Connectivity Expires on 6/30/2027
8 11.4.2024
D. No policy required by this Contract shall be suspended, cancelled, terminated by either party, or reduced in coverage or in limits unless Consultant has provided thirty (30) days prior written notice by certified mail, return receipt requested, to the City.

E. Any deductibles or self-insured retentions in excess of $10,000 must be declared to, and approved by, the City.

F. The requirement as to types, limits, and the City’s approval of insurance coverage to be maintained by Consultant are not intended to, and shall not in any manner, limit or qualify the liabilities and obligations assumed by Consultant under the Contract.

17. MISCELLANEOUS PROVISIONS:

A. Consultant shall keep itself fully informed of, shall observe and comply with, and shall cause any and all persons, firms or corporations employed by it or under its control to observe and comply with, applicable federal, state, county and municipal laws, ordinances, regulations, orders and decrees which in any manner affect those engaged or employed on the work described by this Contract or the materials used or which in any way affect the conduct of the work.

B. Consultant shall not engage in unlawful employment discrimination. Such unlawful employment discrimination includes, but is not limited to, employment discrimination based upon a person’s race, religious creed, color, national origin, ancestry, physical handicap, medical condition, marital status, gender, citizenship, or sexual orientation.

C. This Contract is funded in whole in part through grant funds received under the following grant: State ATP Cycle 6 (the “Grant”), the terms of which are incorporated herein.

Copies of the Grant and any related materials have been made available to Consultant, and Consultant shall ensure that its performance under this Contract, and that of any subcontractors, conforms to the requirements of the Grant. These requirements include, but are not necessarily limited to, compliance with the terms set forth in Exhibit “F”.

D. Consultant shall maintain and make available for inspection by the City and its auditors accurate records of all of its costs, disbursements and receipts with respect to any work under this Contract. Such inspections may be made during regular office hours at any time until six (6) months after the final payments under this Contract are made to the Consultant.

E. Consultant shall maintain and make available for inspection by the City and its auditors accurate records of all of its costs, disbursements and receipts with respect to any work under this Contract. Such inspections may be made during regular office hours at any time until six (6) months after the final payments under this Contract are made to the Consultant.

F. This Contract constitutes the entire agreement between the parties relative to the services specified herein and no modification hereof shall be effective unless and until such modification is evidenced by a writing signed by both parties to this Contract. There are no understandings, agreements, conditions, representations, warranties or promises, with respect to this Contract, except those contained in or referred to in the writing.

G. All notices that are required to be given by one party to the other under this Contract shall be in writing and shall be deemed to have been given if delivered personally or 82 Wood Rodgers, Inc.

CPE24-354 North 5th Streets Complete Streets and Connectivity Expires on 6/30/2027
9 11.4.2024
enclosed in a properly addressed envelope and deposited in a United States Post Office for delivery by registered or certified mail addressed to the parties at the following addresses:

City: City of West Sacramento
Attn to: Christian Asuncion
1110 West Capitol Avenue, 1st Floor
West Sacramento, California 95691
Email: [email protected]

Consultant:

Wood Rodgers, Inc.

Attn to: Steven Robinson
3301 C Street, Bldg. 100-B
Sacramento, CA 95816
Email: [email protected]

H. This Contract shall be interpreted and governed by the laws of the State of California.

I. Any action arising out of this Contract shall be brought and maintained in Yolo County California, regardless of where else venue may lie.

J. In any action brought by either party to enforce the terms of this Contract, each party shall be bear responsibility for its attorney’s fees and all costs regardless of whether one party is determined to be the prevailing party.

K. ELECTRONIC TRANSMISSION OF CONTRACT AND SIGNATURE. By electronically signing this document in electronic form, Parties agree that this Agreement may be transmitted and signed electronically by all Parties, and that such signatures shall have the same force and effect as original signatures, in accordance with California law and regulations, including but not limited to Civil Code Section 1633.7
[Signatures on following page]
83 Wood Rodgers, Inc.

CPE24-354 North 5th Streets Complete Streets and Connectivity Expires on 6/30/2027
10 11.4.2024

CITY OF WEST SACRAMENTO
By: __________________________
Amanda Berlin, Assistant City Manager
ATTEST:

By: _______________________
Jennifer Cusmir, City Clerk
APPROVED AS TO FORM:

By: _______________________
Jeffrey Mitchell, City Attorney
WOOD RODGERS, INC.

By: _________________________
Mark Rayback, PE, President
84 Wood Rodgers, Inc.

CPE24-354 North 5th Streets Complete Streets and Connectivity Expires on 6/30/2027

EXHIBIT A
Consultant Proposal/Scope of Work
85 City of West Sacramento | North 5th Street Complete Streets and Connectivity Project (#24-064-RFP)
Page | 1

SCOPE OF WORK
The following scope of work is intended to provide all services required to develop a fully permitted and constructible set of contract documents pertaining to the South Riverwalk Extension Project (Project).

Task 1 – Project Management and Coordination
Task 1.1 - Meetings and Consultation
Wood Rodgers PM or their staff shall assist City staff and if requested provide presentations before the City Council or Commissions as requested by the City. This may include, but is not limited to, giving oral presentations and preparing written materials and documents (e.g., brief statements, reports, and exhibits).

Wood Rodgers will produce a baseline schedule of work and conduct periodic meetings with the City to discuss progress. The schedule will be monitored and updated monthly.

A project kick-off meeting will be scheduled as soon as practical after Notice to Proceed. This meeting will be used to establish the Project Development Team (PDT) and lines of communication, review the project scope of work, refine the project schedule, identify critical milestones, and will also be used for the identification of key project goals and issues.

Additional PDT meetings will be held as necessary to discuss pertinent project issues, at major milestones, and as needed to obtain direction from the PDT. For each PDT meeting, Wood Rodgers will prepare the meeting agendas, in consultation with City’s Project Manager, and will distribute the agenda prior to the meeting, will arrange for appropriate participants to attend; and will prepare and distribute meeting minutes to the participants.

Wood Rodgers will attend two (2) public open house meetings and up to two (2) City Council meetings.

Wood Rodgers’ PM and their assigned staff shall maintain continuous communication with the City and other interested utilities, public/state agencies, and key Project stakeholders throughout the entire Project. Wood Rodgers will be available upon request to attend and participate in meetings with regulatory agencies and property owners regarding permits and land acquisition and/or easement negotiations. Wood Rodgers will document key discussions and decisions obtained from their interaction with these interested parties and will incorporate such information into the Project design documents.

In conjunction with City staff, Wood Rodgers will identify all agencies with permitting authority over any aspect of the Project and will establish and maintain communications and coordination efforts with each agency throughout the Project. These agencies may include, but are not limited to, State Lands, Caltrans, CVFPB, USACE, U.S.

Department of Fish and Wildlife (USDFW), Reclamation District 900, National American Heritage Association.

Task 1.1 Assumptions:

1. Wood Rodgers will attend/participate in two (2) Council Meetings and two (2) public workshop meetings.

2. Wood Rodgers will attend two (2) meetings with each regulatory agency identified through the design process, and two (2) meetings with each private property owner (assume three (3) property owners).

3. Wood Rodgers will facilitate 1 PDT Meetings each month. 86 City of West Sacramento | North 5th Street Complete Streets and Connectivity Project (#24-064-RFP)
Page | 2
Task 1.2 - Reporting and Invoicing
Wood Rodgers’ (WR) Project Manager (PM) will lead and oversee all aspects of the Project design, permitting, property acquisition and easement needs, schedule, and budget. The Project Manager will be the City’s regular and primary point of contact and shall regularly meet with the City’s Project Manager. The WR PM responsibilities include, but are not limited to, managing all Consultant’s staff, preparing monthly progress reports, providing design schedule updates, conducting progress meeting including preparing meeting agenda and minutes; and preparing monthly invoices.

The WR PM will identify and present to the City’s PM any design constraints that may influence the design schedule; identify informational needs and decisions needed from the, propose solutions to Project related constraints to ensure the Project schedule, deliverables, and budget are met. These items will be brought to the City PM’s attention as they are identified and reflected in the monthly progress report.

The monthly progress report will include, but not be limited to, describing that month’s work progress; work schedule status and issues/conflicts; listing informational/decisions need to maintain the project schedule and deliverables; action items; and listing anticipated upcoming work and constraints. Progress reports will be submitted with monthly invoices.

Invoices will be listed by task, expenditures for the invoice period, total expenditures to date, percent of work complete and remaining budget.

Task 1.3 - Quality Control
Quality Control (QC) consists of task specific activities that apply the QA policies at each level to maintain an acceptable level of quality through the application of sound project management, guidance and review.

Every team member is responsible for ensuring quality as an integral part of his/her project responsibility. In addition, prior to the submittal of any draft or final document, a senior staff engineer on our team will also complete a QA/QC review. The reviewer will verify that the documents are prepared in conformance with the contract requirements and generally accepted professional standards of engineering. Wood Rodgers’ Project Manager will have the general responsibility for ensuring that all elements of the QA/QC are complied with, including ensuring that adequate resources are available to perform quality work.

Task 1 Deliverables:
• Meeting agendas, minutes, action items
• Monthly Progress Reports
• Project Schedule
Task 2 – Data Collection and Review
Task 2.1 - Data Collection
Wood Rodgers will complete a comprehensive review of the existing Project data that include as-built drawings, adopted plans and policies, prepared and approved documents and in-progress work products. Request and gather additional information and data as needed.
87 City of West Sacramento | North 5th Street Complete Streets and Connectivity Project (#24-064-RFP)
Page | 3
Wood Rodgers will conduct site visits and field reviews to verify existing geometric features, structures, drainage, signage, striping, and other features. The existing conditions observed during these site visits will be documented through photos, videos, field notes, and/or field measurements.

Task 2.2 – Traffic, Pedestrian, and Bicycle Counts
Wood Rodgers will perform 24-hour bicycle and pedestrian counts at up to three (3) locations before and after construction. Additionally, Wood Rodgers will collect average daily traffic (ADT) and speed surveys (85th percentile speeds) for one typical weekday at up to six intersections/locations. Wood Rodgers will work with the City to determine collection sites and times.

Task 2.3 – Traffic Study
A Traffic Operations Analysis will be performed for up to six (6) study intersections, with “Existing Conditions” and “Existing plus Project Conditions” scenarios evaluated.

A “No Build” and one (1) geometric road diet alternative will be evaluated.

Wood Rodgers will:
• Prepare a summary of existing conditions transportation facilities. • Prepare Cumulative Design Year traffic forecasts for the study intersections. • Prepare Synchro/SimTraffic models of the study intersections and report delays, level of service (LOS), and 95th percentile queues using HCM 6th edition or SimTraffic reports. • Perform qualitative evaluation of project effects on multimodal facilities. • Perform queuing analysis at study intersections.
• Provide recommendations related to traffic improvements.

A safety analysis of the project site will be performed. It will:
• Provide a summary of last five years (or as available) of collision data for the study area. • Evaluate the effects of the proposed geometric alternatives on safety. In particular, effects on bicycles and pedestrians will be evaluated.
• Evaluate corner sight distance per current version of AASHTO Green Book at study intersections and driveways.

Summarize the results of the traffic counts, traffic analysis, and safety analysis, an in a Traffic Operations Analysis Report (TOAR) consistent with City standards and guidelines, and as required per the permitting agencies, using appropriate tables, figures, and graphics.

Task 2.4 – Geotechnical Design / Soils Report
As a subconsultant to Wood Rodgers, Blackburn Consulting (Blackburn) will perform Geotechnical services for the project. The following scope of services to prepare a Geotechnical Report for the ADA/Bike ramp between 5th Street and the Riverwalk Trail, and an optional Phase 1 Environmental Site Assessment for the entire project.

Task 2.4.1 – Background Research
Blackburn will perform the following
88 City of West Sacramento | North 5th Street Complete Streets and Connectivity Project (#24-064-RFP)
Page | 4
• Review preliminary project plans and discuss the project constraints, expectations and schedule with Wood Rodgers and the City of West Sacramento.
• Review readily available relevant geotechnical data for the existing levee including nearby borings and cone penetration tests (CPTs). Blackburn recently completed subsurface explorations for the WSAFCA Sacramento River West North Levee Project.
• Coordinate site access and mark hand auger boring locations for notification of Underground Service Alert (USA).

Blackburn assumes:
• That any right-of-entry agreements or permits necessary to access the site for USA and to complete our subsurface exploration will be obtained by others.
• A private utility locator is not required.
• USACE will not require a Drilling and Invasive Program Plan (DIPP) for hand auger borings.

Task 2.4.2 - Subsurface Exploration and Laboratory Testing For geotechnical design of the proposed trail improvements, Blackburn will use a hand auger to drill two to three borings to depths of 5-8 feet along the ADA/Bike ramp alignment. At selected intervals, we will obtain relatively undisturbed soil samples using a hand-driven sampler. We will also obtain bulk soil samples from the auger cuttings. Blackburn will backfill the borings with soil cuttings and/or grout upon completion. Blackburn’s engineer or geologist will log the borings and deliver the samples to our laboratory for testing.

Blackburn will perform laboratory tests on samples collected from the hand augers to include:
• Up to three moisture content/unit weight tests,
• One grain size analysis for soil classification,
• One plasticity index test for soil classification,
• One R-value
Task 2.4.3 - Analysis
We anticipate USACE will review the project plans since the project will be constructed on the existing levee.

Blackburn will perform the following to demonstrate the new ramp will not adversely affect the levee performance:
• Develop two geotechnical models of the levee. One for existing conditions and one with the proposed improvements. We will use data from our subsurface exploration and laboratory testing (see Task 2) and our nearby borings and CPT soundings (completed) for the WSAFCA Sacramento River West North Levee project to construct a representative cross section at the trail site. • Evaluate stability for existing and post trail construction conditions. Analysis will include static and rapid draw down conditions.
• Perform a seepage analysis to compare existing and post trail construction conditions for a 200-year water surface elevation.
• Evaluate backward erosion piping originating from the access ramp. • Evaluate settlement from addition of any anticipated fill needed to construct the ramp.

Task 2.4.4 - Draft and Final Geotechnical Report
Blackburn will perform engineering analysis as necessary and prepare a Draft and Final Geotechnical Report for the project containing:
• Project and site description.
89 City of West Sacramento | North 5th Street Complete Streets and Connectivity Project (#24-064-RFP)
Page | 5
• Subsurface soil and groundwater conditions.
• Laboratory testing.
• Expansive soil considerations.
• Discussion of assumptions, soil properties, and evaluations completed for Task 3 and potential project impacts to the existing levee performance (if any).
• Grading recommendations for site clearing and overexcavation (if necessary), subgrade preparation, fill quality and compaction and over-optimum soil moisture considerations/mitigation. • Hot Mix Asphalt (HMA) pavement design recommendations for the trail and connector improvements for traffic indexes provided by others.
• Risk management and limitations.
• Vicinity map.
• Site plan.
• Appendices containing the hand auger boring logs and laboratory test data.

Note that Blackburn’s scope of services does not include liquefaction or seismic lateral spreading evaluation. We can provide these services if requested for an additional scope/fee.

Task 2.4.5 – Phase 1 Environmental Site Assessment
If approved, Blackburn will prepare an ESA for the entire project. The ESA will follow ASTM E1527-21 Standard Practice for Environmental Site Assessment: Phase I Environmental Site Assessment Process to assess whether potential sources or indications of hazardous materials conditions are present within or adjacent to the project corridor. Blackburn will perform the following scope of services to prepare the ESA. • Review published literature for geology and groundwater conditions within the Project limits. • Review title information, as available (e.g., title report or chain of title provided by others). • Review on-line regulatory databases GeoTracker (State Water Resources Control Board) and EnviroStor (Department of Toxic Substances Control (DTSC)) for known impacts and/or previous environmental data that exists for the Project area.
• Conduct a site reconnaissance to observe current land use and indications of potential hazardous material contamination on or adjacent to the Project limits. This includes documentation of areas showing evidence of surface staining, storage, dumping, handling, and mixing areas for hazardous materials (such as pesticides and fuel products), and apparent locations of fuel tanks and wells. • Review historical aerial photography, topographic maps, and Sanborn Maps covering the Project limits and surrounding areas for indications of sources for potential contamination. • Review a commercial database including federal, state, and county records for indications of the use, misuse, or storage of hazardous and/or potentially hazardous materials on or near the Project limits. • Based on historical research, attempt to identify past and present operations conducted on or adjacent to the Project limits to assess the potential for hazardous material impacts.

Prepare an ESA report that includes:
• General site description.
• General geology, groundwater, and surface/subsurface conditions. • Findings of our document reviews, owner interviews, site reconnaissance, historical evaluations, and regulatory records reviews.
• Location and general extent of known or suspected contamination on or adjacent to the Project limits, as applicable.
90 City of West Sacramento | North 5th Street Complete Streets and Connectivity Project (#24-064-RFP)
Page | 6
• Recommendations for further investigation and analysis, if necessary. • Limitations of the report.
• Vicinity and site maps.

Before starting the ESA, Blackburn needs any required rights-of-entry to private parcels if public access is not available.

Task 2.4 Assumptions:

1. The City will assist in obtaining any right-of-entry agreements or permits necessary to access the site for USA and to complete our subsurface exploration.

2. Wood Rodgers will coordinate with private property owners to determine if any private utilities are known.

3. USACE will not require a Drilling Program Plan (DPP) based on our preliminary discussions with them regarding our proposed subsurface exploration program below.

4. Scope of services does not include liquefaction or seismic lateral spreading evaluation, or slope stability/seepage evaluation for the existing levee (river bank). We can provide these services if requested for an additional scope/fee.

Task 2 Deliverables:
• Traffic Counts
• One (1) Draft Traffic Operations Analysis Report (PDF Format) • One (1) Final Traffic Operations Analysis Report (PDF Format) • One (1) Draft Geotechnical Report (PDF Format)
• One (1) Final Geotechnical Report (PDF Format)
Task 3 - Environmental Documentation
Wood Rodgers will identify any additional supporting documentation needs and preparing and submitting the documents to the respective agencies. We will lead efforts in investigating, preparing documentation, and permits associated tribal, cultural, and historic preservation matters. We will prepare required permit applications unless otherwise prepared by the City. All permitting fees will be paid by the City. Additionally, WR will coordinate with ECORP and ensure all necessary cultural resource and tribal consultation documents are included in any permitting applications.

Task 3.1 - Preliminary Environmental Study (PES) Form
Wood Rodgers will prepare and submit a draft Preliminary Environmental Study (PES) to be reviewed by the City prior to submitting to Caltrans Local Assistance. The PES Form will function as an environmental scoping document outlining the environmental technical studies required, the level of NEPA document for the project, and what environmental permits are necessary. Wood Rodgers will provide an electronic version and one administrative draft version to the City and Caltrans for review and comment. Upon receipt of comments, Wood Rodgers will incorporate necessary revisions and submit one final version.

Task 3.2 – Natural Environment Study (Minimal Impacts)
Wood Rodgers will conduct fieldwork in order to assess the presence/absence of sensitive biological resources (e.g., species or habitats), or to determine the potential for occurrence of such resources that may not be detectable when the fieldwork is conducted. In addition, literature research will be conducted to determine the potential for sensitive 91 City of West Sacramento | North 5th Street Complete Streets and Connectivity Project (#24-064-RFP)
Page | 7
plant and animal species in the Project area. The location of any sensitive biological resources present on site, including plants and plant communities, will be mapped. Based on experience with the North Riverwalk Extension Project, the key concern will be identifying elderberry shrubs that may provide suitable habitat for the for the federally threatened Valley Elderberry Longhorn Beetle. If any elderberry shrubs are present, Wood Rodgers will avoid where feasible; however, the biological resources report will be prepared to support Section 7 Consultation between the U.S. Army Corps of Engineers and U.S. Fish and Wildlife Service should impacts to elderberry shrubs and/or beetles be unavoidable.

Wood Rodgers will prepare a Natural Environment Study (Minimal Impacts) which will include a description of the field methods used and the assessment of the Project area. The NESMI will list the plant and animal species present, as well as a general description of the plant communities occurring within the Project area. If any sensitive resources are found on the site, a graphic will be included with the Report displaying the location of the sensitive plant communities on site and any sensitive biological resources observed. Mitigation measures for potential impacts to sensitive species will be included as necessary. This document will be prepared in the Caltrans format in support of the NEPA document they approve; however, it will also be used to support the Army Corps 408 permit review and ensuring the project is consistent with all Endangered Species Act requirements.

Task 3.3 – Historic Resources Survey Report/Archaeological Survey Report Wood Rodgers’ Subconsultant ECORP will prepare a Historic Resources Survey Report and Archaeological Survey Report to identify archaeological or historic cultural resources in the area and to evaluate the potential impact that the Project might have on these resources. This report will be prepared in compliance with Public Resources Code 15064.5, determining the significance of impacts to archeological and historical resources. Where feasible, this effort will build off of prior analysis provided in the Bridge District Master Plan EIR and Supplemental EIR. If any resources are identified, they will be evaluated to determine if they meet any qualified criteria for eligibility on the National Register of Historic Places or the California Register of Historical Resources.

ECORP will complete an intensive field survey of the Project Area using pedestrian transects spaced 10 to 15 meters apart, where possible. ECORP archaeologists will closely examine the Project Area for surface evidence of cultural materials, including pre-contact and historic-period (i.e., older than 50 years of age) cultural deposits and features. If any resources are identified in the Project Area, they will be documented and mapped in detail in accordance with the standards of the California Office of Historic Preservation (OHP). ECORP assumes that there will be no cultural resources to be recorded during the survey, and that no Historic Resources Evaluation Report (HRER) will be required.

A cultural records search will be conducted through the Northwest Information Center in Sacramento, which serves the Yolo County area under the California Historical Resources Information System. As part of this effort, a list of Native American groups in the area will be requested from the Native American Heritage Commission. With City approval, ECORP will contact each tribe via certified mail. After 30 days, a follow–up will be made via telephone with those groups that have not responded to the initial letter. All Native American consultation efforts will be documented pursuant to Assembly Bill 52 (AB 52) under CEQA. The Historic Property Survey Report will be prepared in the Caltrans format and will be used to support NEPA, CEQA, and the federal requirements under Section 106.

This document will also be used by the US Army Corps of Engineers (USACE) during the 408 Permit coordination.

Task 3.3 Assumptions:

1. The City will be responsible for tribal consultation and preparation of tribal documents. 92 City of West Sacramento | North 5th Street Complete Streets and Connectivity Project (#24-064-RFP)
Page | 8
Task 3.4 – CEQA Initial Study/Mitigated Negative Declaration Wood Rodgers will prepare a draft Initial Study with proposed Mitigated Negative Declaration (IS/MND) for City review and comment. An Initial Study is suggested since a road diet is included in the scope of work and may not be eligible for a Categorical Exemption under CEQA. Once the draft IS/MND has been approved by the City, it will be circulated for public review for a period of 30 days. The IS/MND has a critical objective of providing a means by which the public and responsible agencies can participate in the environmental process by providing written comments on issues addressed in the IS/MND. Wood Rodgers will coordinate the preparation of the distribution list with the City, and pursuant to CEQA requirements, Wood Rodgers will also prepare a Notice of Availability/Notice of Intent for the Draft IS/MND. This notice, along with the draft environmental document, will be made available at the appropriate City office, County Clerk, and a local newspaper or distribution list of local property owners during the 30-day public circulation and review period. In addition, the document will be distributed to other reviewing government agencies through the California State Clearinghouse. Wood Rodgers will facilitate preparation of all hard copies, electronic copies, public notices, and directly mailers to ensure the public circulation period is noticed pursuant to CEQA requirements. All comments received during this period will be recorded for inclusion in the final environmental document.

Following public circulation of the Draft IS/MND, Wood Rodgers will review and coordinate with the City to prepare written responses to any comments received. All comments and written responses will be included within the Final IS/MND as an Appendix. Wood Rodgers will prepare a Final IS/MND and Mitigation Monitoring and Reporting Program (MMRP) for City final review and approval.

To complete the CEQA process, Wood Rodgers will prepare and file a Notice of Determination (NOD) with the Yolo County Recorder's Office and the Office of Planning and Research State Clearinghouse within 5 days of the City’s approval of the Final IS/MND and MMRP (pursuant to CEQA guidelines). This scope of work assumes the City will provide payment for the CEQA filing fee at the time the Notice of Determination is filed.

Task 3 Deliverables:
• One (1) Draft PES Form (PDF Format)
• One (1) Final PES Form (PDF Format)
• One (1) Draft Natural Environment Study (PDF Format)
• One (1) Final Natural Environment Study (PDF Format)
• One (1) Each Draft Historic Property Survey Report, Draft Archaeological Survey Report (PDF Format) • One (1) Each Final Historic Property Survey Report, Draft Archaeological Survey Report (PDF Format) • Draft IS/MND, CVFPB Permit, Public Notices and Forms (PDF Format) • Final IS/MND, CVFPB Permit, Public Notices and Forms (PDF Format) Task 4 – Reports, Permitting and Right of Way Activities Task 4.1 - Central Valley Flood Protection Board (CVFPB) Encroachment Permit and 408 USACE Levee Permit
Wood Rodgers will provide all environmental studies, documentation, and resources needed in support of the CVFPB Encroachment Permit application. Wood Rodgers will also provide early coordination with the USACE 408 Division to 93 City of West Sacramento | North 5th Street Complete Streets and Connectivity Project (#24-064-RFP)
Page | 9
ensure that the National Environmental Policy Act (NEPA) review will adequately support the 408 permit requirements. Wood Rodgers will provide as-needed environmental support throughout the CVFPB and 408 permit reviews.

Acquisition of a CVFPB Encroachment Permit can be a very lengthy task (between one and two years from the time of application submittal). Wood Rodgers will complete pre-application coordination with CVFPB and USACE early during the 30% design in order to introduce the project to the two key agencies with permitting authority over the project and to address any concerns they may have for the project design early in the project development process, in order to streamline the agencies’ issuance of permits.

As a federal agency, USACE is required to complete an evaluation of their permitting action in compliance with NEPA.

Wood Rodgers will use our understanding of the federal process and the way federal agencies coordinate to save the City substantial project development costs as well as eliminate the potential for expensive delays in the permit approval process.

Task 4.2 - West Sacramento Area Flood Control Agency Coordination and Permit Wood Rodgers will coordinate with the West Sacramento Area Flood Control Agency (WSAFCA) with regards to WSAFCA's obligations to oversee and protect the levees within Reclamation District (RD ) 900 and RD537. Wood Rodgers will prepare any permit applications required and will provide as-needed support throughout the permit review and authorization process.

Task 4.3 – Right of Way Acquisition and Certification
In order to successfully complete the project’s proposed improvements, it may be necessary for property rights to be acquired from up to 3 privately owned parcels. Monument will work closely with Wood Rodgers and the City to ensure that all potential property impacts are analyzed, and any required property rights are successfully acquired.

All services will be performed in accordance with all applicable statutory and regulatory requirements, including: the Uniform Relocation Assistance and Real Property Acquisition Policies Act of 1970 (49 CFR Part 24), as amended; the Caltrans Right-of-Way Manual; the Real Property Acquisition Guidelines (Title 25, California Code of Regulations); and the City’s own policies and procedures.

Task 4.3.1 - Right of Way Supporting During Design and Environmental Phases Monument understands that a right-of-way cost estimate will be required at the PID phase. At this phase, up to two build alternatives will be under consideration.

Monument will review any right-of-way analysis prepared during prior phases (including feasibility studies, funding applications, etc.) and coordinate with the design team to identify potential right-of-way acquisitions resulting from updated designs. Additionally, Monument will update information about existing conditions including ownership, land use, tenants, and existing encumbrances on affected properties (where available). This will help the design team identify and potentially avoid costly or long-lead acquisitions where possible.

The specific steps Monument will take to determine impacts and estimate costs are as follows:
• Perform a GIS analysis to determine properties potentially affected by each proposed alternative using alignment data prepared by the design team
• Use publicly available data and other real estate resources to confirm the ownership, land use, zoning, lot size, and improvements for each affected property
94 City of West Sacramento | North 5th Street Complete Streets and Connectivity Project (#24-064-RFP)
Page | 10
• Calculate the fee and/or easement area that will need to be acquired for each impacted property using design data and assessor boundary information
• Perform a desktop inspection of properties to confirm the probable acquisition type (full, partial, temporary, etc.) including identifying existing uses to be relocated (if any). • Estimate the total capital cost of acquisition for all parcels including real estate costs, relocation assistance, severance damages, loss of goodwill, fixtures and equipment, demolition and clearance • Estimate the total support cost for all parcels including appraisal fees, condemnation costs, title and escrow fees, environmental fees, and consultant fees as necessary • Escalate costs to anticipated right-of-way acquisition date • Document proposed acquisitions and resulting costs in a K Phase Conceptual Cost Estimate Form (Caltrans Exhibit 4-EX-8) for each alternative.
• Update and finalize the Cost Estimate Form based on feedback from the Wood Rogers team and the City.

Task 4.3.2 Assumptions:

1. Cost estimates will be prepared for a maximum of 2 build alternatives

2. Design team will document proposed right-of-way acquisitions in PDF exhibits and calculate the area of proposed fee acquisitions and easements.

3. Design and environmental teams will be available to review proposed right-of-way impacts and answer questions (assumes 1 review meeting)

4. Assumes right-of-way estimates will require a maximum of 2 revisions based on design team and City comments.

Task 4.3.2 - Right-of-Way Data Sheets
Once designs have advanced, right-of-way cost estimates will need to be updated for inclusion with the Project Report. Monument will review updated plans with the design team, identify any newly impacted properties (or properties no longer impacted), and update the estimates prepared at the PID phase to reflect the advanced design.

Estimates prepared at this phase will also take into consideration refined temporary construction easement areas, construction laydown areas, and other similar project elements that will have been identified in the PA&ED level design. Monument will prepare a Right-of-Way Data Sheet for review and comment by the design team and the City.

Monument will update the Data Sheets based on feedback from the project team and submit final Data Sheets to be submitted with the Project Report.

Task 4.3.2 Assumptions:

1. Data Sheets will be prepared for a maximum of 2 build alternatives

2. Design team will document proposed right-of-way acquisitions in PDF exhibits and calculate the area of proposed fee acquisitions and easements, including TCEs.

3. Design and environmental teams will be available to review proposed right-of-way impacts and answer questions (assumes 1 review meeting)

4. Assumes right-of-way estimates will require a maximum of 2 revisions based on design team and City comments.

Task 4.3.3 - Appraisals
All appraisals and appraisal reviews for the acquisition of real property will be prepared in accordance with the 49 CFR Part 24 and with the Uniform Standards of Professional Appraisal Practice (USPAP). A single “self-contained” 95 City of West Sacramento | North 5th Street Complete Streets and Connectivity Project (#24-064-RFP)
Page | 11
appraisal report will be prepared for each property acquisition that will contain relevant project-related data, subject property information, market comparables, and an analysis of the appraiser’s value conclusions.

During the appraisal process, Monument will be responsible for the following procedures:
• Prepare appraisal scope, fees, and timing on a property-by-property basis. • Issue appraisal notices to property owners. Conduct field reviews of property issues with appraisers. • Make weekly contact with appraisers to update progress. • Review appraisals for quality; request changes/additions as necessary or based on preliminary communication with the City. Complete memo indicating appraisal received and forwarding for review.

Appraisals will be prepared in accordance with USPAP requirements, and, at a minimum, contain the following requirements:
• Adequate description of the physical characteristics of the property being appraised (and, in the case of a partial acquisition, an adequate description of the remaining property). • Items identified as personal property.
• Statement of the known and observed encumbrances, if any, location, zoning, present use, an analysis of highest and best use, and at least a five-year sales history of the property. • All relevant and reliable approaches to value consistent with established federal and federally-assisted program appraisal practices. If the appraiser uses more than one approach, there is to be an analysis and reconciliation of approaches to value used that is sufficient to support the appraiser’s opinion of value. • A description of comparable sales, including a description of all relevant physical, legal, and economic factors such as parties to the transaction, source, and method of financing, and verification by a party involved in the transaction.
• Statement of the value of the real property to be acquired and, for a partial acquisition, a statement of value of the damages and benefits, if any, to the remaining real property where appropriate. • The effective date of valuation, date of appraisal, signature, and certification of the appraiser.

Task 4.3.4 – Appraisal Review
Review appraisals will be provided for each appraisal, and in accordance with State and Federal law and City policy as required. The review appraiser will, as appropriate:
• Identify the reviewer’s client and intended users, the intended use of the reviewer’s opinions and conclusions, and the purpose of the assignment.
• Identify the following:
o Subject of the appraisal review assignment.
o Effective date of the review.
o Property and ownership interest appraised (if any) in the work under review. o Date of the work under review and the effective date of the opinion or conclusion in the work under review.
o Appraiser(s) who completed the work under review, unless the identity was withheld. • Identify the scope of work to be performed.
96 City of West Sacramento | North 5th Street Complete Streets and Connectivity Project (#24-064-RFP)
Page | 12
• Develop an opinion as to the completeness of the material under review, given the scope of work applicable in the assignment.
• Develop an opinion as to the apparent adequacy and relevance of the data and the propriety of any adjustments to the data, given the scope of work applicable in the assignment. • Develop an opinion as to the appropriateness of the appraisal methods and techniques used, given the scope of work applicable in the assignment, and develop the reasons for any disagreement. • Develop an opinion as to whether the analyses, opinions, and conclusions are appropriate and reasonable, given the scope of work applicable in the assignment, and develop the reasons for any disagreement.
• Review appraisals will be forwarded to the City for establishment of just compensation prior to the preparation of offers to acquire the proposed land rights for the project.

Task 4.3.5 – Acquisition and Negotiation
Based on our understanding of the project and information provided by the City, Monument assumes that the Project will require the acquisition of property rights from up to 3 parcels. Monument will provide all acquisition services required for the City to purchase the right-of-way required to construct the Project. All tasks will be performed in accordance with applicable Federal, State and local regulations, and the City’s internal policies and procedures. Specifically, Monument will:
• Provide all acquisition services in a timely, efficient manner and at a reasonable cost. Work shall be performed in accordance with all applicable Federal, State, and local regulations. • Coordinate and manage the acquisition process with the City, legal counsel, design team, property owners, and tenants along with the title company, appraisers, and other consultants to insure effective cross-discipline communications.
• Review right-of-way plans, appraisal reports, title reports, appraisal maps and legal descriptions and all other pertinent documents.
• Prepare acquisition offer packages consisting of the City’s written purchase offer, appraisal summary statement, acquisition brochure, acquisition agreement, conveying instruments (Grant Deed, Permanent and/or Temporary Easements, etc.), Certificate of Acceptance, recommendation of amount of Just Compensation, plat maps and legal descriptions, and Title VI Information. • Monument’s acquisition agent will meet personally with each property owner to present the City’s purchase offer, explain the project design requirement, and inform him or her of the City’s right-of-way acquisition process.
• Negotiate personally in good faith with each property owner, his/her agent or representative and discuss the valuation of the property interests, gather information for consideration and address any questions or concerns that may arise during the acquisition process. • Establish and maintain an acquisition file for each property owner or property interest acquired and maintain a file checklist pursuant to the City’s specifications. • Promptly transmit executed documents (acquisition agreements, executed deeds, rental agreements, statements of information, offset statements, and the like) to the City for acceptance and processing. A report summarizing the pertinent information relative to the transaction will be included. • Prepare and submit a Letter of Recommendation to the City for any proposed administrative settlements with property owners. The letter will include a chronology of the negotiation efforts, provide supporting 97 City of West Sacramento | North 5th Street Complete Streets and Connectivity Project (#24-064-RFP)
Page | 13
evidence and documentation and an explanation of the benefits and rationale behind the recommendation.
• Escrow Coordination – Coordinate opening of escrows, assist the escrow company in obtaining additional documentation as necessary to provide clear title to the City, supervise and review the closing of escrows, and review closing statements for completeness and accuracy. We will serve as liaison between the title company, escrow holder, and the City.
• Recommend condemnation action when negotiations have reached an impasse. The required justification will be submitted in writing to the City. Our primary goal will be to reach an acceptance of the offer with each property owner. We will work with the City in recommending solutions to achieve acceptance of the offer.
• Perform any other normal procedures and processes to implement the acquisition assignment and provide any other supporting information and/or correspondence required by the City. • Provide bilingual acquisition agents, if necessary.
• Prepare all applicable forms, secure property owner’s approval and signature and submit the forms to the City for review and acceptance.
• Upon completion of the acquisition process for each property or property interest, or at project completion, Monument will provide the City with the original acquisition file as well as electronic copy of files for future audit purposes.

Task 4 Deliverables:
• CVFPB Permit
• USACE 408 Permit
• WSAFCA Permit
• Conceptual Cost Estimate Form for up to two (2) Build Alternatives • Right-of-Way Data Sheet for up to two (2) build alternatives (Caltrans Exhibit 17-EX-21) • Up to 3 appraisal reports.
• Up to 3 appraisal reviews.
• Up to 3 executed Agreements and Deeds/Easements.

Task 5 - Surveying
Task 5.1 - Topographic Surveying and Base Map
Wood Rodgers will provide all topographic surveying to support the Project efforts. Survey information will utilize previously obtained survey information in the Bridge District as a base and will conform to match the existing improvements on public and private project that border the Project area. Survey information will be provided at scales of 1”=20’ or 1”= 40’ and with minimum 1-foot contours. Adequate survey and utility information will be collected to design the South Riverwalk Extension, drainage, above and belowground utility and infrastructure, facilities, Universal Road, connection to the proposed Riverfront Parking Lot, the existing Riverwalk (north of the Project), and Riverfront Road.

Wood Rodgers will establish the levee offsets and facilitating the City’s land acquisition and easement efforts. Our effort will include, but is not limited to, interpolating title reports and plat and legal descriptions pertaining to the properties associated with the Project area.
98 City of West Sacramento | North 5th Street Complete Streets and Connectivity Project (#24-064-RFP)
Page | 14
Wood Rodgers will work with the City to coordinate with WSAFCA’s Sacramento River West North Levee Project.

WSAFCA efforts in collaboration with this Project and other City projects will set the stage for the levee easement and land acquisition needed for this Project.

Wood Rodgers will review other data provided by the City and will verify the accuracy of the provided information prior to use in the development of any Project related documents.

Wood Rodgers will create a topographic base map from the topographic survey and other provided/available data that will be used as the base for design. In addition, adjacent affected properties will be shown from record information by Title Reports. Assessor Parcel Numbers (APN) for each parcel will be shown. The APN will be a text entity in the base map with no linked attribute information. The source of the APNs will be the County Assessor’s Office.

Task 5.1 Assumptions:

1. City will pay or wave all encroachment permit fees necessary to complete survey.

2. City will assist with obtaining owner permission to survey on private property.

Task 5.2 – Plats and Legal Descriptions
Wood Rodgers will prepare preliminary (draft) plat and legal documents for right of way and easement acquisition.

Wood Rodgers will research available Caltrans survey monumentation and/or other right-of-way boundary recorded data and will perform a boundary survey to establish right of way parcel lines.

Upon review by City staff, final plat and legal documents will be prepared to be used for right of way and easement appraisal and acquisition.

Task 5.2 Assumptions:

1. Up to three (3) plat and legal documents will be prepared.

2. Wood Rodgers will obtain up to four (4) title reports.

3. Right of way acquisition will commence in a timely manner such that title reports will only have to be purchased once.

Task 5 Deliverables:
• Topographic Survey and Base Map (AutoCAD DWG Format)
• Up to three (3) plat and legal documents
Task 6 – Utility Coordination
Wood Rodgers will perform utility coordination consistent with Chapter 13 of the Caltrans Right-of-Way Manual and Chapter 14 of the Caltrans Local Assistance Procedures Manual (LAPM). The work will include:
• Obtain current utility maps and incorporate utility locations into Base Map. • Request Conflict Resolution and Liability Determination from the affected utilities, as needed. • Prepare Report of investigation, Notices to Owner, and Utility Agreements, as needed. • Submit Report of investigation, Notices to Owner, and Utility Agreements to Caltrans District Utility Coordinator for review and approval.
99 City of West Sacramento | North 5th Street Complete Streets and Connectivity Project (#24-064-RFP)
Page | 15
Wood Rodgers will also perform utility research of the local agencies and utility providers to identify existing utility locations based on records drawings. This information will be incorporated into the base map. As an optional task, Wood Rodgers will pothole underground utilities within the Project site that may be in conflict with proposed improvements.

In conjunction with City staff, Wood Rodgers will work with Caltrans Local Assistance to prepare and submit all required LAPM forms for utility certification.

Task 6 Assumptions:

1. Potholing effort can be completed in one (1) day.

2. City will provide a letter authorizing Wood Rodgers to work on the City’s behalf for utility coordination.

Task 6 Deliverables:
• Utility Maps
• Report of Investigation, Notices to Owner, and Utility Agreements • Utility Certification
Task 7 – Plans, Specifications and Estimate
Task 7.1 – Design Alternatives and Public Workshop
Wood Rodgers will develop up to two (2) conceptual design alternatives, considered 30% designs, that portray:
1) A road diet on 5th Street/Lighthouse Drive between C Street and Fountain Drive. Improvements will include reducing travel lanes, on-street parking, and buffered bike lanes. 2) A connection between 5th Street and the Riverwalk Trail at or near A Street.

Both conceptual design alternatives will be ADA compliant and meet the regulatory agency requirements.

For the 5th St/A St connection to the River Walk Trail, Wood Rodgers will define improvements in sufficient detail to obtain agency consensus on the configuration and extent of the Project. The alternatives will be analyzed to qualitatively compare cost, pedestrian and bicyclist accessibility and connectivity, safety, design exceptions, environmental impacts, right of way and utility relocation requirements. It is assumed that up to three design options (i.e. three iterations) will be needed before the optimum design alternative is determined. This task is anticipated to be an iterative process.

Concept exhibits will be prepared for the final design alternative that will be used for public meetings. As appropriate, the exhibits will consist of: 3D graphical views/visual simulations, plan and elevation views (Geometric Approval Drawing).

Additionally, Wood Rodgers will prepare a preliminary cost estimate, preliminary design and construction schedule, a brief design report describing each design’s critical components and list the informational and/or decisions needed to advance each conceptual design; the necessary permits and respective timelines to obtain each permit; right-ofway and land acquisition needs and timelines; preliminary construction costs. The report will include reference to the Pioneer Bluff Conceptual Design.
100
City of West Sacramento | North 5th Street Complete Streets and Connectivity Project (#24-064-RFP)
Page | 16
The public outreach strategy for the North 5th Street Complete Streets and Connectivity Project is designed to ensure meaningful community engagement and transparent communication throughout the project's design phase. This project aims to transform North 5th Street into a safer, more accessible, and connected corridor that meets the needs of all users—pedestrians, cyclists, and motorists. Public outreach is a crucial component of this phase, as it allows project planners to gather insights directly from those who use the area daily, ensuring that proposed improvements resonate with community needs and priorities.

By engaging residents and stakeholders early and often, public outreach helps identify potential challenges, uncover innovative local solutions, and foster a sense of shared ownership over the project. This process builds trust, mitigates potential concerns, and strengthens public support, paving the way for smoother project implementation and long-term community benefits.

KMP has a proven track record of developing and executing tailored public outreach programs for similar engineering and construction projects, KMP ensures an inclusive, impactful approach that reflects the voice of the community.

Their expertise includes organizing public meetings, facilitating stakeholder assessments, and creating accessible multimedia materials that simplify complex project details for diverse audiences. By leveraging these capabilities, KMP will provide a platform where community input is not only collected but actively integrated into the project’s development.
• Community Open House Meetings - Open house community meetings are important to provide a venue for stakeholders to learn about the project and provide feedback on project components. KMP will identify those parcels/groups most directly impacted by the project and, in partnership with the City, KMP will manage the logistics, format, and content for up to two (2) public open house meetings with the community. These meetings will be scheduled incrementally through the design process. Includes meeting logistics, stakeholder notifications, and facilitation. The open houses will be held at a City facility. • Collateral Materials – KMP will develop up to 4 individual collateral materials that will inform the community/stakeholders about the project, its impacts and benefits, and schedule. Includes content development, graphic design, printing, and mailing (when necessary). Materials can include open house/community meeting notification, information boards for open houses, fact sheets, and FAQs, depending on project needs providing flexibility throughout the project. Materials can be prepared in English and Spanish.
• Presentations – KMP will prepare and conduct up to two (2) presentations that provide project updates, highlight community feedback integration, and discuss project milestones and next steps to the Transportation, Mobility, and Infrastructure Commission. • Outreach Management & Strategic Guidance – KMP will manage outreach and reports, monitor project communications, and attend necessary project meetings. KMP is flexible and can adjust the outreach approach knowing that the best laid plans often change, to meet project needs. All produced materials will be reviewed and approved by key City team member with up to two rounds of edits.

Task 7.2 - 60% Design and Plans, Specifications, and Estimate Wood Rodgers will prepare 60% design and plans for the 30% alternative selected by the City, incorporating any comments or design changes, and will prepare preliminary technical specifications. Quantities and cost estimate will be updated. All plans will be prepared in accordance with the City of West Sacramento Standards, Title 23 and Section 408 requirements. The plans may include, but are not limited to, the following:
• General Sheets (e.g., General Notes, Regulatory Agency Notes, and Project Specific Notes, etc.) 101
City of West Sacramento | North 5th Street Complete Streets and Connectivity Project (#24-064-RFP)
Page | 17
• Improvement Plans including Plan, Profile, Construction Details, and Typical Sections • Existing Utilities and Demolition Plans
• Grading Plans
• Proposed Utility Plans (e.g., water, storm drain, etc.) • Signing and Striping Plans
• Traffic Signal and Lighting Modification Plans (with Photometric Analysis) • Proposed Lighting with Photometric Analysis and Safety Features • Irrigation and Landscape Plans
• Erosion Control Plans
Wood Rodgers will prepare a list of all anticipated specifications need for the project, including but not limited to, supplemental front-end specifications, special provisions, or other relevant specifications pending changes to the funding source or regulatory agency requirements. The Contract Documents will be prepared in accordance with the City of West Sacramento Standards and comply with Project affiliated land acquisition, right-of-way, and easement agreements terms and conditions.

Task 7.2 Assumptions:

1. The City will prepare front-end “boilerplate” specifications.

2. Cost estimate unit prices will be based on bid results provided by the City and/or Caltrans cost data.

3. All PS&E documents will be submitted electronically.

Task 7.3 - 90% Design and Plans, Specifications, and Estimate (Optional Task) Wood Rodgers will incorporate any City comments on the 60% plans, technical specifications, and cost estimate. The 90% submittal will include complete draft plans, technical specifications, and a detailed engineer’s construction estimate. This is an optional task that will not be performed without prior written authorization by the City and additional fee.

Task 7.4 - Final Plans, Specifications, and Estimate (Optional Task) Wood Rodgers will revise the 90% PS&E based on City comments and will finalize the PS&E package for construction bidding. It is anticipated that there will not be another round of review or comments after this submittal. This is an optional task that will not be performed without prior written authorization by the City and additional fee.

Task 7 Deliverables:
• Two (2) conceptual alternative exhibits, preliminary cost estimates (PDF Format) • Up to six (6) 3D graphical views/visual simulations/public meeting exhibits (PDF Format) • One (1) Design Report (PDF Format)
• One (1) 60% Plans, Draft Technical Specifications, Cost Estimate (PDF Format) • One (1) 90% Plans, Technical Specifications, Cost Estimate (PDF Format) • One (1) Final Plan Set (PDF Format)
• One (1) Final Technical Specifications (Word and PDF Format) • One (1) Final Cost Estimate (Excel and PDF Format)
102
City of West Sacramento | North 5th Street Complete Streets and Connectivity Project (#24-064-RFP)
Page | 18
Task 8 – Grant & Bid and Award Support (Optional Tasks) Task 8.1 – Grant Support
Wood Rodgers will assist the City in identifying possible grant opportunities. This will involve preparing a list of possible federal grants that the City could consider pursuing. Wood Rodgers can assist the City in preparing grant applications as well for an additional scope/fee.

Task 8.1 Deliverables:
• Grant Opportunities Support
• Grant Application Support (if requested)
Task 8.2 - Bid and Award Support
Wood Rodgers will assist the City during the bidding and award of the Project. Wood Rodgers will attend the pre-bid meeting, if requested, and assist the City of West Sacramento in answering questions from Contractors during the bidding process as well as assisting the City with bid evaluation as required. Consult with and assist City engineering and construction management staff regarding Contractor proposals, construction issues, and plan revisions. This is an optional task that will not be performed without prior written authorization by the City and additional fee.

Task 8.2 Assumptions:

1. Up to three (3) PS&E addenda during bidding with responses to Contractor questions in written format to the City’s Project Manager.

Task 8.2 Deliverables:
• Attend one (1) Bid Meeting
• Prepare up to three (3) Addenda
• One (1) Electronic CAD File Submittal (DWG Format)
103
Wood Rodgers, Inc.

CPE24-354 North 5th Streets Complete Streets and Connectivity Expires on 6/30/2027

EXHIBIT B
Schedule of Performance
Contract Start Date January 15, 2025
Contract End Date June 30, 2027
104
City of West Sacramento | North 5th Street Complete Streets and Connectivity Project (#24-064-RFP)
Page | 25
Project Schedule
105
Wood Rodgers, Inc.

CPE24-354 North 5th Streets Complete Streets and Connectivity Expires on 6/30/2027

EXHIBIT C
Schedule of Fees
106
Local Assistance Procedures Manual EXHIBIT 10-H1
Cost Proposal
Note: Mark-Ups are Not Allowed
Consultant: Wood Rodgers, Inc.

Project No. Contract No.

Project Name

DIRECT LABOR
Classification Hours Actual Hr Rate Total
Principal Engineer II 90.00 - 125.00 26 $ 125.00 $ 3,250.00 Senior Engineer II 68.25 - 93.75 154 $ 78.13 $ 12,032.02 Principal Engineer I 79.33 - 110.58 36 $ 100.96 $ 3,634.56 Project Engineer I 58.65 - 83.32 92 $ 49.00 $ 4,508.00
Project Engineer I 38.50 - 52.50 80 $ 52.88 $ 4,230.40
Engineer II 218 $ 42.00 $ 9,156.00
Senior Engineer I 90.00 - 125.00 24 $ 68.90 $ 1,653.60
Senior Engineer II 16 $ 80.53 $ 1,288.48
Engineer II 32 $ 40.00 $ 1,280.00
Senior Engineer II 32 $ 69.71 $ 2,230.72
Principal Landscape Architect I 8 $ 88.94 $ 711.52
Sr. Landscape Architect I 24 $ 60.10 $ 1,442.40
Project Landscape Architect I 56 $ 51.25 $ 2,870.00
Principal Engineer I 57.00 - 71.11 10 $ 91.35 $ 913.50
Senior Surveyor II 36 $ 86.54 $ 3,115.44
Principal Engineer I 52 $ 82.00 $ 4,264.00
Principal Planner I 0 $ 81.73 $ -
Senior Engineer I 80 $ 74.52 $ 5,961.60
Project Coordinator 24 $ 43.00 $ 1,032.00
Principal Engineer II 0 $ 150.00 $ -
Principal Engineer I 0 $ 110.58 $ -
Senior Engineer II 0 $ 93.75 $ -
Senior Engineer I 20 $ 83.32 $ 1,666.40
Project Engineer II 0 $ 71.11 $ -
Project Engineer I 182 $ 62.25 $ 11,329.50
Engineer II 110 $ 52.00 $ 5,720.00
Engineer I 434 $ 41.00 $ 17,794.00
Assistant Engineer 24 $ 37.00 $ 888.00
Designer 24 $ 39.00 $ 936.00
Sr CAD Tech/Graphics Designer II 120 $ 49.00 $ 5,880.00 Senior Surveyor II 0 $ 86.54 $ -
Senior Surveyor I 0 $ 60.82 $ -
Project Surveyor II 12 $ 58.00 $ 696.00
Project Surveyor I 34 $ 56.01 $ 1,904.34
Surveyor II 40 $ 48.00 $ 1,920.00
Surveyor I 40 $ 43.25 $ 1,730.00
Survey Crew 80 $ 60.49 $ 4,839.20
Principal Planner I 0 $ 103.37 $ -
Senior Planner II 0 $ 80.53 $ -
Senior Planner I 0 $ 70.91 $ -
Project Planner II 0 $ 58.89 $ -
Project Planner I 0 $ 62.50 $ -
Planner II 0 $ 45.00 $ -
Planner I 0 $ 38.50 $ -
Principal GIS I 0 $ 88.94 $ -
Senior GIS II 0 $ 83.17 $ -
Michael Nowlan
Rosa Rios-Dominguez
Steven Leung
John Nicolaus
Corey Kazinec
Ashley Christensen
Jay Punia
Derek Kirkland
Tim Chamberlain
Dennis Barber
Craig Spiess
Lynette Marshall
Mark Rayback
Steven Robinson
James Pangburn
Katie Alexandrova
Alan Wong
Cody Milligan
EXHIBIT 10-H1 COST PROPOSAL Page 1 of 3

ACTUAL COST-PLUS-FIXED FEE OR LUMP SUM (FIRM FIXED PRICE) CONTRACTS (DESIGN, ENGINEERING AND ENVIRONMENTAL STUDIES)
November 26, 2024
City of West Sacramento North 5th Street Complete Streets Name Fee Range
Victoria Martinez
Prime Consultant Subconsultant 2nd Tier Subconsultant

January 2018
107
Local Assistance Procedures Manual EXHIBIT 10-H1
Cost Proposal
Senior GIS I 0 $ 72.50 $ -
Project GIS II 0 $ 65.00 $ -
Project GIS I 0 $ 53.50 $ -
Senior Geologist II 0 $ 79.33 $ -
Senior Geologist I 0 $ 66.59 $ -
Project Geologist II 0 $ 61.30 $ -
Project Geologist I 0 $ 57.00 $ -
2,120

LABOR COSTS
a) Subtotal Direct Labor Costs $ 118,877.68
b) Anticipated Salary Increases $0.00
c) TOTAL DIRECT LABOR COSTS [(a) + (b)] $ 118,877.68

INDIRECT COSTS
d) Fringe Benefits (Rate:) 59.21% c) Total Fringe Benefits [(c) x (d)] $ 70,387.47 f) Overhead (Rate:) 132.76% g) Overhead [(c) x (f)] 157,822.01 $ h) General and Administrative (Rate: 0.00% ) i) Gen & Admin [(c) x (h)] $ - j) TOTAL INDIRECT COSTS [(e) + (g) + (i)] $ 228,209.48
FIXED FEE k) TOTAL FIXED FEE [(c) + (j)] x fixed fee 10% ] $ 34,708.72 l) CONSULTANT’S OTHER DIRECT COSTS (ODC) – ITEMIZE (Add additional pages if necessary) Quantity Unit Unit Cost Total
Actual $ 4,000.00
Actual $ 5,000.00
Actual $ 10,000.00
Actual $ 10,000.00
i) TOTAL OTHER DIRECT COSTS $ 29,000.00
m) SUBCONSULTANTS' COSTS (Add additional pages if necessary) $ 52,966.90
$ 44,143.24
$ 26,031.36
$ 80,877.34
m) TOTAL SUBCONSULTANTS' COSTS $ 204,018.84
n) TOTAL OTHER DIRECT COSTS INCLUDING SUBCONSULTANTS [(l) + (m)] $ 233,018.84 TOTAL COST [(c) + (j) + (k) + (n)] $ 614,814.72
NOTES:

2. The cost proposal format shall not be amended. Indirect cost rates shall be updated on an annual basis in accordance with the consultant’s annual accounting period and established by a cognizant agency or accepted by Caltrans.

3. Anticipated salary increases calculation (page 2) must accompany.

BLACKBURN (GEOTECHNICAL)

ECORP (ENVIRONMENTAL)
MONUMENT (RIGHT-OF-WAY) [DBE]

1. Key personnel must be marked with an asterisk (*) and employees that are subject to prevailing wage requirements must be marked with two asterisks (**). All costs must comply with the Federal cost principles. Subconsultants will provide their own cost proposals.

KMP STRATEGIES (OUTREACH) [DBE]
Description of Item
Traffic Counts
Potholing
Event Hosting Costs
Title Reports

January 2018
108
Local Assistance Procedures Manual EXHIBIT 10-H1
Cost Proposal
Direct Labor Total Hours per Avg 5 Year
Subtotal per Cost Cost Proposal Hourly Contract
Proposal Rate Duration
= $56.07 Year 1 Avg
Hourly Rate
Avg Hourly Rate Proposed Escalation
Year 1 + 3.0% = $57.76 Year 2 Avg Hourly Rate
Year 2 + 3.0% = $59.49 Year 3 Avg Hourly Rate
Year 3 + 3.0% = $61.27 Year 4 Avg Hourly Rate
Year 4 + 3.0% = $63.11 Year 5 Avg Hourly Rate
Estimated % Completed Total Hours per Cost Total Hours per Each Year Proposal Year
Year 1 * 2,120 = 2120 Estimated Hours Year 1
Year 2 * 2,120 = 0 Estimated Hours Year 2
Year 3 * 2,120 = 0 Estimated Hours Year 3
Year 4 * 2,120 = 0 Estimated Hours Year 4
Year 5 * 2,120 = 0 Estimated Hours Year 5
Total Total = 2,120
Avg Hourly Rate Estimated hours
(Calculated above) (Calculated Above)
Year 1 * 2120 = Estimated Hours Year 1
Year 2 * 0 = Estimated Hours Year 2
Year 3 * 0 = Estimated Hours Year 3
Year 4 * 0 = Estimated Hours Year 4
Year 5 * 0 = Estimated Hours Year 5
Total Direct Labor Cost with Escalation =
Direct Labor Subtotal before Escalation =
Estimated total of Direct Labor Salary Increase = Transfer to Page 1 NOTES:

3. This assumes that one year will be worked at the rate on the cost proposal before salary increases are granted.

4. Calculations for anticipated salary escalation must be provided.

2. An estimation that is based on direct labor multiplied by salary increase % multiplied by the # of years is not acceptable. $63.11 $0.00
$118,877.68
$118,877.68
$0.00

1. This is not the only way to estimate salary increases. Other methods will be accepted if they clearly indicate the % increase, the # $57.76 $0.00
$59.49 $0.00
$61.27 $0.00

0.0%
100.000%

4. Calculate Total Costs including Escalation (Multiply Average Hourly Rate by the number of hours) Cost Per
Year
$56.07 $118,877.68
$61.27

3. Calculate estimated hours per year (Multiply estimate % each year by total hours) 100.0%

0.0%

0.0%

0.0%
$118,877.68 2,120

1. Calculate hourly rate for all years (Increase the Average Hourly Rate for a year by proposed escalation %) $56.07
$57.76
$59.49
EXHIBIT 10-H1 COST PROPOSAL Page 2 of 3

ACTUAL COST-PLUS-FIXED FEE OR LUMP SUM (FIRM FIXED PRICE) CONTRACTS (CALCULATIONS FOR ANTICIPATED SALARY INCREASES)

1. Calculate Average Hourly Rate for 1st year of the contract (Direct Labor Subtotal divided by total hours)

January 2018
109
Local Assistance Procedures Manual EXHIBIT 10-H1
Cost Proposal

1. Generally Accepted Accounting Principles (GAAP)

2. Terms and conditions of the contract

3. Title 23 United States Code Section 112 - Letting of Contracts

4. 48 Code of Federal Regulations Part 31 - Contract Cost Principles and Procedures

5. 6. 48 Code of Federal Regulations Part 9904 - Cost Accounting Standards Board (when applicable) Prime Consultant or Subconsultant Certifying:

Name**: Title**:

Signature: Date of Certification (mm/dd/yyyy):

Email**: Phone Number:

Address: 3301 C Street, Building 100B, Sacramento, CA 95816 List services the consultant is providing under the proposed contract:
**An individual executive or financial officer of the consultant’s or subconsultant’s organization at a level no lower than a Vice President or a Chief Financial Officer, or equivalent, who has authority to represent the financial information utilized to establish the cost proposal for the contract.

Prime consultant
Mark Rayback, PE Vice President
9/10/2024
[email protected] (916) 440-8131
EXHIBIT 10-H1 COST PROPOSAL Page 3 of 3
Certification of Direct Costs:

I, the undersigned, certify to the best of my knowledge and belief that all direct costs identified on the cost proposal(s) in this contract are actual, reasonable, allowable, and allocable to the contract in accordance with the contract terms and the following requirements:
23 Code of Federal Regulations Part 172 - Procurement,
All costs must be applied consistently and fairly to all contracts. All documentation of compliance must be retained in the project files and be in compliance with applicable federal and state requirements. Costs that are noncompliant with the federal and state requirements are not eligible for reimbursement.

Local governments are responsible for applying only cognizant agency approved or Caltrans accepted Indirect Cost Rate(s).

January 2018
110
Staffing Worksheet
COMPANY: Wood Rodgers, Inc. DATE: 7/21/23PROJECT: City of West Sacramento - North 5th Street Complete Streets M. Rayback
Principal
Engineer II
S. Robinson
Senior
Engineer II
J. Pangburn
Principal
Engineer I
K. Alexandrova
Project
Engineer I
A. Wong
Project
Engineer I
V. Martinez
Engineer II
C. Milligan
Senior
Engineer I
M. Nowlan
Senior
Engineer II
R. RiosDominguez
Engineer II
S. Leung
Senior
Engineer II
J. Nicolaus
Principal
Landscape
Arch. I
C. Kazinec
Senior
Landscape
Arch. I
A. Christensen
Project Landscape
Arch. I
D. Barber
Principal
Surveyor I
C. Spiess
Senior
Surveyor I
J. Punia
Principal
Engineer I
D. Kirkland
Principal Planner I
T. Chamberlain
Senior Engineer
I
Senior
Engineer I
Project
Engineer I Engineer II Engineer I Assistant Engineer Designer Senior CAD Tech II Project Surveyor II Project Surveyor I Surveyor II Surveyor I Survey Crew L. Marshall Project Coordinator Billing Rate: $ 401.46 $ 250.93 $ 324.25 $ 157.37 $ 169.83 $ 134.89 $ 221.28 $ 258.64 $ 128.47 $ 223.89 $ 285.65 $ 193.02 $ 164.60 $ 293.39 $ 277.94 $ 263.36 $ 262.49 $ 239.33 $ 267.60 $ 199.93 167.01$ 131.68$ $ 118.83 $ 125.26 $ 157.37 $ 186.28 $ 179.89 $ 154.16 $ 138.90 $ 194.27 $ 138.10 26 50 32 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 000 0 000000 24 132 3 $ 6,674.77 16 32 8 56 $ 15,557.84
816 16 40 $ 9,436.14
2 232 36 $ 11,680.78
0 100 4 4 0 0 0 0 0 0 0 0 0 0 0 0 8 20 18 40 120 0 000000 0 116 2 $ 2,943.79 2 25 $ 01.86
4 4 $ 1,070.39
2 16 18 40 12 88 $ 16,642.49
64 4 8 22 $ 4,729.06
0 00 0 0000 0 0 0 0 0 0 0 0 0 60 0116 02120 0 000000 0 388 6 $ 5,467.32 12 24 40 76 $ 12,937.38
432 48 84 $ 13,675.55
12 12 24 $ 4,452.1532 60 112 204 $ 34,402.25
0 200 20 0 0160 0 0 0 0 0 0 0 52 0 12 048 0200 0 0 0 0 0 0 0 0 188 4 $ 0,503.14 12 12 8 28 12 30 20 122 $ 25,547.23
88 8 24 18 66 $ 14,955.91
0- $
0 60 4 0000 0 0 0 0 0 10 36 0 0 0 0 0 000 0 012 34 40 40 80 0 262 5 $ 0,690.62 4 616 12 18 20 40 80 196 $ 36,865.60
24 420 16 20 66 $ 13,825.02
0 164 0 40 18 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0200 0 0 0 0 0 0 0 0 98 1 $ 7,166.76 16 4 40 18 20 98 $ 17,166.76
0 520 64 36 2008 16 32 32 8 24 56 0 0 0 0 0 0 070 170 24 24 1200 0 0 0 0 0 1508 2 $ 40,100.53 28 24 16 80 8 8 4 16 40 70 90 40 424 $ 68,059.53
24 40 20 120 8 8 24 32 4 8 16 80 24 24 80 512 $ 80,289.95

OPTIONAL TASKS
20 40 16 80 8 8 16 40 2 8 8 60 20 20 40 386 $ 62,181.7910 20 8 40 4 4 4 16 4 4 24 16 12 20 186 $ 29,569.27 0 102 24 8160 0 0 2 0 2 0 0 2 0 24 0 0 0 800 0 0 0 0 0 0 0 4 102 2 $ 0,029.52 22 24 4 32 $ 8,002.52
824 8 16 2 2 2 8 70 $ 12,027.00
TOTAL HOURS 26 154 36 92 80 218 24 16 32 32 8 24 56 10 36 52 0 80 20 182 110 434 24 24 120 12 34 40 40 80 24 2120 TOTAL LABOR FEE $10,438 $38,643 $11,673 $14,478 $13,587 $29,406 $5,311 $4,138 $4,111 $7,164 $2,285 $4,633 $9,217 $2,934 $10,006 $13,695 $0 $19,147 $5,352 $36,387 $18,371 $57,148 $2,852 $3,006 $18,885 $2,235 $6,116 $6,166 $5,556 $15,542 $3,314 $381,795.88 OTHER DIRECT COSTS (ODC) AMOUNTTitle Reports $ 4,000.00Traffic Counts $ 5,000.00Potholling $ 10,000.00Event Hosting Costs $ 6,000.00TOTAL ODC EXPENSE $ 25,000.00 WOOD RODGERS' PROJECT TOTAL COST (LABOR + ODC) $406,795.88 TASK 8 - GRANT & BID & AWARD SUPPORT
Task 8.2 - Bid & Award SupportTask 8.1 - Grant Support
TASK 5 - SURVEYING
Task 5.1 - Topographic Surveying & Base MapTask 5.2 - Plats and Legal Descriptions TASK 6 - UTILITY COORDINATION
Task 6 - Utility Coordination
TASK 7 - PLANS, SPECIFICAITONS, & ESTIMATES
Task 7.1 - Design Alternative and Concept/Workshop ExhibitsTask 7.2 - 60% Design and Plans, Specifications, and EstimateTask 7.4 - Final Plans, Specifications, and EstimateTask 7.3 - 90% Design and Plans, Specifications, and EstimateTask 3.1 - Preliminary Environmental StudyTask 3.2 - Natural Environment StudyTask 3.4 - CEQA Initial Study/Mitigated Negative Declaration TASK 4 - REPORTS, PERMITTING, & RIGHT OF WAY ACTIVITIES Task 4.1 - CVFPB Encroachment Permit & 408 USACE Levee Permit TASK 2 - DATA COLLECTION & REVIEW
Task 2.1 - Data CollectionTask 2.2 - Traffic, Pedestrian, & Bicycle CountsTask 2.3 - Traffic StudyTask 2.4 - Geotechnical Design WOOD RODGERS, INC.

TOTAL TASK FEE

AMOUNT DESCRIPTION
Personnel: TOTAL TASK
HOURS
Task 4.2 - West Sacramento Area Flood Control Agency Coordination and PermitTask 4.3 - Right of Way Acquisition and CertificationTask 3.3 - Historic Resources Survey Report/Archaeological Survey Report TASK 3 - ENVIRONMENTAL DOCUMENTATION AND PERMITTINGTASK 1 - PROJECT MANAGEMENT & COORDINATION Task 1.1 - Meetings and ConsultationTask 1.2 - Reporting and InvoicingTask 1.3 - Quality Control 5 111
Certification of Indirect Costs and Financial Management System - Independent Office of Audits and Investigations - Revised 9/2022 Inspector General
California Department of Transportation
Certification of Indirect Costs and Financial Management System (Note: If a Safe Harbor Indirect Cost Rate is approved, this form is not required) Consultant’s Full Legal Name:

Important: Consultant means the individual or consultant providing engineering and design related services as a party of a contract with a recipient or sub-recipient of Federal assistance. Therefore, the Indirect Cost Rate(s) shall not be combined with its parent company or subsidiaries.

Indirect Cost Rate (ICR):

Combined Rate: Or
Home Office Rate: and Field Office Rate (if applicable):

Facilities Capital Cost of Money (if applicable):

Fiscal Period:*
* Fiscal period is annual one year applicable accounting period that the ICR was developed (not the contract period). The ICR is based on the consultant’s one-year applicable accounting period for which financial statements are regularly prepared by the consultant.

I have reviewed the proposal to establish an ICR(s) for the fiscal period as specified above and have determined to the best of my knowledge and belief that:
• All costs included in the cost proposal to establish the ICR(s) are allowable in accordance with the cost principles of the Federal Acquisition Regulation (FAR) 48, Code of Federal Regulations (CFR), Chapter 1, Part 31 (48 CFR Part 31).
• The cost proposal does not include any costs which are expressly unallowable under the cost principles of 48 CFR Part 31.
• The accounting treatment and billing of prevailing wage delta costs are consistent with our prevailing wage policy as either direct labor, indirect costs, or other direct costs on all federally-funded A&E Consultant Contracts.
• All known material transactions or events that have occurred subsequent to year-end affecting the consultant’s ownership, organization, and indirect cost rates have been disclosed as of the date of this certification.

I am providing the required and applicable documents as instructed on the Financial Document Review Request form.

Financial Management System:

Our labor charging, job costing, and accounting systems meet the standards for financial reporting, accounting records, and internal control adequate to demonstrate that costs claimed have been incurred, appropriately accounted for, are allocable to the contract, and comply with the federal requirements as set forth in Title 23 United States Code (U.S.C.) Section 112(b)(2); 48 CFR Part 31.201-2(d); 23 CFR, Chapter 1, Part 172.11(a)(2); and all applicable state and federal rules and regulations.

Our financial management system has the following attributes:
• Account numbers identifying allowable direct, indirect, and unallowable cost accounts; • Ability to accumulate and segregate allowable direct, indirect, and unallowable costs into separate cost accounts;
1 112
Certification of Indirect Costs and Financial Management System - Independent Office of Audits and Investigations - Revised 9/2022 • Ability to accumulate and segregate allowable direct costs by project, contract and type of cost; • Internal controls to maintain integrity of financial management system; • Ability to account and record costs consistently and to ensure costs billed are in compliance with FAR; • Ability to ensure and demonstrate costs billed reconcile to general ledgers and job costing system; and • Ability to ensure costs are in compliance with contract terms and federal and state requirements.

Cost Reimbursements on Contracts:

I also understand that failure to comply with 48 CFR Part 16.301-3 or knowingly charge unallowable costs to Federal-Aid Highway Program (FAHP) contracts may result in possible penalties and sanctions as provided by the following:
• Sanctions and Penalties - 23 CFR Part 172.11(c)(4)
• False Claims Act - Title 31 U.S.C. Sections 3729-3733 • Statements or entries generally - Title 18 U.S.C. Section 1001 • Major Fraud Act - Title 18 U.S.C. Section 1031
All A&E Contract Information:
• Total participation amount ___________________ on all State and FAHP contracts for Architectural & Engineering services that the consultant received in the last three fiscal periods. • The number of states in which the consultant does business is • Years of consultant’s experience with 48 CFR Part 31 is • Identify the type of audits listed below that the consultant has had performed (if applicable):

Cognizant ICR Audit Local Govt ICR Audit
Caltrans ICR Audit
CPA ICR Audit Federal Govt ICR Audit
I, the undersigned, certify all of the above to the best of my knowledge and belief and that I have reviewed the ICR Schedule to determine that any costs which are expressly unallowable under the Federal cost principles have been removed and comply with Title 23 U.S.C. Section 112(b)(2), 48 CFR Part 31, 23 CFR Part 172, and all applicable state and federal rules and regulations. I also certify that I understand that all documentation of compliance must be retained by the consultant. I hereby acknowledge that costs that are noncompliant with the federal and state requirements are not eligible for reimbursement and must be returned to Caltrans.

Name:** Title**:

Signature: Date:

Phone**: Email**:
**An individual executive or financial officer of the consultant’s or subconsultant’s organization at a level no lower than a Vice President, a Chief Financial Officer, or equivalent, who has authority to represent the financial information used to establish the indirect cost rate.

Note: Both prime and subconsultants as parties of a contract must complete their own forms. Caltrans will not process local agency’s invoices until a complete form is accepted and approved by the Independent Office of Audits and Investigations.
2 113
Cost Proposal 1
Fee Itemization for Geotechnical Report Cost Plus Fixed Fee or Lump Sum Prime Consultant Subconsultant 2nd Tier Subconsultant
Consultant: Blackburn Consulting
Project No. Contract No. Date 11/19/2024
Range Hours Actual Hourly
Rate Total
$97 - $125 $ 106.30 $ -
$86 - $110 11 $ 101.40 $ 1,115.40
$55 - $85 $ 67.08 $ -
$55 - $85 $ 70.35 $ -
$55 - $85 29 $ 56.19 $ 1,629.51
$55 - $85 $ 61.66 $ -
$50 - $63 $ 54.65 $ -
$50 - $63 $ 60.63 $ -
$50 - $63 $ 54.48 $ -
$50 - $54 $ 54.00 $ -
$30 - $49 $ 27.00 $ -
$30 - $49 $ 29.98 $ -
$30 - $49 38 $ 31.27 $ 1,188.26
$30 - $49 38 $ 47.13 $ 1,790.94
$60 - $70 6 $ 73.10 $ 438.60
$45 - $73.5 $ 70.70 $ -
$31 - $42 12 $ 38.18 $ 458.16
$20 - $25 3 $ 23.74 $ 71.22
$38 - $41 1 $ 41.00 $ 41.00
LABOR COSTS 138
$ 6,733.09
$ -
c) TOTAL DIRECT LABOR COSTS [(a) + (b)] $ 6,733.09

INDIRECT COSTS
) e) Total Fringe Benefits [(c) x (d)] $ -
286.60% ) g) Overhead [(c) x (f)] $ 19,297.04
) i) Gen & Admin [(c) x (h)] $ -
j) TOTAL INDIRECT COSTS [(e) + (g) + (i)] $ 19,297.04
FIXED FEE k) TOTAL FIXED FEE [(c) + (j)] x fixed fee: 10% $ 2,603.01 l) CONSULTANT'S OTHER DIRECT COSTS (ODC) - ITEMIZE (Add additional pages if necessary) Quantity Unit Unit Cost Total
16 mile @ IRS rate $ 10.72
1 sum $1,835 $ 1,835.00
1 day $ 348.00 $ 348.00
$ - $ -
l) TOTAL OTHER DIRECT COSTS $ 2,193.72
m) SUBCONSULTANTS' COSTS (Add additional pages if necessary) m) TOTAL SUBCONSULTANTS' COSTS $ -
n) TOTAL OTHER DIRECT COSTS INCLUDING SUBCONSULTANTS [(l) + (m)] $ 2,193.72 TOTAL COST [(c) + (j) + (k) + (n)] $ 30,826.86
NOTES:

1. 2.

3. Note: Mark-ups are Not Allowed
RFP 24-064-RFP

DIRECT LABOR
Classification/Title Name
Sr. Engineer To be determined
Project Manager Daniel Contreras
Project Manager Robert Sandquist
Senior Geologist Brian Carey
Sr. Project Manager Ken Johnson
Project Engineer Luke Morrell
Sr. Principal Robert Lokteff
Principal Haze Rodgers
Assistant Natalie Mutto
Sr. Project Manager David Morrell
Project Engineer Alex Garcia
Project Engineer Dennis Magana
Project Engineer Joshua Budean
Sr. Project Manager Robert Pickard
Sr. Project Manager Laura Long
Administrative To be determined
PW Tester/Inspector Grp 3 To be determined
Project Engineer - OT To be determined
Drafter Ryan Hiett
a) Subtotal Direct Labor Costs
b) Anticipated Salary Increases (see page 2 for calculation) d) Fringe Benefits (Rate:
f) Overhead & G&A (Rate:
h) General & Admin (Rate:

Description of Item
Subconsultant 1:

Subconsultant 2:

Subconsultant 3:

Mileage
Laboratory Analysis
Hand Sampling Equipment
Subconsultant 4:

Key personnel must be marked with an asterisk (*) and employees that are subject to prevailing wage requirements must be marked with two asterisks (**). All costs must comply with the Federal cost principles. Subconsultants will provide their own cost proposals.

The cost proposal format shall not be amended. Indirect cost rates shall be updated on an annual basis in accordance with the consultant's annual accounting period and established by a cognizant agency or accepted by Caltrans.

Anticipated salary increases calculation (page 2) must accompany. 114
Consultant
Project No. Contract No. Date 11/19/2024

1. Calculate Average Hourly Rate for 1st year of the contract (Direct Labor Subtotal divided by total hours) Avg Hourly 5 Year Contract
Rate Duration
$ 6,733.09 = $ 48.79 Year 1 Avg Hourly Rate
Avg Hourly Rate
Year 1 $ 48.79 + = $ 50.74 Year 2 Avg Hourly Rate
Year 2 $ 50.74 + = $ 52.77 Year 3 Avg Hourly Rate
Year 3 $ 52.77 + = $ 54.88 Year 4 Avg Hourly Rate
Year 4 $ 54.88 + = $ 57.08 Year 5 Avg Hourly Rate
Total Hours
per Year
Year 1 90.00% * = 124.2 Estimated Hours Year 1
Year 2 10.00% * = 13.8 Estimated Hours Year 2
Year 3 0.00% * = 0.0 Estimated Hours Year 3
Year 4 0.00% * = 0.0 Estimated Hours Year 4
Year 5 0.00% * = 0.0 Estimated Hours Year 5
Total 100% = 138.0
Year 1 $ 48.79 * = $ 6,059.78 Estimated Hours Year 1
Year 2 $ 50.74 * = $ 700.24 Estimated Hours Year 2
Year 3 $ 52.77 * = $ - Estimated Hours Year 3
Year 4 $ 54.88 * = $ - Estimated Hours Year 4
Year 5 $ 57.08 * = $ - Estimated Hours Year 5
= $ 6,760.02
= $ 6,733.09
= $ 26.93 Transfer to Page 1
NOTES:

1. 2.

3. 4.

RFP 24-064-RFP 0
Direct Labor Subtotal Total Hours
per Cost Proposal per Cost Proposal

CALCULATIONS FOR ANTICIPATED SALARY INCREASES
Blackburn Consulting
4%
4%
4%

3. Calculate estimated hours per year (Multiply estimate % each year by total hours) 138

2. Calculate hourly rate for all years (Increase the Average Hourly Rate for a year by proposed escalation %) Proposed Escalation
4%
138.0
138.0
138.0
Total

4. Calculate Total Costs including Escalation (Multiply Average Hourly Rate by the number of hours) Estimated % Total Hours
Completed Each Year per Cost Proposal
138.0
138.0
124
14 0
0 0
Total Direct Labor Cost with Escalation
Avg Hourly Rate Estimated hours Cost per Year (calculated above) (calculated above) Direct Labor Subtotal before Escalation
Estimated total of Direct Labor Salary Increase
This is not the only way to estimate salary increases. Other methods will be accepted if they clearly indicate the % increase, the # of years of the contract, and a breakdown of the labor to be performed each year.

An estimation that is based on direct labor multiplied by salary increase % multiplied by the # of years is not acceptable. (i.e. $250,000 x 2% x 5 yrs = $25,000 is not an acceptable methodology).

This assumes that one year will be worked at the rate on the cost proposal before salary increases are granted.

Calculations for anticipated salary escalation must be provided. 115
I, the undersigned, certify to the best of my knowledge and belief that all direct costs identified on the cost proposal(s) in this contract are actual, reasonable, allowable, and allocable to the contract in accordance with the contract terms and the following requirements:

1. Generally Accepted Accounting Principles (GAAP)

2. Terms and conditions of the contract

3. Title 23 United States Code Section 112 - Letting of Contracts

4. 48 Code of Federal Regulations Part 31 - Contract Cost Principles and Proceedures

5. 23 Code of Federal Regulations Part 172 - Procurement, Management and Administration of Engineering and Design Related Service

6. 48 Code of Federal Regulations Part 9904 - Cost Accounting Standards Board (when applicable) All costs must be applied consistently and fairly to all contracts. All documentation of compliance must be retained in the project files and be in compliance with applicable federal and state requirements. Costs that are noncompliant with the federal and state requirements are not eligible for reimbursement. Local governments are responsible for applying only cognizant agency or Caltrans accepted Indirect Cost Rate(s).

Name: Wendy Supinger Title *: Principal
Signature: Date of Certification: 11/19/2024
Email: [email protected] Phone number: 530-887-1494 Address: Blackburn Consulting, 11521 Blocker Dr., Ste. 110, Auburn, CA 95603 List services the consultant is providing under the proposed contract:

Certification of Direct Costs:

Prime Consultant or Subconsultant Certifying:
* An individual executive or financial officer of the consultant's or subconsultant's organization at a level no lower than a Vice President or a Chief Financial Officer, or equivalent, who has authority to represent the financial information utilized to establish the cost proposal for the contract.

Providing Geotechnical Services for the City of West Sacramento North 5th Street Complete Streets and Connectivity Project. RFP: 24-064-RFP 116
Cost Proposal 1
Fee Itemization for Phase 1 ESA Cost Plus Fixed Fee or Lump Sum Prime Consultant Subconsultant 2nd Tier Subconsultant
Consultant: Blackburn Consulting
Project No. Contract No. Date 11/19/2024
Range Hours Actual Hourly
Rate Total
$97 - $125 $ 106.30 $ -
$86 - $110 1 $ 101.40 $ 101.40
$55 - $85 $ 67.08 $ -
$55 - $85 $ 70.35 $ -
$55 - $85 $ 56.19 $ -
$55 - $85 7 $ 61.66 $ 431.62
$50 - $63 $ 54.65 $ -
$50 - $63 $ 60.63 $ -
$50 - $63 32 $ 54.48 $ 1,743.36
$50 - $54 $ 54.00 $ -
$30 - $49 $ 27.00 $ -
$30 - $49 $ 29.98 $ -
$30 - $49 $ 31.27 $ -
$30 - $49 8 $ 47.13 $ 377.04
$60 - $70 $ 73.10 $ -
$45 - $73.5 $ 70.70 $ -
$31 - $42 4 $ 38.18 $ 152.72
$20 - $25 2 $ 23.74 $ 47.48
$38 - $41 1 $ 41.00 $ 41.00
LABOR COSTS 55
$ 2,894.62
$ -
c) TOTAL DIRECT LABOR COSTS [(a) + (b)] $ 2,894.62

INDIRECT COSTS
) e) Total Fringe Benefits [(c) x (d)] $ -
286.60% ) g) Overhead [(c) x (f)] $ 8,295.98
) i) Gen & Admin [(c) x (h)] $ -
j) TOTAL INDIRECT COSTS [(e) + (g) + (i)] $ 8,295.98
FIXED FEE k) TOTAL FIXED FEE [(c) + (j)] x fixed fee: 10% $ 1,119.06 l) CONSULTANT'S OTHER DIRECT COSTS (ODC) - ITEMIZE (Add additional pages if necessary) Quantity Unit Unit Cost Total
16 mile @ IRS rate $ 10.72
1 each $996 $ 996.00
$ - $ -
$ - $ -
l) TOTAL OTHER DIRECT COSTS $ 1,006.72
m) SUBCONSULTANTS' COSTS (Add additional pages if necessary) m) TOTAL SUBCONSULTANTS' COSTS $ -
n) TOTAL OTHER DIRECT COSTS INCLUDING SUBCONSULTANTS [(l) + (m)] $ 1,006.72 TOTAL COST [(c) + (j) + (k) + (n)] $ 13,316.38
NOTES:

1. 2.

3. Sr. Principal Robert Lokteff
Principal Haze Rodgers
Sr. Project Manager Ken Johnson
Note: Mark-ups are Not Allowed
RFP 24-064-RFP

DIRECT LABOR
Classification/Title Name
Sr. Engineer To be determined
Project Engineer Joshua Budean
Project Manager Daniel Contreras
Senior Geologist Brian Carey
Sr. Project Manager David Morrell
Sr. Project Manager Robert Pickard
Project Manager Robert Sandquist
PW Tester/Inspector Grp 3 To be determined
Project Engineer - OT To be determined
Drafter Ryan Hiett
Project Engineer Dennis Magana
Project Engineer Alex Garcia
Project Engineer Luke Morrell
Assistant Natalie Mutto
Administrative To be determined
Mileage
Records Search
a) Subtotal Direct Labor Costs
b) Anticipated Salary Increases (see page 2 for calculation) d) Fringe Benefits (Rate:
f) Overhead & G&A (Rate:
h) General & Admin (Rate:

Description of Item
Subconsultant 1:

Subconsultant 2:

Subconsultant 3:

Subconsultant 4:

Key personnel must be marked with an asterisk (*) and employees that are subject to prevailing wage requirements must be marked with two asterisks (**). All costs must comply with the Federal cost principles. Subconsultants will provide their own cost proposals.

The cost proposal format shall not be amended. Indirect cost rates shall be updated on an annual basis in accordance with the consultant's annual accounting period and established by a cognizant agency or accepted by Caltrans.

Anticipated salary increases calculation (page 2) must accompany.

Sr. Project Manager Laura Long
117
Consultant
Project No. Contract No. Date 11/19/2024

1. Calculate Average Hourly Rate for 1st year of the contract (Direct Labor Subtotal divided by total hours) Avg Hourly 5 Year Contract
Rate Duration
$ 2,894.62 = $ 52.63 Year 1 Avg Hourly Rate
Avg Hourly Rate
Year 1 $ 52.63 + = $ 54.73 Year 2 Avg Hourly Rate
Year 2 $ 54.73 + = $ 56.92 Year 3 Avg Hourly Rate
Year 3 $ 56.92 + = $ 59.20 Year 4 Avg Hourly Rate
Year 4 $ 59.20 + = $ 61.57 Year 5 Avg Hourly Rate
Total Hours
per Year
Year 1 100.00% * = 55.0 Estimated Hours Year 1
Year 2 0.00% * = 0.0 Estimated Hours Year 2
Year 3 0.00% * = 0.0 Estimated Hours Year 3
Year 4 0.00% * = 0.0 Estimated Hours Year 4
Year 5 0.00% * = 0.0 Estimated Hours Year 5
Total 100% = 55.0
Year 1 $ 52.63 * = $ 2,894.62 Estimated Hours Year 1
Year 2 $ 54.73 * = $ - Estimated Hours Year 2
Year 3 $ 56.92 * = $ - Estimated Hours Year 3
Year 4 $ 59.20 * = $ - Estimated Hours Year 4
Year 5 $ 61.57 * = $ - Estimated Hours Year 5
= $ 2,894.62
= $ 2,894.62
= $ - Transfer to Page 1
NOTES:

1. 2.

3. 4.

RFP 24-064-RFP 0
Direct Labor Subtotal Total Hours
per Cost Proposal per Cost Proposal

CALCULATIONS FOR ANTICIPATED SALARY INCREASES
Blackburn Consulting
4%
4%
4%

3. Calculate estimated hours per year (Multiply estimate % each year by total hours) 55 2. Calculate hourly rate for all years (Increase the Average Hourly Rate for a year by proposed escalation %) Proposed Escalation
4%

55.0 55.0

55.0 Total

4. Calculate Total Costs including Escalation (Multiply Average Hourly Rate by the number of hours) Estimated % Total Hours
Completed Each Year per Cost Proposal

55.0 55.0
Direct Labor Subtotal before Escalation
Estimated total of Direct Labor Salary Increase
This is not the only way to estimate salary increases. Other methods will be accepted if they clearly indicate the % increase, the # of years of the contract, and a breakdown of the labor to be performed each year.

An estimation that is based on direct labor multiplied by salary increase % multiplied by the # of years is not acceptable. (i.e. $250,000 x 2% x 5 yrs = $25,000 is not an acceptable methodology).

This assumes that one year will be worked at the rate on the cost proposal before salary increases are granted.

Calculations for anticipated salary escalation must be provided. 55 0
0 0
0 Total Direct Labor Cost with Escalation
Avg Hourly Rate Estimated hours Cost per Year (calculated above) (calculated above) 118
I, the undersigned, certify to the best of my knowledge and belief that all direct costs identified on the cost proposal(s) in this contract are actual, reasonable, allowable, and allocable to the contract in accordance with the contract terms and the following requirements:

1. Generally Accepted Accounting Principles (GAAP)

2. Terms and conditions of the contract

3. Title 23 United States Code Section 112 - Letting of Contracts

4. 48 Code of Federal Regulations Part 31 - Contract Cost Principles and Proceedures

5. 23 Code of Federal Regulations Part 172 - Procurement, Management and Administration of Engineering and Design Related Service

6. 48 Code of Federal Regulations Part 9904 - Cost Accounting Standards Board (when applicable) All costs must be applied consistently and fairly to all contracts. All documentation of compliance must be retained in the project files and be in compliance with applicable federal and state requirements. Costs that are noncompliant with the federal and state requirements are not eligible for reimbursement. Local governments are responsible for applying only cognizant agency or Caltrans accepted Indirect Cost Rate(s).

Name: Wendy Supinger Title *: Principal
Signature: Date of Certification: 11/19/2024
Email: [email protected] Phone number: 530-887-1494 Address: Blackburn Consulting, 11521 Blocker Dr., Ste. 110, Auburn, CA 95603 List services the consultant is providing under the proposed contract:

Certification of Direct Costs:

Prime Consultant or Subconsultant Certifying:
* An individual executive or financial officer of the consultant's or subconsultant's organization at a level no lower than a Vice President or a Chief Financial Officer, or equivalent, who has authority to represent the financial information utilized to establish the cost proposal for the contract.

Providing Geotechnical Services for the City of West Sacramento North 5th Street Complete Streets and Connectivity Project. RFP: 24-064-RFP 119
&HUWL¿FDWLRQRI,QGLUHFW&RVWVDQG)LQDQFLDO0DQDJHPHQW6\VWHP,QGHSHQGHQW2I¿FHRI$XGLWVDQG,QYHVWLJDWLRQV5HYLVHG 
Inspector General
California Department of Transportation
Certification of Indirect Costs and Financial Management System (Note: If a Safe Harbor Indirect Cost Rate is approved, this form is not required) Consultant’s Full Legal Name:

Important: Consultant means the individual or consultant providing engineering and design related services as a party of a contract with a recipient or sub-recipient of Federal assistance. Therefore, the Indirect Cost Rate(s) shall not be combined with its parent company or subsidiaries.

Indirect Cost Rate (ICR):

Combined Rate: Or
+RPH2ႈFH5DWH
DQG)LHOG2ႈFH5DWH
LIDSSOLFDEOH

Facilities Capital Cost of Money (if applicable):

Fiscal Period:*
* Fiscal period is annual one year applicable accounting period that the ICR was developed (not the contract period). The ICR is based on the FRQVXOWDQW¶VRQH\HDUDSSOLFDEOHDFFRXQWLQJSHULRGIRUZKLFKILQDQFLDOVWDWHPHQWVDUHUHJXODUO\SUHSDUHGE\WKHFRQVXOWDQW ,KDYHUHYLHZHGWKHSURSRVDOWRHVWDEOLVKDQ,&5
V
IRUWKHILVFDOSHULRGDVVSHFLILHGDERYHDQGKDYHGHWHUPLQHG to the best of my knowledge and belief that:
• All costs included in the cost proposal to establish the ICR(s) are allowable in accordance with the cost principles of the Federal Acquisition Regulation (FAR) 48, Code of Federal Regulations (CFR), Chapter 1, Part 31 (48 CFR Part 31)
• The cost proposal does not include any costs which are expressly unallowable under the cost principles of 48 CFR Part 31
• The accounting treatment and billing of prevailing wage delta costs are consistent with our prevailing wage policy as either direct labor, indirect costs, or other direct costs on all federally-funded A&E Consultant Contracts.
• $OONQRZQPDWHULDOWUDQVDFWLRQVRUHYHQWVWKDWKDYHRFFXUUHGVXEVHTXHQWWR\HDUHQGDIIHFWLQJWKHFRQVXOWDQW¶V RZQHUVKLSRUJDQL]DWLRQDQGLQGLUHFWFRVWUDWHVKDYHEHHQGLVFORVHGDVRIWKHGDWHRIWKLVFHUWLILFDWLRQ I am providing the required and applicable documents as instructed on the Financial Document Review Request form.

Financial Management System:
2XUODERUFKDUJLQJMREFRVWLQJDQGDFFRXQWLQJV\VWHPVPHHWWKHVWDQGDUGVIRU¿QDQFLDOUHSRUWLQJDFFRXQWLQJ records, and internal control adequate to demonstrate that costs claimed have been incurred, appropriately accounted for, are allocable to the contract, and comply with the federal requirements as set forth in Title 23 United States Code (U.S.C.) Section 112(b)(2); 48 CFR Part 31.201-2(d); 23 CFR, Chapter 1, Part 172.11(a)(2); and all applicable state and federal rules and regulations. 2XU¿QDQFLDOPDQDJHPHQWV\VWHPKDVWKHIROORZLQJDWWULEXWHV

• Account numbers identifying allowable direct, indirect, and unallowable cost accounts; • Ability to accumulate and segregate allowable direct, indirect, and unallowable costs into separate cost accounts;
1 Blackburn Consulting
286.60 148.42
01/01/2022-12/31/2022
120
&HUWL¿FDWLRQRI,QGLUHFW&RVWVDQG)LQDQFLDO0DQDJHPHQW6\VWHP,QGHSHQGHQW2I¿FHRI$XGLWVDQG,QYHVWLJDWLRQV5HYLVHG 
• Ability to accumulate and segregate allowable direct costs by project, contract and type of cost; • ,QWHUQDOFRQWUROVWRPDLQWDLQLQWHJULW\RIILQDQFLDOPDQDJHPHQWV\VWHP

• Ability to account and record costs consistently and to ensure costs billed are in compliance with FAR; • Ability to ensure and demonstrate costs billed reconcile to general ledgers and job costing system; and • Ability to ensure costs are in compliance with contract terms and federal and state requirementV Cost Reimbursements on Contracts:

I also understand that failure to comply with 48 CFR Part 16.301-3 or knowingly charge unallowable costs to Federal-Aid Highway Program (FAHP) contracts may result in possible penalties and sanctions as provided by the following:
• Sanctions and Penalties - 23 CFR Part 172.11(c)(4)
• False Claims Act - Title 31 U.S.C. Sections 3729-3733 • Statements or entries generally - Title 18 U.S.C. Section 1001 • Major Fraud Act - Title 18 U.S.C. Section 1031
All A&E Contract Information:
• Total participation amount ___________________ on all State and FAHP contracts for Architectural & (QJLQHHULQJVHUYLFHVWKDWWKHFRQVXOWDQWUHFHLYHGLQWKHODVWWKUHHILVFDOSHULRGV • The number of states in which the consultant does business is • Years of consultant’s experience with 48 CFR Part 31 is • ,GHQWLI\WKHW\SHRIDXGLWVOLVWHGEHORZWKDWWKHFRQVXOWDQWKDVKDGSHUIRUPHG LIDSSOLFDEOH

Cognizant ICR Audit Local Govt ICR Audit
Caltrans ICR Audit
CPA ICR Audit Federal Govt ICR Audit
I, the undersigned, certify all of the above to the best of my knowledge and belief and that I have reviewed the ICR Schedule to determine that any costs which are expressly unallowable under the Federal cost principles have been removed and comply with Title 23 U.S.C. Section 112(b)(2), 48 CFR Part 31, 23 CFR Part 172, and all applicable state and federal rules and regulations. I also certify that I understand that all documentation of compliance must be retained by the consultant. I hereby acknowledge that costs that are noncompliant with the federal and state requirements are not eligible for reimbursement and must be returned to Caltrans.

Name
** Title**:

Signature: Date:

Phone**: Email**:

$QLQGLYLGXDOH[HFXWLYHRU¿QDQFLDORႈFHURIWKHFRQVXOWDQW¶VRUVXEFRQVXOWDQW¶VRUJDQL]DWLRQDWDOHYHOQRORZHUWKDQD 9LFH3UHVLGHQWD&KLHI)LQDQFLDO2ႈFHURUHTXLYDOHQWZKRKDVDXWKRULW\WRUHSUHVHQWWKH¿QDQFLDOLQIRUPDWLRQXVHGWR establish the indirect cost rate.

Note: Both prime and subconsultants as parties of a contract must complete their own forms. Caltrans will not SURFHVVORFDODJHQF\¶VLQYRLFHVXQWLODFRPSOHWHIRUPLVDFFHSWHGDQGDSSURYHGE\WKH,QGHSHQGHQW2ႈFHRI Audits and Investigations.
2 10.90
1 16
Wendy Supinger
✔
✔
CFO
✔
(530) 887-1494 [email protected]
08/08/2024
121
Local Assistance Procedures Manual EXHIBIT 10-H1
Cost Proposal
Note: Mark-Ups are Not Allowed
Consultant: KMP STRATEGIES LLC
Project No. Contract No. Date
Project Name

DIRECT LABOR
Classification/Title Name Hours Actual Hr Rate Total
Partner Sarah Modeste 0 $ 74.52 $ -
Partner Noah Painter 100 $ 62.50 $ 6,250.00
Senior Project Manager KMP Staff 45 $ 60.00 $ 2,700.00
Project Manager KMP Staff 25 $ 55.00 $ 1,375.00
Project Coordinator KMP Staff 0 $ 40.00 $ -
Project Assistant KMP Staff 45 $ 30.00 $ 1,350.00
215

LABOR COSTS
a) Subtotal Direct Labor Costs $ 11,675.00
b) Anticipated Salary Increases $175.13
c) TOTAL DIRECT LABOR COSTS [(a) + (b)] $ 11,850.13

INDIRECT COSTS
d) Fringe Benefits (Rate: 22.19% ) c) Total Fringe Benefits [(c) x (d)] 2,629.54 $ f) Overhead (Rate: 238.12% ) g) Overhead [(c) x (f)] 28,217.52 $ h) General and Administrative (Rate: 0.00% ) Gen & Admin [(c) x (h)] $ - j) TOTAL INDIRECT COSTS [(e) + (g) + (i)] $ 30,847.06
FIXED FEE k) TOTAL FIXED FEE [(c) + (j)] x fixed fee 10% ] $ 4,269.72 l) CONSULTANT’S OTHER DIRECT COSTS (ODC) – ITEMIZE (Add additional pages if necessary) Unit Cost Total
Public Outreach Needs (i.e., Graphic design, printing, postage, domain, digital ads,etc.) $ 6,000.00 i) TOTAL OTHER DIRECT COSTS $ 6,000.00
m) SUBCONSULTANTS' COSTS (Add additional pages if necessary) m) TOTAL SUBCONSULTANTS' COSTS $ -
n) TOTAL OTHER DIRECT COSTS INCLUDING SUBCONSULTANTS [(l) + (m)] $ 6,000.00 TOTAL COST [(c) + (j) + (k) + (n)] $ 52,966.90
NOTES:

3. Anticipated salary increases calculation (page 2) must accompany.

1. Key personnel must be marked with an asterisk (*) and employees that are subject to prevailing wage requirements must be marked with two asterisks (**). All costs must comply with the Federal cost principles. Subconsultants will provide their own cost proposals.

2. The cost proposal format shall not be amended. Indirect cost rates shall be updated on an annual basis in accordance with the consultant’s annual accounting period and established by a cognizant agency or accepted by Caltrans.

Description of Item
EXHIBIT 10-H1 COST PROPOSAL Page 1 of 3

ACTUAL COST-PLUS-FIXED FEE OR LUMP SUM (FIRM FIXED PRICE) CONTRACTS (DESIGN, ENGINEERING AND ENVIRONMENTAL STUDIES)
November 25, 2024
North 5th Street Complete Streets
Prime Consultant Subconsultant 2nd Tier Subconsultant