Brentwood City Council
May 24, 2022

MAY 24, 2022

CITY COUNCIL/SUCCESSOR AGENCYBIFA AGENDA
*IMPORTANT NOTICE ABOUT PUBLIC COMMENTS AND MEETING PARTICIPATION* UPDATED APRIL 21, 2022
Consistent with Contra Costa County Health orders, and in accordance with California Government Code Section 54953(e) concerning teleconference meetings, this City Council meeting will be held exclusively via teleconference, using the Zoom video conferencing system. At this time, public participation will be available exclusively via telephone or teleconference, using the Zoom video conferencing system.

How to View and Participate
The public is invited to participate in the City Council meeting and offer comments of up to 3 minutes (or as may otherwise be determined by the Council) using any of the following methods:

1. Zoom: www.brentwoodca.gov/vcc or Zoom Webinar ID: 760 1397 0037 Phone Numbers:

Dial(for higher quality, dial a number based on your current location):

US: +1 720 707 2699 or +1 253 215 8782 or +1 346 248 7799 or +1 646 558 8656 or +1 301 715 8592 or +1 312 626 6799 or 888 788 0099 (Toll Free) or 833 548 0276 (Toll Free) or 833 548 0282 (Toll Free) or 877 853 5247 (Toll Free)
As the City Council Chamber will not be open to the public, individuals may view and participate in the meeting with this link. During the meeting, each period for public comment will be announced, and participants may use the “Raise Hand” feature on Zoom to request to speak. The meeting host will call on you, by name, and enable your microphone when it is your turn to speak.

In order to ensure the orderly administration of the meeting using this method, providing your name is encouraged, but is not required. (If you need instructions on how to use this feature, please contact the City Clerk by noon of the meeting date at [email protected] or 925.516.5182.)
The public may view the meeting via one-way video feed by selecting the video option at the City Council Agendas’ link on the City webpage at www.brentwoodca.gov

2. Telephone
If you wish to comment during the meeting via telephone, you may “raise your hand” virtually on most devices by pressing *3, and you will be called upon when it is your time to speak. After speaking, please press *3 again to remove the “raise your hand” feature. If that feature does not work on your device, please email [email protected] in advance of the meeting where possible. The request must contain in the subject line “Request to Speak – Agenda Item #” and should include name and full phone number that will be used to call in. In order to ensure the orderly administration of the meeting using this method, providing your name is encouraged, but is not required.

3. E-mail
Public comments can also be submitted via e-mail to [email protected]. Any public comments received up until 3:00 p.m. of the meeting date will be:
 distributed to the Council via email before the meeting,  posted online for public inspection at https://www.brentwoodca.gov/councilmeetingonline, and
 later summarized in the meeting minutes.

MAY 24, 2022

CITY COUNCIL/SUCCESSOR AGENCY/BIFA AGENDA
PAGE 2 OF 6
Public comments received after 3:00 p.m. of the meeting date, but prior to the start of the meeting, will be emailed to the City Council, posted online within one day following the meeting, and will be summarized in the meeting minutes. The City cannot guarantee that its network, website, and/or the Zoom system will be uninterrupted. In the event of an interruption to the broadcasting of the meeting using the telephone or internet-based options listed above, the City Council will take no further action on items on the agenda until public access to the meeting via either option is restored. To ensure that the City Council receives your comments prior to taking action, you are strongly encouraged to submit them in advance of the meeting by 3:00 p.m.

As e-mails containing public meeting comments are part of the official record, note that personal contact information may be published if it is included with your e-mail.

The Closed Captioning provided via Zoom is auto generated. It is not the official record and is provided as a convenience
Pursuant to Section 54956 of the California Government Code, a special meeting of the City Council is hereby called for May 24, 2022 at 5:45 p.m. or as soon thereafter as possible.

CALL TO ORDER & ROLL CALL
PUBLIC COMMENTS At this time the public is permitted to address the City Council on items that are on the Closed Session portion of the agenda. Unless otherwise stated by the Mayor, persons addressing the City Council are required to limit their remarks to three (3) minutes. Please use the Raise Your Hand feature in Zoom. Those with questions should direct them to the Council and, if relevant, the Council may direct them to the appropriate staff member.

RECESS TO CLOSED SESSION
A. PUBLIC EMPLOYEE PERFORMANCE EVALUATION
[Gov’t. Code §54957]
Title: City Manager
B. CONFERENCE WITH LABOR NEGOTIATORS
[Gov’t. Code § 54957.6]
City Designated Representatives: Mayor Joel Bryant
Vice Mayor Johnny Rodriguez
Tim Davis, Esq.

Unrepresented Employee: City Manager

ADJOURN CITY COUNCIL
MAY 24, 2022

CITY COUNCIL/SUCCESSOR AGENCY/BIFA AGENDA
PAGE 3 OF 6
7:00 PM – CITY COUNCIL/SUCCESSOR AGENCY MEETING

CALL TO ORDER & ROLL CALL

PLEDGE OF ALLEGIANCE

REPORT ON CLOSED SESSION

PUBLIC COMMENTS
The public is permitted to speak on items that are listed under Presentations; Informational Reports from Council Members, Committee, Liaisons, and Staff; on the Consent Calendar; Requests for Future Agenda Items, new items; or items not on the agenda. Public comments for scheduled agenda items should wait until that time.

Persons are required to limit their remarks to three (3) minutes unless an extension of time is granted by the Mayor subject to approval of the City Council/Successor Agency/BIFA. Please use the Raise Your Hand feature in Zoom during this item to speak under Public Comments. Speakers desiring answers to questions should direct them to the City Council/Successor Agency/BIFA Board and, if relevant, the City Council/Successor Agency/BIFA Board may direct them to the appropriate staff member.

A. PRESENTATIONS
A.1 Recognition of the City of Brentwood 2021/22 Redistricting Commission.

B. INFORMATIONAL REPORTS FROM COUNCIL MEMBERS, COMMITTEES,

LIAISONS AND STAFF
This portion of the agenda is to provide an opportunity for Council Members to report on attendance at events, subcommittee meetings, and entities on which the Council Member has been appointed as a liaison.

At the direction of the City Manager, he may share or invite other staff to provide brief updates and/or information to the City Council.

C. CONSENT CALENDAR
All matters listed on the consent calendar are considered routine in nature and will be enacted by one motion. If discussion is required, that particular item will be removed from the consent calendar and will be considered separately.

C.1. Proclamation Proclaiming June 2022 as Pride Month.

C.2 Proclamation Proclaiming June 2022 as Safety Month.

C.3. A resolution adopting the 2022/23 Proposition 4 Appropriations Limit using the change in State per capita income of 7.55% as the cost-of-living factor and the change in the City population factor of 0.18% to calculate the Limit. (Kerry Breen/Clarissa Domen/Sonia Agostini)
MAY 24, 2022

CITY COUNCIL/SUCCESSOR AGENCY/BIFA AGENDA
PAGE 4 OF 6
C.4. A Resolution approving and authorizing the City Manager or designee to execute Agreements for Professional Services with On-Call Civil/Structural Design Services, Geotechnical/Construction Materials Testing Services, and Survey and Related Services in a not-to-exceed amount of $100,000 per agreement for fiscal year 2022/23; and approving and authorizing the City Manager or designee to execute up to two additional one-year extensions for these agreements in a not-to-exceed amount of $100,000 per agreement, per fiscal year. (Miki Tsubota/Renee Payette/Jigar Shah) C.5. A Resolution approving a fee waiver in the amount of $64,166 for fiscal year 2022/23 and $63,920 for fiscal year 2023/24 for the use of City facilities for the operation of the County Senior Nutrition Program (Café Costa) (Bruce Mulder/Kris Farro) C.6. Consideration of an Arts Commission recommendation to appoint Gianna Baldazo as the City of Brentwood’s Poet Laureate for a two year term beginning on June 1, 2022. (Bruce Mulder/Kris Farro)
C.7. A Resolution approving and authorizing the City Manager or designee to execute a Memorandum of Understanding between the City of Brentwood and the Brentwood Senior Citizens Club, Inc. for running a wide variety of programs, activities, and services at City facilities and approving a fee waiver for fiscal years 2022/23 - 2024/25 not to exceed $98,311.13 per fiscal year. (Bruce Mulder/Kris Farro) C.8. Consideration of actions pertaining to the City’s Landscape and Lighting Assessment Districts, Landscape and Lighting Assessment District No. 19-3, Landscape and Lighting Assessment District No. 21-1, and the Citywide Park Maintenance District No. 98-1 for Fiscal Year 2022/23 (Bruce Mulder/Aaron Wanden)
C.9. Consider appointment of new Commissioners to the City of Brentwood Youth Commission (Bruce Mulder/Kris Farro)
C.10. A Resolution amending City Council/Administrative Policy 110-04 Procedures for Ceremonial Documents related to the process for Proclamations (Tim Ogden/Margaret Wimberly)
C.11. Resolutions approving the continued use of teleconferencing for meetings of (1) the City Council and all subsidiary City legislative bodies, (2) the Successor Agency to the Brentwood Redevelopment Agency, and (3) the Brentwood Infrastructure Financing Authority, from May 24, 2022 through June 23, 2022, per AB 361 (2021) (Tim Ogden/Margaret Wimberly)
C.12. A Resolution recognizing the completion of service by the 2021/22 Redistricting Commission (Tim Ogden/Margaret Wimberly/Damien Brower)
C.13. A Resolution approving the contract documents, awarding the bid and authorizing the City Manager or designee to execute a construction contract and necessary documents for the Pavement Management Program 2022 (Grind & Overlay), CIP Project No. 336- 31699, with McGuire and Hester as the lowest responsible and responsive bidder, in the amount of $1,253,201.00, plus a 20% contingency of $250,640.20, for a total possible not-to-exceed contract amount of $1,503,841.20. (Miki Tsubota/Renee Payette/Aman Grewal)
MAY 24, 2022

CITY COUNCIL/SUCCESSOR AGENCY/BIFA AGENDA
PAGE 5 OF 6
D. PUBLIC HEARINGS
Persons addressing the City Council/Successor Agency are asked to raise their hand using the Zoom feature. The Council may adopt reasonable regulations at the onset of the public hearing to facilitate public testimony. These regulations may include time limits. In the absence of such regulations, the public hearing shall follow the protocol for Public Comments.

D.1. Call for Review of the Planning Commission's decision to approve a Conditional Use Permit amendment (CUP 08-31-A4) and Design Review (DR 21-009) application for the operation of Vineyard Academy Christian School, and the construction of a 3,260 square foot modular building for additional classrooms at The Rock Church, located at 1770 Adams Lane (APNs 016-040-009, 016-040-010, and 016-040-011). (Alexis Morris/Crystal De Castro)
D.2. An Urgency Ordinance Extending, for an Additional Period of 10 Months and 15 Days, a Moratorium on New Oil and Gas Development in the City of Brentwood (Tim Ogden/Damien Brower/Alexis Morris)
D.3. A resolution adopting the 2022/23 – 2026/27 Capital Improvement Program (CIP) including roadway, parks and trails, water, wastewater and community facilities improvements to be constructed during the next five years; and approving a long-term interfund loan in the amount of $2,016,661, per Council/Administrative Policy 10-5, Budget and Fiscal Policies, Section 4.3, to provide capital funding for the portion of the Sand Creek Sports Complex project costs that will be repaid with Bond Refinance Savings. (Kerry Breen/Sonia Agostini)
D.4. Second reading of Ordinance No. 1038 of the City Council of the City of Brentwood amending Title 15 (Buildings and Construction) Chapter 15.06 of the Brentwood Municipal Code to adopt by reference the 2019 Edition of the California Fire Code, California Code of Regulations, Title 24, Part 9, as amended by Contra Costa Fire Protection District Ordinance 2019-37, including Findings in Support Amendments to the 2019 California Building Standards Code, Title 24, Part 9, California Fire Code, and Setting a Public Hearing for May 24, 2022. (Alexis Morris) E. BUSINESS ITEMS
E.1 Direction to staff regarding the construction of duets, duplexes, triplexes or fourplexes for affordable units as an option for developers to meet the City’s affordable housing requirement, and include the City Council direction in the draft affordable housing ordinance (Alexis Morris/Sylvia Elias)
E.2. An update related to a Council-sponsored ballot initiative to protect open space, and recreational areas, as well as provide staff with recommendations and directions regarding a ballot initiative (Tim Ogden/Darin Gale)
MAY 24, 2022

CITY COUNCIL/SUCCESSOR AGENCY/BIFA AGENDA
PAGE 6 OF 6
F. REQUEST FOR FUTURE AGENDA ITEMS
F.1. NEW REQUEST(S)
Council Members wishing to have an agenda item placed on a future agenda shall make a request under this section of the agenda. These items will be included on the agenda for the next Council meeting.

F.2. REQUESTED ITEMS
F.2.1. Future agenda item request from Council Member Mendoza for City Council discussion of, and possible direction to staff, related to an update of zoning regulations to limit or prohibit sales of tobacco. (Tim Ogden/Margaret Wimberly) F.2.2. Future agenda item requests from Council Member Mendoza for City Council discussion of, and possible direction to staff, related to Planning Commission training on their roles and responsibilities; as well as issues and consequences of Commissioner communications.. (Tim Ogden/Margaret Wimberly)

ADJOURNMENT
Any disclosable public records related to an agenda item for the open session of this meeting distributed to all or a majority of the City Council less than 72 hours before this meeting is available for inspection on the City’s website.

If you challenge any of the matters listed under 'Public Hearings' in court, you may be limited to raising only those issues you or someone else raised at the public hearing described in this notice, or in written correspondence delivered to the Brentwood City Council at, or prior to, the public hearing.

NOTICE
In compliance with the Americans with Disabilities Act, when meeting in-person, the meeting room is wheelchair accessible and disabled parking is available at the City Hall parking lot. If you are a person with a disability and you need disability-related modifications or accommodations to participate in this meeting, please contact the City Clerk's Office at (925) 516-5440 or fax (925) 516-5441. Notification 48 hours prior to the meeting will enable the City to make reasonable arrangements to ensure accessibility to this meeting. {28 CFR 35.102-35, 104 ADA Title II}

POSTING STATEMENT
On May 20, 2022, a true and correct copy of this agenda was posted on the City Hall Bulletin Board, outside City Hall, 150 City Park Way, Brentwood, CA 94513 and at our website www.brentwoodca.gov A complete packet of information is available for public review at City Hall or on our website at www.brentwoodca.gov
Packet Pg. 7
Communication: A. PUBLIC EMPLOYEE PERFORMANCE EVALUATION Packet Pg. 8
Communication: B. CONFERENCE WITH LABOR NEGOTIATORS
C.1
Packet Pg. 9
Communication: Proclamation Proclaiming June 2022 as Pride Month. (CONSENT CALENDAR) C.2
Packet Pg. 10
Communication: Proclamation Proclaiming June 2022 as Safety Month. (CONSENT CALENDAR) CITY COUNCIL AGENDA ITEM NO. 3
Meeting Date: May 24, 2022
Subject/Title: A resolution adopting the 2022/23 Proposition 4 Appropriations Limit using the change in State per capita income of 7.55% as the cost-of-living factor and the change in the City population factor of 0.18% to calculate the Limit.

Prepared by: Clarissa Domen, Accountant II
Sonia Agostini, Accounting Manager
Submitted by: Kerry Breen, Director of Finance and Information Systems

PURPOSE AND RECOMMENDATION
Annually, government agencies are required to calculate their Appropriations Limit per State Proposition 4. Staff recommends approving a resolution adopting the 2022/23 Proposition 4 Appropriations Limit using the change in State per capita income factor of 7.55% as the cost-ofliving factor and the change in the City population factor of 0.18% to calculate the Limit.

PREVIOUS ACTION
On May 25, 2021 the City Council approved Resolution No. 2021-51 adopting the 2021/22 Proposition 4 Appropriations Limit.

BACKGROUND
Article XIIIB of the California State Constitution, more commonly referred to as the Gann Initiative, was approved via Proposition 4 by California voters on November 6, 1979. The goal of the Gann Limit (“Limit”) was to slow the expenditure growth of governments in California.

Under the Limit, a maximum bound was established for the amount of proceeds of taxes that state and local governmental agencies can appropriate each fiscal year. That bound was to be adjusted each year depending on changes in population and inflation. The Limit does not apply to enterprise funds or bond issues. The City is legally required to adopt a Limit prior to each fiscal year.

The Limit represents a cap on City expenditures which are funded by taxes. Since the General Fund is the primary recipient of tax revenue, a rough estimate of the City expenditures funded by taxes can be calculated by summing all tax revenue (property tax, sales tax, etc) that the General Fund receives. The sum of these taxes is then compared to the Limit, and the City would not be permitted to receive and spend tax revenues in excess of the Limit amount.

The Limit is based on actual appropriations during the 1986/87 fiscal year, and is increased each year using the growth of population and inflation. In June 1990, the voters approved Proposition 111 which provided new adjustment formulas which makes the Limit more responsive to local growth issues by using a change in State per capita income or a change in non-residential new construction instead of inflation. The annual adjustment made to the Limit is based on a formula which includes the following factors:

Change in City population or Change in population for the entire County AND
Change in State per capita income or Change in non-residential new construction C.3
Packet Pg. 11
Typically, an agency selects the factors which provide for the largest growth in the Limit. For the calculation of the 2022/23 Limit, the percentage change in the City’s population, with an increase of 0.18%, is used as it provides a greater Limit. The decrease in the County’s population was 0.41%. These population estimates have been updated based on 2020 census data.

Article XIIIB specifies that local jurisdictions select their cost-of-living factor to compute their Appropriation Limit by vote of their governing body. The two allowable factors are the change in State per capita income, which was an increase of 7.55%, and the change in non-residential new construction as a percentage of the total taxable value increase of the City, which was an increase of 4.48%. The cost-of-living factor used for the 2022/23 calculation is the change in State per capita income as it provides for a greater Limit. Using the percentage change in State per capita income and the percentage change in City population generates the following 2022/23 Appropriation Limit:

Appropriations Limit for Fiscal Year 2021/22 $ 100,382,108 City Population in January 2021 64,224
City Population in January 2022 64,342
Percentage Increase in Population - City of Brentwood 0.18% Percentage Decrease - Contra Costa County -0.41%
California Per Capita Personal Income 7.55%
Change in non-residential new construction 4.48%
Factor to be applied to Prior Year

1.077435900
(1 + Population Factor) x (1 + Per Capita
Factor)
Appropriations Limit for Fiscal Year 2022/23 $ 108,155,287 Current City appropriations funded by taxes are well below the Limit.

FISCAL IMPACT
None
Attachments:

Resolution
C.3
Packet Pg. 12
RESOLUTION NO.

A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF BRENTWOOD ADOPTING THE 2022/23 PROPOSITION 4 APPROPRIATION LIMIT USING THE CHANGE IN THE STATE PER CAPITA INCOME OF 7.55% AS THE COST-OF-LIVING FACTOR AND THE CHANGE IN CITY POPULATION FACTOR OF 0.18% TO CALCULATE THE LIMIT.

WHEREAS, the Department of Finance staff have notified the City of the change in the California per capita personal income and the change in the local assessment roll due to local nonresidential construction in which the City has the option to use the greater percentage change, which change is an increase of 7.55% in California per capita personal income, and; WHEREAS, the Department of Finance staff have notified the City of the change in population of the City and the entire Contra Costa County in which the City has the option to use the greater percentage change, which change is an increase of 0.18% for the City population for the prior calendar year, and;
WHEREAS, On May 25, 2021 the City Council approved Resolution No. 2021-51 adopting the 2021/22 Proposition 4 Appropriations Limit, and; WHEREAS, pursuant to California Constitution Article XIIIB, Section 1 and Government Code sections 7900 et seq., and pursuant to the guidelines set forth by Proposition 111, the City appropriations limit must be adjusted for changes from the base year of 1986/87 to the fiscal year ending June 30, 2023.

NOW, THEREFORE BE IT RESOLVED that the City Council of the City of Brentwood, adopt the Appropriations Limit for the City of Brentwood for fiscal year ending June 30, 2023 of $108,155,287, using the change in State per capita income of 7.55% as the cost-of-living factor and the change in the City population factor of 0.18% to calculate the Limit.

PASSED, APPROVED AND ADOPTED by the City Council of the City of Brentwood at a regular meeting held on May 24, 2022 by the following vote:

C.3.a
Packet Pg. 13
Attachment: Resolution (2669 : GANN Limit)
CITY COUNCIL AGENDA ITEM NO. 4
Meeting Date: May 24, 2022
Subject/Title: A Resolution approving and authorizing the City Manager or designee to execute Agreements for Professional Services with On-Call Civil/Structural Design Services, Geotechnical/Construction Materials Testing Services, and Survey and Related Services in a not-to-exceed amount of $100,000 per agreement for fiscal year 2022/23; and approving and authorizing the City Manager or designee to execute up to two additional one-year extensions for these agreements in a not-to-exceed amount of $100,000 per agreement, per fiscal year.

Prepared by: Renee Payette, Project Services Specialist Jigar Shah, Engineering Manager
Submitted by: Miki Tsubota, Director of Public Works/City Engineer

PURPOSE AND RECOMMENDATION
This action allows staff to work with civil/structural design, geotechnical and survey consultants on various projects that come up during the fiscal year. Not approving this item would mean that staff would have to go out with a request for proposals for every project, which may cause a delay in getting work done.

It is recommended that the City Council adopt a Resolution approving and authorizing the City Manager or designee to execute Agreements for Professional Services with On-Call Civil/Structural Design Services, Geotechnical/Construction Materials Testing Services, and Survey and Related Services in a not-to-exceed amount of $100,000 per agreement for fiscal year 2022/23; and approving and authorizing the City Manager or designee to execute up to two additional one-year extensions for these agreements in a not-to-exceed amount of $100,000 per agreement, per fiscal year.

CITY COUNCIL STRATEGIC INITIATIVES
Not Applicable.

PREVIOUS ACTION
On May 28, 2019, by Resolution No. 2019-61, City Council approved and authorized the City Manager or designee to execute Agreements for Professional Services with On-Call Geotechnical, Survey, and Civil/Structural Design Consultants in a not-to-exceed amount of $100,000 for Fiscal Year 2019/20 and approving and authorizing the City Manager or designee to execute up to two additional one-year extensions for these agreements in a not-toexceed amount of $100,000 per fiscal year.

BACKGROUND
Every three years, staff from Engineering prepares Requests for Qualifications (“RFQ”) for OnCall Services for Civil/Structural Design Services, Geotechnical Services, and Survey Services for various projects. This process allows staff to have consultants available for use on a rotation basis for multiple phases in the life of projects. There are many occasions where these services are needed immediately, such as for Strategic Initiatives, and having consultants in a stand-by mode eliminates potential delays to the projects. Over the past two years, on-call consultants have been utilized on approximately ten projects.

C.4
Packet Pg. 14
Staff prepared the necessary RFQs for all three services. These documents were advertised in the local paper and with the builders’ exchanges. Staff received a total of 16 submittals; five for Civil/Structural Design Services, five for Geotechnical/Construction Materials Testing Services, and six for Survey and Related Services.

A committee of four individuals from the City’s Public Works Department reviewed the submittals in detail, and scored them based upon the criteria published in each respective RFQ.

Based on the entire RFQ process, staff is of the opinion that the following on-call consultants are the most qualified for use on a rotation basis on projects for fiscal year 2022/23.

Civil/Structural Design Services
Bellecci & Associates
BKF Engineers
CSG Consultants, Inc.

Wood Rodgers, Inc.

Geotechnical/Construction Materials Testing Services
BSK Associates
Construction Testing Services, Inc.

Geocon Consultants, Inc.

Ninyo & Moore Geotechnical and Environmental Sciences Consultants Survey Services and Related Services
BKF Engineers
R.E.Y. Engineers
Ruggeri-Jensen-Azar
Wood Rodgers, Inc.

Staff respectfully recommends approval of these Agreements for Professional Services up to a maximum amount of $100,000 per agreement, per fiscal year.

FISCAL IMPACT
These agreements are for on-call services and would only be utilized in the event there is a specific project need. Project budgets are prepared to include funding for civil/structural, geotechnical and survey services. Verification of funding availability will occur prior to retaining the selected on-call consultant for each specific project. No additional funds are requested.

Attachments:

Resolution
Bellecci & Associates Civil-Structural Agreement
BKF Engineers Civil-Structural Agreement
CSG Consultants, Inc. Civil-Structural Agreement
Wood Rodgers, Inc. Civil-Structural Agreement
BSK Associates Geotechnical Agreement
Construction Testing Services, Inc. Geotechnical Agreement Geocon Consultants, Inc. Geotechnical Agreement
Ninyo & Moore Geotechnical and Environmental Sciences Consultants Geotechnical Agreement BKF Engineers Survey Agreement
R.E.Y. Engineers Survey Agreement
C.4
Packet Pg. 15
Ruggeri-Jensen-Azar Survey Agreement
Wood Rodgers, Inc. Survey Agreement
C.4
Packet Pg. 16
RESOLUTION NO.

A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF BRENTWOOD

APPROVING AND AUTHORIZING THE CITY MANAGER OR DESIGNEE
TO EXECUTE AGREEMENTS FOR PROFESSIONAL SERVICES WITH ONCALL CIVIL/STRUCTURAL DESIGN CONSULTANTS, GEOTECHNICAL/

CONSTRUCTION MATERIALS TESTING SERVICES, A ND SURVEY AND RELATED SERVICES IN A NOT-TO-EXCEED AMOUNT OF $100,000 PER AGREEMENT FOR FISCAL YEAR 2022/23; AND APPROVING AND

AUTHORIZING THE CITY MANAGER OR DESIGNEE TO EXECUTE UP TO

TWO ADDITIONAL ONE-YEAR EXTENSIONS FOR THESE AGREEMENTS IN A NOT-TO-EXCEED AMOUNT OF $100,000 PER AGREEMENT, PER FISCAL YEAR.

WHEREAS, on May 28, 2019, by Resolution No. 2019-61, City Council approved and authorized the City Manager or designee to execute Agreements for Professional Services with On-Call Geotechnical, Survey, and Civil/Structural Design Consultants in a not-to-exceed amount of $100,000 for Fiscal Year 2019/20 and approving and authorizing the City Manager or designee to execute up to two additional one-year extensions for these agreements in a not-toexceed amount of $100,000 per fiscal year; and WHEREAS, every three years, staff from Engineering prepares Requests for Qualifications (“RFQ”) for On-Call Services for Civil/Structural Design Services, Geotechnical/Construction Materials Testing Services, and Survey and Related Services for various projects; and
WHEREAS, this process allows staff to have consultants available for use on a rotation basis for multiple phases in the life of projects; and
WHEREAS, staff prepared the necessary RFQs for all three services; and WHEREAS, these documents were advertised in the local paper and through builders’ exchanges; and
WHEREAS, a committee of four individuals from the City’s Public Works Department reviewed the submittals in detail, and scored them based upon the criteria published in each respective RFQ; and
WHEREAS, based on the entire RFQ process, staff is of the opinion that the following on-call consultants are the most qualified for use on a rotation basis on projects for fiscal year 2022/23:

Civil/Structural Design Services
Bellecci & Associates
BKF Engineers
CSG Consultants, Inc.

Wood Rodgers, Inc.

Geotechnical/Construction Materials Testing Services
BSK Associates
Construction Testing Services, Inc.

Geocon Consultants, Inc.

Ninyo & Moore Geotechnical and Environmental Sciences Consultants C.4.a
Packet Pg. 17
Attachment: Resolution (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Survey and Related Services
BKF Engineers
R.E.Y. Engineers
Ruggeri-Jensen-Azar
Wood Rodgers, Inc.

NOW, THEREFORE BE IT RESOLVED that the City Council of the City of Brentwood does hereby approve and authorize the City Manager or designee to execute Agreements for Professional Services with Bellecci & Associates, BKF Engineers, CSG Consultants, Inc., and Wood Rodgers, Inc. for On-Call Civil/Structural Design Services; BSK Associates, Construction Testing Services, Inc., Geocon Consultants, Inc. and Ninyo & Moore Geotechnical and Environmental Sciences Consultants for On-Call Geotechnical/Construction Materials Testing Services; and BKF Engineers, R.E.Y. Engineers, Ruggeri-Jensen-Azar and Wood Rodgers, Inc. for On-Call Survey and Related Services in a not-to-exceed amount of $100,000 per agreement for fiscal year 2022/23; and approving and authorizing the City Manager or designee to execute up to two additional one-year extensions in a not-to-exceed amount of $100,000 per agreement, per fiscal year.

PASSED, APPROVED AND ADOPTED by the City Council of the City of Brentwood at a regular meeting held on the 24th day of May 2022 by the following vote:

C.4.a
Packet Pg. 18
Attachment: Resolution (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) PSA_City Attorney Approved Version 040821

AGREEMENT FOR ON-CALL CIVIL/STRUCTURAL DESIGN SERVICES
Bellecci & Associates
THIS AGREEMENT is made and entered into as of the _____ day of __________________, 2022 by and between the City of Brentwood, a municipal corporation of the State of California ("City"), and Bellecci & Associates, an S Corporation ("Consultant") (each a “Party” and collectively, the “Parties”).

RECITALS
A. City requires the professional services of a consultant specifically trained and experienced in civil/structural design services, which are professional services outside of services offered by City.

B. Consultant has the professional skills and experience necessary to perform the services described in this Agreement.

C. Consultant customarily engages in these services as part of its independently established trade, occupation, and/or business, separately from its work for City.

D. City desires to engage Consultant to provide these services by reason of its qualifications and experience in performing such services
E. Consultant has submitted a proposal to City and has affirmed its willingness and ability to perform such work on the terms and manner set forth in this Agreement.

NOW, THEREFORE, in consideration of these recitals and the mutual covenants contained herein, the Parties agree as follows:

1. Scope of Work.

1.1 City retains Consultant, as an independent contractor, to perform, and Consultant agrees to render, those services (the "Services") that are described in the attached Exhibit "A," which is incorporated by this reference, pursuant to this Agreement’s terms and conditions.

1.2 Consultant will control the manner and the means of the work to be performed, and be responsible for the professional quality, technical accuracy and coordination of the Services. Consultant will, without additional compensation, correct or revise any errors or deficiencies in the Services.

1.3. Consultant will keep City informed on a regular basis that the Services are being performed in accordance with the requirement and intentions of this Agreement.

1.4 If applicable, Consultant has designated those persons listed in Exhibit “A” to provide the Services to the City. Consultant will not change or reassign those persons described in Exhibit “A” without prior written notice to City, and will not replace those individuals with individuals to whom City has a reasonable objection.

2. Standard of Performance. Consultant acknowledges that in entering into this Agreement the City is relying on Consultant's special skills and experience to do and perform the Services. While performing the Services, Consultant will exercise the reasonable professional care and skill customarily exercised by reputable members of Consultant's profession practicing in the Northern California area. The acceptance of the Services by City does not release Consultant from these obligations.

Consultant will be responsible for employing or engaging all persons necessary to perform the Services.

Consultant will control the manner and means of the services to be performed by its employees and subconsultants. All of Consultant's staff will be qualified by training and experience to perform their assigned tasks. Consultant will give its personal attention to the fulfillment of the provisions of this Agreement by all of its employees and subcontractors, if any, and will keep the Services under its control. 









  
C.4.b
Packet Pg. 19
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 2 PSA_City Attorney Approved Version 040821
On demand of City, if any employee or subcontractor of Consultant fails or refuses to carry out the provisions of this Agreement or appears to be incompetent or to act in a disorderly or improper manner, he or she will be discharged immediately from the Services.

3. Term. Unless earlier terminated, the term of this Agreement will be effective for a period of one year from the date first above written. The City Manager may amend the Agreement to extend it for two additional one-year periods or parts thereof in an amount not to exceed one hundred thousand dollars ($100,000) per Agreement year. Extensions will be based upon a satisfactory review of Consultant's performance, City needs, and appropriation of funds by the City Council. The parties will prepare a written amendment indicating the effective date and length of the extended Agreement.

4. Schedule. Consultant will generally adhere to the schedule set forth in Exhibit “A” provided, that City will grant reasonable extensions of time for the performance of the Services occasioned by unusually lengthy governmental reviews of Consultant’s work product or other unavoidable delays occasioned by unforeseen circumstances; provided, further, that such unavoidable delay will not include strikes, lockouts, work stoppages, or other labor disturbances conducted by, or on behalf of, Consultant’s officers or employees.

Consultant acknowledges the importance to City of City’s project schedule and agrees to put forth its best professional efforts to perform the Services in a manner consistent with that schedule. City understands, however, that Consultant’s performance must be governed by sound practices. Consultant will work such overtime or engage such personnel and equipment as necessary to maintain the schedule, without additional compensation.

5. Compensation.

5.1 The total fee payable for the Services to be performed during the term of this Agreement will be a not to exceed amount of one hundred thousand dollars ($100,000) as may be further specified in the attached Exhibit “A.” No other compensation for the Services will be allowed except for items covered by subsequent amendments to this Agreement. The City reserves the right to withhold a ten percent (10%) retention until City has accepted the Services.

5.2 Payment will occur only after receipt by City of invoices sufficiently detailed to include hours performed, hourly rates, and related activities and costs for approval by City.

5.3 Within thirty (30) days after receipt of any applicable progress payment request, City will verify the accuracy of the request, correct the charges where appropriate, and make payment to Consultant in an amount equal to the amount of such application, as verified or corrected by City. No payment made prior to completion and acceptance of the Services will constitute acceptance of any part of the Services.

City reserves the right to withhold payment from Consultant on account of Services not performed satisfactorily, delays in Consultant's performance of Services, or other defaults hereunder.

6. Status of Consultant. Consultant will perform the Services as an independent contractor, free from the control and direction of City, in pursuit of Consultant’s independent calling, and not as an employee of City. The persons used by Consultant to provide the Services under this Agreement will not be considered employees of City for any purposes whatsoever and City will not pay any tax, workers’ compensation insurance, retirement contributions or unemployment contributions on behalf of Consultant or its employees or subcontractors. Consultant agrees to indemnify and pay City within thirty (30) days for any tax, retirement contribution, social security, overtime payment, unemployment payment or workers’ compensation payment, including, but not limited to, those based on any provision of the Federal Affordable Care Act, which City may be required to make on behalf of Consultant or any agent, employee, or contractor of Consultant for work done under this Agreement. The payment made to Consultant pursuant to the Agreement will be the full and complete compensation to which Consultant is entitled. City will not make any federal or state tax withholdings on behalf of Consultant or its agents, employees or subcontractors.

At the City’s election, City may deduct the amounts paid pursuant to this Section, from any balance owing to Consultant.










  
C.4.b
Packet Pg. 20
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 3 PSA_City Attorney Approved Version 040821

7. Subcontracting. Consultant's services are being requested by City because they are unique and personal. Except as may be specified in Exhibit “A”, Consultant will not subcontract any portion of the Services without prior written approval of City Manager or his/her designee. If Consultant subcontracts any of the Services, Consultant will be fully responsible to City for the acts, errors and omissions of Consultant's subcontractor and of the persons either directly or indirectly employed by the subcontractor, as Consultant is for the acts and omissions of persons directly employed by Consultant. Nothing contained in this Agreement will create any contractual relationship between any subcontractor of Consultant and City.

Consultant will be responsible for payment of subcontractors. Consultant will bind every subcontractor and every subcontractor of a subcontractor by the terms of this Agreement applicable to Consultant's work unless specifically noted to the contrary in the subcontract and approved in writing by City.

8. Other Consultants. The City reserves the right to employ other consultants in connection with the Services.

9. Indemnification. Consultant agrees to indemnify, including the cost to defend, City, its officers, agents, volunteers and employees from any and all claims, demands, costs or liability that arise out of, or pertain to, or relate to the negligence, recklessness, or willful misconduct of Consultant and its agents in the performance of services under this Agreement, but this indemnity does not apply to liability for damages for death or bodily injury to persons, injury to property, or other loss, arising from the sole negligence, willful misconduct or defects in design by City or the agents, servants, or independent contractors who are directly responsible to City, or arising from the active negligence of City.

10. Insurance. Consultant will obtain and maintain, at its cost and expense, for the duration of the Agreement and any and all amendments, insurance against claims for injuries to persons or damage to property which may arise out of or in connection with performance of the Services by Consultant or Consultant’s agents, representatives, employees or subcontractors. The insurance will be obtained from an insurance carrier admitted and authorized to do business in the State of California. The insurance carrier is required to have a current Best's Key Rating of not less than "A:VII."

10.1 Coverages and Limits. Consultant will maintain the types of coverages and minimum limits indicated below, unless Risk Manager or City Manager, in consultation with the City Attorney approves a lower amount. These minimum amounts of coverage will not constitute any limitations or cap on Consultant's indemnification obligations under this Agreement. City, its officers, agents, volunteers and employees make no representation that the limits of the insurance specified to be carried by Consultant pursuant to this Agreement are adequate to protect Consultant. The coverage will contain no special limitations on the scope of its protection to the above-designated insureds except for Workers Compensation and errors and omissions insurance. Consultant will obtain occurrence coverage, excluding Professional Liability, which will be written as claims-made coverage. If Consultant believes that any required insurance coverage is inadequate, Consultant will obtain such additional insurance coverage, as Consultant deems adequate, at Consultant's sole expense.

10.1.1 Commercial General Liability Insurance. $2,000,000 combined single-limit per occurrence for bodily injury, personal injury and property damage. If the submitted policies contain aggregate limits, general aggregate limits will apply separately to the work under this Agreement or the general aggregate will be twice the required per occurrence limit.

10.1.2 Automobile Liability. $1,000,000 combined single-limit per accident for bodily injury and property damage.

10.1.3 Workers' Compensation and Employer's Liability. Workers' Compensation limits as required by the California Labor Code and Employer's Liability limits of $1,000,000 per accident for bodily injury. Workers' Compensation and Employer's Liability insurance will not be required if Consultant has no employees and provides, to City's satisfaction, a declaration stating this. 









  
C.4.b
Packet Pg. 21
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 4 PSA_City Attorney Approved Version 040821

10.1.4 Professional Liability. Errors and omissions liability appropriate to Consultant’s profession with limits of not less than $1,000,000 per claim.

10.2 Endorsements. For Commercial General Liability Insurance, Consultant will ensure that the policies are endorsed to name the City, its officers, agents, volunteers and employees as additional insureds. Prior to City's execution of this Agreement, Consultant will furnish, to the satisfaction of the City, certificates of insurance and endorsements.

10.3 Cancellation. Insurance will be in force during the life of the Agreement and any extensions of it and will not be canceled without thirty (30) days prior written notice to City sent pursuant to the notice provisions of this Agreement.

10.4 Failure to Maintain Coverage. If Consultant fails to maintain any of these insurance coverages, then City will have the option to declare Consultant in breach of this Agreement, or may purchase replacement insurance or pay the premiums that are due on existing policies in order to maintain the required coverages. Consultant is responsible for any payments made by City to obtain or maintain insurance and City may collect these payments from Consultant or deduct the amount paid from any sums due Consultant under this Agreement.

10.5 Submission of Insurance Policies. City reserves the right to require, at any time, complete and certified copies of any or all required insurance policies and endorsements.

10.6 Primary Coverage. For any claims related to the Services and this Agreement, the Consultant’s insurance coverage will be primary insurance with respect to City, its officers, agents, volunteers and employees. Any insurance or self-insurance maintained by City for itself, its officers, agents, volunteers and employees, will be in excess of Consultant’s insurance and not contributory with it.

10.7 Reduction in Coverage/Material Changes. Consultant will notify City in writing pursuant to the notice provisions of this Agreement thirty (30) days prior to any reduction in any of the insurance coverage required pursuant to this Agreement or any material changes to the respective insurance policies.

10.8 Waiver of Subrogation. The policies shall contain a waiver of subrogation for the benefit of City.

11. Business License. Consultant will obtain and maintain a City of Brentwood Business License for the term of the Agreement, as it may be amended from time-to-time.

12. Maintenance of Records. Consultant will maintain complete and accurate records with respect to costs incurred under this Agreement. All records will be clearly identifiable. Consultant will allow a representative of City during normal business hours to examine, audit, and make transcripts or copies of records and any other documents created pursuant to this Agreement. Consultant will allow inspection of all work, data, documents, proceedings, and activities related to the Agreement for a period of three (3) years from the date of final payment under this Agreement.

13. Ownership of Documents.

13.1 All product produced by Consultant or its agents, employees, and subcontractors pursuant to this Agreement (the “Work Product”) is the property of City. In the event this Agreement is terminated, all Work Product produced by Consultant or its agents, employees and subcontractors pursuant to this Agreement will be delivered to City pursuant to the termination clause of this Agreement. Consultant will have the right to make one (1) copy of the Work Product for Consultant’s records.

13.2 The Work Product may be used by City and its agents, employees, representatives, and assigns, in whole or in part, or in modified form, for all purposes City may deem advisable, without further employment of or payment of any compensation to Consultant; provided, however, that if this Agreement is terminated for any reason prior to completion of the Project and if under such circumstances City uses, 









  
C.4.b
Packet Pg. 22
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 5 PSA_City Attorney Approved Version 040821
or engages the services of and directs another consultant to use, the Work Product, City agrees to hold Consultant harmless from any and all liability, costs, and expenses relative to claims arising out of matters and/or events which occur subsequent to the termination of this Agreement as a result of causes other than the fault or negligence of Consultant, or anyone for whose acts it is responsible, in preparation of the Work Product. Consultant will not be responsible for deficiencies solely attributable to modifications of the Work Product performed by others, or that arise from use of the Documents in connection with a project or site other than that shown in the Work Product.

14. Copyrights. Consultant agrees that all copyrights that arise from the Services will be vested in City and Consultant relinquishes all claims to the copyrights in favor of City.

15. Confidentiality. All documents, reports, information, data, and exhibits prepared or assembled by Consultant in connection with the performance of the Services pursuant to the Agreement are confidential until released by the City to the public, and the Consultant will not make any of these documents or information available to any individual or organization not employed by the Consultant or the City without the written consent of the City before any such release.

16. Notices. Any notices relating to this Agreement shall be given in writing and shall be deemed sufficiently given and served for all purposes when delivered personally, by facsimile or by generally recognized overnight courier service, or five (5) days after deposit in the United States mail, certified or registered, return receipt requested, with postage prepaid, addressed as follows:

For City:

City of Brentwood
150 City Park Way
Brentwood, CA 94513
Phone No. (925) 516-5307
Attn: Jigar Shah
For Consultant:

Name: Bellecci & Associates
Title: Vice President
Address: 2290 Diamond Boulevard, Suite 100
Concord, CA 94520
Phone: (925) 685-4569
Attn: Daniel Leary
Either Party may change its address for purposes of this section by giving the other Party written notice of the new address in the manner set forth above.

17. Conflicts of Interest.

17.1 City will evaluate Consultant’s duties pursuant to this Agreement to determine whether disclosure under the Political Reform Act and City’s Conflict of Interest Code is required of Consultant or any of Consultant’s employees, agents, or subcontractors. Should it be determined that disclosure is required, Consultant or Consultant’s affected employees, agents, or subcontractors will complete and file with the City Clerk those schedules specified by City and contained in the Statement of Economic Interests Form 700.

17.2 Consultant understands that its professional responsibility is solely to City. Consultant warrants that it presently has no interest, present or contemplated, and will not acquire any direct or indirect interest, that would conflict with its performance of this Agreement. Consultant further warrants that neither Consultant, nor Consultant’s agents, employees, subcontractors and consultants have any ancillary real property, business interests or income that will be affected by this Agreement or, alternatively, that Consultant will file with the City an affidavit disclosing this interest. Consultant will not knowingly, and will take reasonable steps to ensure that it does not, employ a person having such an interest in the performance of this Agreement. If after employment of a person, Consultant discovers that it has employed a person with a direct or indirect interest that would conflict with its performance of this Agreement, Consultant will promptly disclose the relationship to the City and take such action as the City may direct to remedy the conflict.










  
C.4.b
Packet Pg. 23
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 6 PSA_City Attorney Approved Version 040821

18. General Compliance with Laws. Consultant will keep fully informed of federal, state and local laws and ordinances and regulations which in any manner affect those employed by Consultant, or in any way affect the performance of the Services by Consultant. Consultant will at all times observe and comply with these laws, ordinances, and regulations and will be responsible for the compliance of the Services with all applicable laws, ordinances and regulations.

19. Pandemic Health Laws. Consultant’s duty to comply with Laws includes compliance by Consultant with all local, state, or federal Laws that have been or may be enacted in response to the COVID-19 pandemic (collectively, “Health Laws”), which include all of the County of Contra Costa Health Orders. Failure to fully comply with the Health Laws constitutes a material default, subject to all available remedies including suspension or termination.

20. Discrimination and Harassment Prohibited. Consultant will comply with all applicable local, state and federal laws and regulations prohibiting discrimination and harassment.

21. Termination. In the event of the Consultant's failure to prosecute, deliver, or perform the Services, City may terminate this Agreement for nonperformance by notifying Consultant in writing pursuant to the notice provisions of this Agreement. Consultant has five (5) business days to deliver any documents owned by City and all work in progress to City address contained in this Agreement. City will make a determination of fact based upon the work product delivered to City and of the percentage of work that Consultant has performed which is usable and of worth to City in having the Agreement completed. Based upon that finding City will determine the final payment of the Agreement. In the event City elects to terminate, City will have the right to immediate possession of all Work Product and work in progress prepared by Consultant, whether located at the project site, at Consultant's place of business, or at the offices of a subconsultant.

Either Party, upon tendering thirty (30) calendar days written notice to the other Party, may terminate this Agreement for convenience. In this event and upon request of City, Consultant will assemble the work product without charge and put it in order for proper filing and closing and deliver it to City. Consultant will be paid for work performed to the termination date; however, the total will not exceed the lump sum fee payable under this Agreement. City will make the final determination as to the portions of tasks completed and the compensation to be made.

22. Covenants Against Contingent Fees. Consultant warrants that Consultant has not employed or retained any company or person, other than a bona fide employee working for Consultant, to solicit or secure this Agreement, and that Consultant has not paid or agreed to pay any company or person, other than a bona fide employee, any fee, commission, percentage, brokerage fee, gift, or any other consideration contingent upon, or resulting from, the award or making of this Agreement. For breach or violation of this warranty, City will have the right to terminate this Agreement for nonperformance, or, in its discretion, to deduct from the Agreement price or consideration, or otherwise recover, the full amount of the fee, commission, percentage, brokerage fees, gift, or contingent fee.

23. Claims And Lawsuits. By signing this Agreement, Consultant agrees that any Agreement claim submitted to City must be asserted as part of the Agreement process as set forth in this Agreement and not in anticipation of litigation or in conjunction with litigation. Consultant acknowledges that if a false claim is submitted to City by Consultant, it may be considered fraud and Consultant may be subject to criminal prosecution. Consultant acknowledges that California Government Code sections 12650 et seq., the False Claims Act, applies to this Agreement and, provides for civil penalties where a person knowingly submits a false claim to a public entity. These provisions include false claims made with deliberate ignorance of the false information or in reckless disregard of the truth or falsity of information. If City seeks to recover penalties pursuant to the False Claims Act, it is entitled to recover its litigation costs, including attorney's fees. Consultant acknowledges that the filing of a false claim may subject Consultant to an administrative debarment proceeding as the result of which Consultant may be prevented to act as a Consultant on any public work or improvement for a period of up to five (5) years. Consultant acknowledges debarment by another jurisdiction is grounds for City to terminate this Agreement. 









  
C.4.b
Packet Pg. 24
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 7 PSA_City Attorney Approved Version 040821

24. Jurisdiction, Venue and Governing Law. Any action at law or in equity brought by either of the Parties for the purpose of enforcing a right or rights provided for by this Agreement will be tried in a court of competent jurisdiction in the County of Contra Costa, State of California, and the Parties waive all provisions of law providing for a change of venue in these proceedings to any other county. This agreement will be governed by the laws of the State of California.

25. Testimony. Consultant will testify at City's request if litigation is brought against City in connection with Consultant's services under this agreement. Unless the action is brought by Consultant, or is based upon Consultant's actual or alleged negligence or other wrongdoing, City, upon prior written agreement with Consultant will compensate Consultant for time spent in preparation for testimony, testimony, and travel at Consultant's standard hourly rates at the time of actual testimony.

26. Successors and Assigns. It is mutually understood and agreed that this Agreement will be binding upon the Parties and their respective successors. Neither this Agreement nor any part of it nor any monies due or to become due under it may be assigned by Consultant without the prior written consent of City, which will not be unreasonably withheld.

27. Section Headings. Section headings as used in this Agreement are for convenience only and will not be deemed to be a part of such sections and will not be construed to change the meaning of the section.

28. Waivers. The waiver by either Party of any breach or violation of any term, covenant, or condition of this Agreement or of any applicable law will not be deemed to be a waiver of such term, covenant, condition or law or of any subsequent breach or violation of same or of any other term, covenant, condition or law. The acceptance by either Party of any fee or other payment which may become due under this Agreement will not be deemed to be a waiver of any preceding breach or violation by the other Party of any term, covenant, or condition of this Agreement or any applicable law.

29. Entire Agreement. This Agreement, together with any other written document referred to or contemplated by it embody the entire Agreement and understanding between the parties relating to the subject matter of it. The City Manager is authorized, in consultation with the City Attorney, to agree to nonmaterial amendments to this Agreement. Neither this Agreement nor any of its provisions may be amended, modified, waived or discharged except in a writing signed by both parties.

30. Authority. The individuals executing this Agreement and the instruments referenced in it on behalf of Consultant each represent and warrant that they have the legal power, right and actual authority to bind Consultant to the terms and conditions of this Agreement.

31. Severability. If any term, provision, condition or covenant of this Agreement or its application to any party or circumstances shall be held, to any extent, invalid or unenforceable, the remainder of this Agreement, or the application of the term, provision, condition or covenant to persons or circumstances other than those as to whom or which it is held invalid or unenforceable, shall not be affected, and shall be valid and enforceable to the fullest extent permitted by law. 









  
C.4.b
Packet Pg. 25
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 8 PSA_City Attorney Approved Version 040821

32. Signatures.

32.1 Counterparts. This Agreement may be executed in two or more counterparts, each of which together will be deemed an original, but all of which together will constitute the same instrument.

32.2 Digital/Electronic Signatures. Using a City-approved method, this Agreement may be executed through the use of digital or electronic signatures in accordance with Government Code Section

16.5. The presence of an electronic signature on this Agreement will be construed as the Parties’ consent to do business electronically.

CONSULTANT:
* By:

Printed Name: Daniel Leary
Title: Vice President
** By:

Printed Name: Anoop Reddy Admal
Title: CFO
CITY:

By:

Tim Y. Ogden, City Manager
ATTEST:

By:

Margaret Wimberly, City Clerk
APPROVED AS TO FORM:

By:

Damien Brower, City Attorney
If required by City, proper notarial acknowledgment of execution by Consultant must be attached. If a Corporation, Agreement must be signed by one corporate officer from each of the following two groups. *Group A. **Group B.

Chairman, Secretary,
President, or Assistant Secretary,
Vice-President CFO or Assistant Treasurer
Otherwise, the corporation must attach a resolution certified by the secretary or assistant secretary under corporate seal empowering the officer(s) signing to bind the corporation.

If an LLC:
x The Agreement must be signed by a Managing Member or the LLC must attach a resolution empowering the signatory to bind the LLC.

If a partnership:
x The Agreement must be signed by the Managing Partner or the Partner authorized to execute agreements of this type. Additional documentation, such as the partnership agreement, confirming this signature authority may be required.

If a sole proprietorship:
x The Agreement must be signed by the owner.










  
C.4.b
Packet Pg. 26
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 9 PSA_City Attorney Approved Version 040821
EXHIBIT “A”

SCOPE OF SERVICES










  
C.4.b
Packet Pg. 27
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) a
Statement of Qualifications to the City of Brentwood for Civil/Structural Design Services for Infrastructure Projects March 8, 2022
E. 14th St. Complete Streets Corridor Improvements • Alameda County Public Works Agency 









  
C.4.b
Packet Pg. 28
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Letter of Transmittal 1
Firm Qualifications
Firm Profile: Bellecci 2
Firm Profile: Subconsultants 2
Project Team
Bio- Summaries: Key Staff 3
Project Experience
Recent Projects 4
Project Approach
Overall Project Approach 6
Scope of Work
Quality of Work
Example Drawings 9
Statements
Agreement Provisions 12
Conflict of Interest 12
Claims or Litigation 12

APPENDIX
Organization Chart 13
Resumes
Bellecci 14
Subconsultants 23
Exhibits/Other
Awards 28
Qualification Letters 29
Table of Contents
Brentwood • Civil/Structural Design Services










  
C.4.b
Packet Pg. 29
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 1
February 22, 2022
Mr. Jigar Shah
Engineering Manager | Public Works Department
City of Brentwood
150 City Park Way
Brentwood, CA 94513
Dear Mr. Shah,
Bellecci & Associates (Bellecci) is very excited about the prospect of providing our professional design, engineering, and surveying services. We are very motivated to be selected for this On-Call contract because we have been designing infrastructure projects in the City of Brentwood since 1983, completing more than 150 projects in Brentwood. The Bellecci Team will leverage our substantial, three-plus decades of Brentwood infrastructure experience for this on-call contract. All of this background history will allow us to work very efficiently and produce high quality designs.

To enhance our team’s extensive knowledge about the City and the surrounding communities, we have teamed with Biggs Cardosa for Structural Engineering, and Fehr & Peers for traffic engineering. They are both highly regarded leaders in their respective fields who also have recent collaboration experience with Bellecci on other major CIP public sector projects in Northern California.

The most compelling reasons why the Bellecci team should be selected for this project:
• Bellecci’s 3+ decades of substantial Brentwood and East Contra Costa County knowledge and experience that will distinguish us from other firms • We have teamed with two high quality subconsultants, (Biggs Cardosa and Fehr & Peers) to deliver high quality plans for the City • We have 30 current on-calls with Cities, Counties, and other agencies throughout Northern California We look forward to having the opportunity to expand upon this SOQ and demonstrate why we have the best qualifications and assembled team to design a wide variety of on-call projects for the City. If you have any questions about this SOQ, which acknowledges receipt of Clarification No. 1 and No. 2, please feel free to contact me directly at 925 • 681 • 4880 or at [email protected].

Thank you in advance for your consideration
Daniel Leary, PE, PTOE, QSD
Principal/Senior Project Manager










  
C.4.b
Packet Pg. 30
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 2
Bellecci & Associates, Inc. (Bellecci) is a CA S-Corporation that was established in 1983. We provide civil engineering, land surveying, and construction management/inspection services to both public sector and private clients in Northern California. We are recognized leaders in design and implementation of complete streets, bike/pedestrian safety improvements, and undergrounding of overhead utilities / Rule 20 projects for multiple cities, towns, counties, and other agencies throughout Northern California. Daniel Leary, PE, PTOE, QSD was voted Manager of the Year (Transportation) by the APWA Nor Cal Chapter in 2021 and the E. 14th Street Complete Streets project was nominated for a 2022 Project of the Year award.

Most Relevant Projects
Bellecci’s Current On-Call Contracts
• Alameda, Co. Dept. of PW • MTC (Quick-Build Bench)
• Alameda, Co. Dept. of PW (Fed) • Millbrae, City of (Civil|CM|Survey) • Alameda, City of (Survey) • Mill Valley City of (Civil|CM) • American Canyon, (Civil|CM|Survey) • Pinole, City of (Civil|CM|Survey) • Antioch, City of (Civil|Survey) • Pittsburg, City of
• Berkeley, City of • San Bruno, City of (CM)
• Brentwood, City of • San Carlos, City of (Civil|CM|Survey) • College of Marin • San Jose, Dept. of Transportation
• Cupertino, City of • San Pablo, City of
• Daly City, City of • San Rafael, City of (Civil|CM|Survey) • Davis, City of (Survey) • Solano Transportation Authority • Foothill DeAnza Community College District • South San Francisco, City of • Hercules, City of (Civil|CM|Survey) • University of California, Berkeley • Los Altos, City of (Civil|CM|Survey) • Walnut Creek, City of (Inspection) • MTC (PTAP- Non-Pavement Asset Bench) • Walnut Creek, City of (Civil|Survey) Project Manager
Daniel Leary, PE, PT0E, QSD
925 • 681 • 4885
[email protected]
Office:
7077 Koll Center Parkway, Suite 210
Pleasanton, CA 94S66
925 • 685 • 4S69
Year Established:
1983
Brentwood Experience
250+ Projects from 1983–2021 (Private & City)
Firm Profile: Bellecci
Firm Profiles: Subconsultants
Biggs Cardosa
Role:

Structural Engineer
Contact:

Ron Oen
1111 Broadway #1510
Oakland, CA 94607
510 • 625 • 9900
Bellecci Teaming Experience:

Yes
Representative Brentwood Experience:
• Lone Tree Way Underpass
• Brentwood Communications Tower
• Carmel Estates Pedestrian Bridge
• Marsh Creek Retaining Walls
• East Contra Costa Irrigation District Lateral 4N Relocation • Barrington Subdivision Basin Outlet and Thrust Blocks • Sterling Preserve III Pedestrian Bridge
• East Contra Costa Irrigation District Main Canal Road Bridge at Marsh Creek • State Route 4 Bypass.

Ferh & Peers
Role:

Traffic Engineer
Contact:

Bill Burton
100 Pringle Ave., Suite 600
Walnut Creek, CA 94596
925 • 357 • 3381
Bellecci Teaming Experience:

Yes
Representative Brentwood Experience:
• Design of City’s initial fiber optic traffic signal communication network • New traffic signal - American Avenue / Heritage High School parking lot • New traffic signal fiber optic interconnect on American Avenue • O’Hara/Sand Creek Road Traffic Signal
• Modification for Adams Lane / Grant Street Signal
• Brentwood Communications Master Plan










  
C.4.b
Packet Pg. 31
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 3
Key Personnel
Please note, full size resumes for our Key Staff are located in the Appendix Daniel Leary, PE, PTOE, QSD (Bellecci) Principal-in-Charge Daniel has few peers who have managed as many public sector complete streets & Rule 20 projects.

All of these projects required comprehensive project management during the different phases, solving complex engineering challenges, while also balancing the needs of diverse stakeholders. His extensive knowledge about CIP goals and procedures will be very valuable for this contract. He was in charge of most of the relevant projects in this proposal. He is a member of Alameda County’s BPAC commission and was voted Project of the Year (Transportation) by the APWA Nor Cal Chapter in 2021. He also is a Professional Traffic Operations Engineer™ (PTOE). Daniel earned his BSCE from Cal Poly and an MBA from Cal State East Bay.

Anoop Reddy Admal, PE, LSIT, QSD (Bellecci) Project Manager Anoop is a proven and highly effective Project Manager from his role on numerous high profile public sector CIP projects over the past 16+ years. He has worked closely with Daniel on nearly two dozen UC Berkeley projects between 2006 and today. Anoop has been a Project Manager on many of our relevant University CIP projects. He is known for his attention to detail and ability to find creative solutions to problems. He will manage a staff of Professional Engineers and Project Engineers, as well as provide close coordination with our subconsultants. He has local experience from his role as the PM for the E. Cypress Road Widening and Complete Streets project for the City of Oakley. He also has earned a Master’s Degree in Civil engineering.

Keyi “Amy” Yang, PE, MSCE, LEED Green, LSIT (Bellecci) Associate/Professional Engineer Amy is one of Bellecci’s most valuable employee’s who represents the next generation of highly educated engineers. She recently passed her PE exam and has Excel skills which includes creating customized formulas to automate previous time consuming data gathering tasks. Her other engineering software knowledge includes (ArcGIS; Infoworks ICM; Civil 3D; AutoCAD; EPA SWMM; EPANET; MATLAB; HEC-RAS; Optimizer) which makes her well qualified for this contract. For Bellecci, she quickly immersed herself into several of the company’s most complex projects including active transportation projects for the cities of Santa Clara, Cupertino, Redwood City, and UC Berkeley.

Emma Schoenthal, EIT (Bellecci) Associate/Project Engineer Emma is a self starter who graduated summa cum laude with a 3.95 GPA from a prestigious University of California school. She was awarded the “Highest Academic Achievement in Environmental Engineering” and earned the John E. Starrett Memorial Scholarship award. Her software experience includes AutoCAD, MATLAB, Solidworks, 3D Printing and programming for PTC Mathcad and Python. We are thrilled that Emma decided to join our new generation of outstanding academic achievers.

Ron Oen, PE, QSD (Biggs Cardosa)
Ron has provided structural engineering services to the City of Brentwood and within the city since 2000. Ron was the project engineer on their first contract with the City of Brentwood to design the Lone Tree Way Underpass.

On another contract with the City, Ron provided project management for the design of the Brentwood Communications Tower. Ron has worked on numerous other projects throughout the city, including but not limited to: Carmel Estates Pedestrian Bridge; Marsh Creek Retaining Walls; East Contra Costa Irrigation District Lateral 4N Relocation; Barrington Subdivision Basin Outlet and Thrust Blocks; Sterling Preserve III Pedestrian Bridge; East Contra Costa Irrigation District Main Canal Road Bridge at Marsh Creek; State Route 4 Bypass.

Photo Not Available










  
C.4.b
Packet Pg. 32
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 4
E. 14th Street Corridor Bicycle & Pedestrian Safety Improvements • Alameda County Public Works Agency Bellecci was awarded the design contract as the Prime Consultant for over a mile of complete streets and pavement rehabilitation on this heavily traveled regional corridor. The project includes Class IV protected bike lanes, new sidewalks, curb, driveway conforms, pedestrian safety improvements, and assorted improvements via our On-Call contract with Alameda County. The improvements on E. 14th also features bulb-outs, raised curb medians, and improved sidewalks/ crosswalks in this very congested street, which is also designated as a SR 185 along most of this corridor. Early in the preliminary design, Bellecci led two public outreach meetings. The community meetings were successful and well attended by the business operators, elected officials representatives and community. Several ideas from the community were implemented into the project design.

Construction: $17M Schedule: Completed December, 2021
Client Reference:

Alameda County Public Works Agency (ACPWA)
Ms. Amber Lo, PE
510 • 481 • 6963 | 510 • 670 • 5485
Recent Projects
2020 Pavement Repair • City of Hercules
Bellecci was selected to design this job through our on-call contract. We prepared plans, specifications and estimate (PS&E). The proposed repair for Turquoise Drive will feature 0.30” Cold In-Place Recycling & 0.20” Overlay. The project also includes removal & replacement of 440 LF of PCC curb & gutter, remove & replace 500 SF of PCC sidewalk, remove and replace 1410 SF of PCC curb ramp.

Construction: $731k Estimate Schedule: Completed 2021
Client Reference:

City of Hercules
Mr. Mike Roberts, PE
510 • 799 • 8241
[email protected]
Diamond Blvd./Willow Pass Road Sewer Repair No. 2554 • City of Concord Bellecci was selected to provide surveying and design services to address the replacement of structural deficient sewers, with approx. 724 LF of new 8” HDPE / PVC sanitary sewers. Sanitary sewer lines recommended for replacement included replacing sewer laterals, from the sewer main to rightof-way clean out. Sanitary sewer manholes and right-of-way clean outs were evaluated to determine if they needed to be rehabilitated, constructed, or replaced.

Construction: $771k Eng. Est.

Schedule: In Construction Winter, 2022
Client Reference:

City of Concord | Mr. Ali Hatefi, PE Project Manager
[email protected] | 925 • 671• 3284










  
C.4.b
Packet Pg. 33
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 5
Recent Projects
2019-20 Citywide Annual Waterline Replacement • Sunnyvale, City of The Project consists of replacing approximately 12,400 lineal feet of water mains, on eight City-wide public streets and three locations in the Caltrans ROW - El Camino Real (SR 82), including valves and fire hydrants; tie-in of new mains to existing mains, replacement of service laterals up to existing water meters, and replacement of non-radio-read water meters. Our scope of work included project management, preliminary design, design development, permitting, bid documents, bidding support, and construction support services Construction: $6.09M
Schedule: Bids opened Jan. 2022
Client Reference:

City of Sunnyvale
Richard Chen, PE, Project Manager
408 • 730 • 7414
Bellecci has been selected as the lead engineer on a Roundabout design on State Route 152. The Roundabout project is a collaboration between the City and a home builder, as part of new residential development. SR 152 is an important link between I-5 in the Central Valley and the Monterey Bay Areas. The project includes two alignments: a) a two-lane roundabout with an ultimate design to expand to b) a four-lane roundabout.

Construction: $1.1M
Schedule: Completed Fall 2021
Client Reference:

Meritage Homes City of Gilroy
Jon Cakus, Project Manager Gary Heap, City Engineer
925 • 543 • 4058 408 • 846 • 0451
Autumn Way and Hecker Pass Highway (SR 152) Roundabout • Gilroy, City of 









  
C.4.b
Packet Pg. 34
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 6
Project Approach
Planning & Project Management (Typical On-Call Project) Evaluation of City Project Goals
Prior to preparing detailed plans and specifications for a typical City On-Call engineering project, we will perform research and take careful assessment of the City’s primary goals and objectives. At Bellecci we have established a mindset to carefully consider each project’s challenges of designing for all users within limited right of way and coordinating the parking impacts on the community.

Kick Off Meeting
At the outset of the project, Bellecci will listen to the City to establish the overall Mission of the Project. The goals of the City for future task orders will be refined as part of our preliminary design efforts and discussions with Key Stakeholders at the Project Kick-Off Meeting. One question we will ask each staff person at the Kick-Off meeting will be “How would you define the successful outcome of an On-Call Project?” Communication with City Staff
Communication is one of the key aspects of our programming approach.

Project elements such as design alternatives, schedule, project costs, budget, and meetings should be effectively communicated to the City. We have found that standing project meetings results in more effortless ebb and flow for the project, with all parties remaining in-sync. Much of the stress on the Design Team and the City results from unplanned events. This can be alleviated by having standing meetings.
• Virtual PM Meeting Every Two Weeks - City PM & Bellecci PM (20-minute action item check-in)
• Page-Turn Review Meeting for each submittal (or a remote video conference as appropriate)
• Monthly Agenda/Schedule Teleconference – following the weekly PM conference call.

Mapping & Field Investigations
Design Base Map: Aerial Mapping and Field Survey
Bellecci has In-House Local 3 Union field surveyors, most who have been with the firm for more than 20 years. Bellecci will prepare a topographic survey for On-Call projects, under the direction of a California Licensed Land Surveyor and field crew performing supplemental survey. The topographic survey will be a combination of aerial topographic survey and supplemental field survey by our in-house field survey crew.

Initially, our aerial subconsultantwill fly the site, and a photogrammetrist will prepare the aerial topographic survey using with field points a select locations to rectify the survey. The aerial topographic survey in CAD will provide an excellent base map for the conceptual design and the Community Meeting, both in terms of graphics and accuracy.

After the 35% design, the Bellecci field crew will use the same field control as the aerial topographic survey to perform supplemental field surveying.

The field topography will consist of focused segments of the project which require additional details based on the conforms identified in the 35% plans. Our licensed PLS may use GPS for topographic survey as appropriate, to be determined on a site by site basis. The CAD drawing will be completed by the office survey staff under the direction of the professional land surveyor. The supplemental topographic survey will include the outline of the existing facilities, topographic survey points with elevations, annotated existing features, street names, north arrow, scale, basis of bearing, and Bellecci standard border.

Right of Way Mapping Process
As part of the topographic survey mapping, Bellecci’s survey department will perform right of way mapping research. For streets and locations without property impacts, the survey department will use Parcel Quest to download record maps. We will also review the maps received from the City to include the street right of way line in CAD for the project.

After downloading the on-line record maps, the approximate property line locations will be added to the project survey base map using street widths, best fit lines at the back of walk and centerline setbacks, and best fit property lines at fence lines.

Utility Company Program Management
A key element to the successful completion of On-Call projects is the skillful and persistent management of the utility companies for the utility relocations. Bellecci recently completed a $15 million utility relocation program for the City of Redwood City on Middlefield Road. This Rule 20 project had 24 joint utility meetings to track the progress. Our strategy with PG&E, AT&T, Comcast and Astound was threefold: 1) Regular Meetings with action items and meeting minutes, 2) Exhibits for each utility meeting sent to each participant in advance, and 3) Office visits/ field visits and telephone calls with the utility companies between meetings. One of the aspects of our management of the utility process, which the utility companies appreciate, is we have a goal of short meetings focused on the action items. As a result, we have had almost 80% attendance rate at the Middlefield Road UUD program meetings due to our approach of respecting the time of the utility company reps, while persistently following up with them.

Utility Letters and Mapping
Bellecci will also prepare utility letters and project location exhibits, with utility requests on City letter head to avoid paying fees for utility information, to coordinate and identify existing utilities that will be impacted or cause impact by the proposed project.

Bellecci will coordinate with owners of the utilities, including City owned facilities, in the project area to obtain copies of their utility base maps for use in developing the base plans. The approximate locations of the utilities from the information provided by the utility companies will be added to the base map. Bellecci will research and review existing topographic mapping, right‐of‐way maps, “as built” plans, record maps, surveys, assessor maps, improvement plans, and other characteristics for the project. Bellecci will conduct field reconnaissance of the project limits. Bellecci will also incorporate utility lids, valves and manholes that are located as part of the field work by the field survey crew. 









  
C.4.b
Packet Pg. 35
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 7
Project Approach
Next, the engineer will adjust the utility lines in CAD based on the topographic survey points of the utility box lids, manholes, valves, and USA markings that were also captured as part of the field survey.

The utility covers in the limits of work will be identified on the plans, and construction notes will state the action required by the Contractor or the utility company.

Caltrans Utility Matrix
For any work along a State Route or within the State right of way, Caltrans will require an Encroachment permit application, a letter from the City authorizing the design consultant and authorized representative on behalf of the City, Utility certification, Utility Conflict Matrix, Utility Design Exception letter, signed and stamped encroachment permit plans, traffic control plans, cost estimates. We have recent samples of these documents that were approved by Caltrans for the Crystal Springs Sewer Replacement Project constructed on El Camino Real (SR 82) in San Bruno. We have recently coordinated with Caltrans Representatives Roya Azarmi, Transportation Engineer and Amjad Naseer, Sr. Permits Engineer on two projects: Crystal Springs Avenue Sewer Replacement Project and on Middlefield Road and Woodside Intersection (SR 84) Underground Utility Joint trench crossing a Caltrans State Highway.

Engineering & Design
Accessible Curb and Gutter & Curb Ramp Improvements
For Curb Ramp design in general, design would follow these design guidelines: Conform to the Caltrans Standard Plans A88B. Caltrans Std.

Details allow for Construction tolerances. ADA requirements for City Standard Details 2% max. cross slope, 9% max. curb ramp slope and 10% max. flare slope and 4’ min. width of sidewalk are also acceptable. • Max. Curb Ramp slope = 7.5%
• Max. Landing Cross Slope = 1.5%
• Max. Flare Slope = 9%
• Minimum Width of Curb Ramp = 4’-2” for Case A, D, E, F and G. • Minimum Width of Curb Ramp = 5’ for Case B & C
• Maximum Slopes in adjoining gutters = 5% within 4’ of the curb ramp in the roadway.
• Detectable Domes = 3’ Min. long and width of curb ramp.

We feel the design of the accessible curb ramps is also one of the most important potential tasks for On-Call improvements. Our surveyor will collect focused survey data at the proposed curb ramps. The curb ramps will be designed per the most recent Caltrans Plan Preparation Manual and will be shown an enlarged plan at 10 scale. See Sample Detailed Grading plan (above) from a recent City of Pittsburg Federal Aid Project.

As part of our Best Practices for smaller transportation projects, Bellecci will prepare a stormwater treatment summary email prior to the 65% submittal. The purpose of the stormwater treatment evaluation is to review the MRP as it relates to the project and to document and finalize the strategy for the required LID improvements/C3. LID treatment devices are likely not required for a minor transportation project/s, but it is important to document the project assumptions in the event there are questions asked after the projects are constructed.

Sample Enlargement Detail by Bellecci for City of Pittsburg’s Stoneman Avenue Improvements (see image above)
Public Outreach
Our Team has been involved in Community Outreach in 2020 through 2022 for several cities in the Bay Area during shelter in-place and Covid-19.

Outreach notification remains the same using e-outreach connection by emails, via community organization lists, project mailing list/s from local agencies, notices in local community newspapers, and websites dedicated to the project with a reference to public involvement. The meetings may be hosted on a video conferencing platform, such as Zoom.

AutoTurn Analysis of Turning Movements
For intersections with needed geometry changes on
this On-Call contract, we will evaluate the truck turning templates. Bellecci will use AutoTurn software to model the turning movements for each corner. The critical design vehicles will be local fire truck, buses, and the largest delivery vehicle expected for the affected streets. Also, bus routes will be researched to verify additional design criteria. AutoTurn has hundreds of preset vehicle templates, or Bellecci can modify an existing AutoTurn template to match the design vehicle desired by the City.

Hecker Pass Roundabout (SR 152) • Gilroy, City of










  
C.4.b
Packet Pg. 36
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 8
Project Approach
Peer Reviewer
The Peer Reviewer assigned to the On-Call contract is Jude Dictado, PE. He has more than 25 years’ experience in public works engineering and construction management. Jude is in charge of our Construction Management Department and is separate from our team of design engineers proposed for this contract. For the plan review, he will be checking the following key items:
• Trench details
• Landscape, electrical, structural and utility layout conflicts • Sequencing of work
• Pedestrian and bicycle safety, crossings and path of travel during construction Traffic handling and pedestrian access • Conformance with various city master plans and specific plans • Interim drainage during construction
• Utility pipe material, spacing and alignment
• Review of temporary and permanent traffic signal conduits, affected by construction • Driveway and turning movement impacts during construction • Profile review for conflicts
• Pay clauses in the specifications & Bid Form
• Side street and private property conforms
• Back-check geotechnical report and corrosion report
• City standards
• Field review of the USA Markings
3rd St. Complete Streets (In Construction) • Davis, City of 









  
C.4.b
Packet Pg. 37
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 9
Example Plan Set










  
C.4.b
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 10
Example Plan Set










  
C.4.b
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 11
Example Plan Set










  
C.4.b
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 12
Statements
Statements
We have seen the City’s standard agreement in Attachment B of this RFP. The instructions say that we agree to enter into a contract with no exceptions to the agreement. Generally we find this acceptable with the understanding that the contract language isn’t materially different than the most recent On-Call survey contract we signed with the City in 2019, with a signed extension in June 2021.

Claims or Litigation
Bellecci is proud to declare we have not had any claims or litigation regarding our work within the past three years. This is a testament to the high quality of our designs and project management.

Conflicts of Interest
As has been stated throughout this proposal, Bellecci as a company has been working on projects in the city of Brentwood since the year we first started business – 1983. Our library of projects includes approximately 250 projects in the City – with 36 for the City itself. Bellecci routinely works on private and public sector projects on an on-going basis, which could include future work in Brentwood. However, we are proposing staff from our Pleasanton office to work on this project who are separate from the development department that works in our Concord corporate office. Below is a list of our current and most recent Brentwood projects.

Year Client Project Name Type of Work
2021 Brentwood, City of Diablo Alley S.S. Survey
2021 Brentwood, City of Waterline Fairview STA Survey
2021 Claremont Homes Silvergate Survey (Design Earlier Phase) 2020 Private Hagar Residence (Lone Oak Rd.) Design/Survey 2019 Brentwood, City of Sand Creek Rd Row Survey
2019 Brentwood, City of Brentwood Blvd To Homecoming Survey 2019 Brentwood, City of Alleyway Oak-Fir Survey










  
C.4.b
Packet Pg. 41
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 13
Daniel Takacs, LSIT
Survey Technician
Land Surveying
Alex Fong, PLS
Survey Manager, Principal
Land Surveying
Anoop Admal, PE , LSIT, QSD
Senior Project Manager,Principal
Civil Engineering/Project Mgt.

Daniel Leary, PE, PTOE, QSD
Principal in Charge
Civil Engineering/Project Mgt.

Edmund Tsui
Project Engineer
Civil Engineering/Project Mgt.

Anthony Nguyen, EIT
Project Engineer
Civil Engineering/Project Mgt.

Keyi Amy Yang, PE, LSIT
Associate, Professional Engineer
Civil Engineering/Project Mgt.

Robert Broestl, PE
QA/QC, Principal
Civil Engineering/Project Mgt.

Appendix: Organization Chart
Jigar Shah
Engineering Manager
Brentwood, City of
Emma Schoenthal, EIT
Associate, Project Engineer
Civil Engineering/Project Mgt.

Andy Chakraborty, PE, PTOE
Senior Traffic Engineer
Civil Engineering/Project Mgt.

Bellecci & Associates
TEAM
Fehr & Peers
Bellecci Field Crew
Land Surveying
Land Surveying
Ron L. Oen, PE, QSD
Principal in Charge
Structural Engineering
Bill Burton, PE, TE
Principal, Project Manager
Traffic Engineering
To Be Determined
Landscape Architect
Mark Howard, PE
Senior Transportation Engineer
Traffic Engineering
John Alciati, PE, QSD
Structures Project Manager
Structural Engineering
360 Aerial
Biggs Cardosa
Landscape Architect (TBD)
Principal, Project Manager
360 Aerial
Jason Bagley
Survey Technician
Land Surveying
Nick Natale, PE
Professional Engineer
Civil Engineering/Project Mgt.










  
C.4.b
Packet Pg. 42
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 14
Daniel Leary, PE, PTOE, QSD
Principal in Charge
25 years experience • 23 years with Bellecci
MBA: Cal State Hayward, Hayward, CA
BSCE: Cal Poly San Luis Obispo
PE: CA 48394 | QSD: 24867
PTOE: 3935
Daniel has served as the Office Director for Bellecci’s Pleasanton office for more than 20 years. He is know for his ability to skillfully implement On-Call projects, as well as very complex, multi-discipline projects with construction values up to $25M. He is a leader in municipal CIP design and is a member of Alameda County’s BPAC Technical committee. Mr. Leary has managed the majority of Bellecci’s recent and past On-Call projects, including an 11 year on-call contract with 110+ projects for the San Jose Redevelopment Agency, 50+ projects for UC Berkeley, and 19 projects for Alameda County Public Works Agency over the past five years. Daniel also received a Manager of the Year Award (Transportation) in 2021 from the APWA Nor Cal Chapter.

Contra Costa Blvd. / Taylor Blvd. Complete Streets Imp. • City of Pleasant Hill $5.4M Principal in Charge: Bellecci is the civil prime for complete streets and traffic safety enhancements along approximately 0.25 miles of Contra Costa Blvd. (CCB) Major improvements include new Class II buffered bike lanes along both sides of street, bicycle detection at signalized intersection, buffered sidewalks and LED pedestrian level lighting adjacent to the commercial frontage, ADA compliant curb ramp upgrades, include bus stop improvements, pavement resurfacing, LED street lighting in the median island, drought‐tolerant landscape, irrigation, and hardscape to match the earlier phases, utility coordination, and obtain an E-76.

Burlingame Avenue Streetscape • City of Burlingame $15.9M Principal in Charge: Bulbouts, widened sidewalks, ADA ramps, new pavement, pavers, rain gardens, downtown business district coordination, parking stalls, bulbouts, crosswalks, drainage. (APWA Silicon Valley Chapter Project of Year - 2015)
Middlefield Rd. Bicycle & Pedestrian Improvements • City of Redwood City $8.06M Principal in Charge: Streetscape, Rule 20, pedestrian, bike safety, County coordination, New wider sidewalks, paver crosswalk,bioswale treatment, pedestrian safety, Class IV bike lanes.

Stevens Creek Blvd. Quick Build Cycle Track to Apple • City of Cupertino $811k Project Manager: for project that will construct Improvements for a major regional arterial road including new Class IV bike lanes, intersection bulb‐outs and curb returns, curb ramps, raised buffer island, and signal modifications at three intersections. We developed an innovative pre-cast cycle track island design in conjunction with a leading concrete manufacturer.

E. 14th Street Complete Streets • Alameda County PW $17.3M Project Manager: Project to create Class IV bike lanes, widen sidewalks, enhanced crosswalks, bulb-outs, and undergrounding of all utilities. Also included are street tree plantings, improved medians, decorative pavers, and decorative streetlights for Ph. II which includes SR 185.

Saratoga Ave. / Prospect Rd. Complete Streets • City of Saratoga $4.5M Project Manager: To prepare PS&E for 1.9 mi of ped/bike safety - including Class II buffered bike lanes, 6500’ of new medians, ADA curb, gutter, sidewalk, drainage, utilities, bus stop, and a RRFB mid-block crossing, and school frontage improvements.

Third Street Bicycle Corridor| Complete Streets • City of Davis $3.5M Project Manager: Downtown gateway to UC Davis. Permeable pavers, urban rain gardens, bioswales, bulbouts, ADA curb ramps, storm drain, sewer, water, gas, joint trench, sidewalks, and drainage.

Project Duties
• City procedures and QA/ QC
• Resource for Design & Management
• Bike & Pedestrian Safety Expertise
• Complete Streets Expertise
• Subconsultant Management
• Public Outreach
• Contracts
Appendix: Resumes (Bellecci)










  
C.4.b
Packet Pg. 43
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 15
Anoop Reddy Admal, PE, LSIT, QSD, MSCE
Senior Project Manager, Principal
17 years experience • 16 years with Bellecci
MSCE: Univ. of Memphis, Memphis, TN
BSCE: Osmania University, Hyderabad, India
PE: CA 76008 | LSIT: CA 8256 | QSD: 23976
Anoop is known for his outstanding design and Project Management skills for a wide variety of municipal CIP projects throughout Northern California. His expertise includes Complete Streets, Water Distribution, Sanitary Sewer, Rule 20, and ADA improvements. For his Masters degree, Anoop focused on Transportation and Traffic Engineering and implements his training when designing and managing projects. Anoop has been the PM on recent active transportation projects for the Cities of Concord, Cupertino, Los Altos (City & Town of), Milpitas, Pleasant Hill, Redwood City, Saratoga, and Santa Clara.

Contra Costa Blvd. / Taylor Blvd. Complete Streets Imp. • City of Pleasant Hill $5.4M Project Manager: for complete streets and traffic safety for 0.25 miles of Contra Costa Blvd. (CCB) Major improvements include new Class II buffered bike lanes (both sides),, bicycle detection at signalized intersection, buffered sidewalks, pedestrian level lighting, ADA compliant curb ramps, bus stop improvements, pavement resurfacing, LED street lights, drought‐tolerant landscape, irrigation, and hardscape to match the earlier phases, utility coordination, and obtain an E-76.

Public Right-of-Way ADA Improvements • City of Santa Clara $8.6M Project Manager: The Project generally involves removal of barriers to accessibility in the public rightof-way in the near Levi’s Stadium. The work includes concrete sidewalks, curb ramps, driveways, asphalt repairs,pedestrian street crossings, parking lots, landscape areas, rail crossings, traffic signals, and other miscellaneous barriers
Middlefield Rd. Bicycle & Pedestrian Improvements • City of Redwood City $8.06M Project Manager: Complete Streets, Rule 20, pedestrian, bike safety, County coordination, new wider sidewalks, paver crosswalk, bioswale treatment, pedestrian safety, and separated bike lanes.

Downtown Bike/ Ped. Improvements • City of Concord $3.8M Project Manager: Features bulbouts, widened sidewalks, ADA ramps, new bike lanes, downtown business coordination, and high visibility crosswalks along one of the busiest City corridors.

Dyer Street Pedestrian Safety • City of Union City $100k Project Manager: Project with In-road warning system, bike lanes, ADA curb ramps, speed feedback sign, stripping, E76, federal funded, topo survey.

Saratoga Ave. Complete Streets • City of Saratoga $4.5M Professional Engineer: 1.9 mi of ped/bike safety - including Class II buffered bike lanes, 6500’ of new medians, ADA curb ramps, gutter, sidewalk, drainage, utilities, bus stop, and new RRFB.

E. 14th Street Complete Streets • Alameda County PW $17.3M Professional Engineer: Project to widen sidewalks, enhanced crosswalks, bulb-outs, and undergrounding of all utilities. Also included are street tree plantings, improved medians, decorative pavers, and decorative streetlights for Ph. II along this regionally significant corridor.

Downtown Streetscape Ph. I-III • City of Vallejo $4M
Professional Engineer: 10+ blocks, intersections, signal, new sidewalks, ADA curb, pavement, and rain garden.

SR 152 at Hecker Pass Roundabout • Private Client (in Gilroy, CA) $1.09M Professional Engineer: Bellecci was selected to design, and help guide this roundabout design through the regional Caltrans office. Now that this project is completed, the public can enjoy this modern roundabout and the more efficient flow of traffic through this busy corridor. The project also included close coordination with the City of Gilroy’s engineering department.

Project Duties
• Proposed Project Manager
• Design Team Leader
• Schedule & Budget
• Meetings with Designers
• Stakeholder Presentation(s) & Meetings
• Oversee Creation of PS&E
• Subconsultant Coordination
Appendix: Resumes (Bellecci)










  
C.4.b
Packet Pg. 44
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 16
Anindya (Andy) Chakraborty PE, PTOE
Senior Traffic Engineer
19 years experience
MSCE: Wayne State University, Detroit, MI
MBA: University of Connecticut, Storrs, CT
BSCE: Jadavpur University, India
Mr. Anindya (Andy) Chakraborty has extensive experience in traffic engineering and transportation planning. Throughout his career, he has conducted, managed and supervised wide-ranging transportation projects, including corridor studies, traffic impact studies, crash analysis, design and analysis of traffic signals and signal systems, development of Maintenance & Protection of Traffic (MPT) plans, technical documentation and reports, including cost estimates, contract documents and specifications. Mr. Chakraborty has been a published Engineer in the Transportation Research Board (TRB) newsletter.

Rubber Avenue and Melbourne Avenue/Hoadley Street Signals* Project Manager: (FEDERAL AID PROJECT NO. 1087 (113) Served as Project Manager for a traffic signal design project at the intersection of Rubber Avenue and Melbourne Avenue/Hoadley Street. The project will involve survey, capacity analysis of the existing skewed intersection and development of traffic signal plans for a complete replacement of the existing traffic signal hardware including controller cabinet and signal heads, while calling for new vehicle detectors, pavement markings and pedestrian signal phase.

Traffic Signal Design US Route 6 and Route 72*
Lead Traffic Engineer: Served as Lead Traffic Engineer for the traffic signal design project for a total overhaul of traffic signal equipment as part of a bridge replacement project. The subject intersection operated on a complex phasing simultaneously with the intersection from the same controller and also had a time-base co-ordination with Allen Street, with a pre-defined offset. Efforts included recommendations on geometric improvements, relocation of pedestrian crossings and stop bars, new signage, overhaul of traffic signal timing and phasing schemes and design of completely new traffic signal equipment, including controller cabinet, video detection cameras, emergency preemption system, pedestrian signals as well as associated hardware.

I-91 and Route 5 Signals*
Lead Traffic Engineer: for re-designing two existing traffic signals at the intersections of I-91 ramps with Route 5. The project is currently at its final design phase. The scope of work also included development of Maintenance and Protection of Traffic plans, specifications and estimates for the bridge replacement portion of the project.

On-Call Traffic Engineering Services, Orangetown*
Lead Traffic Engineer: for providing on-call engineering services to the Town of Orangetown including traffic signal design, review of traffic impact studies, signage and pavement marking design and miscellaneous engineering tasks.
32 Mi. Long Major Corridor Study (17 interchanges / 64 Signalized Intersections) ** Lead Traffic Engineer: for preparing a corridor study for widening of an Interstate. The project involved detailed traffic simulation model development in CORSIM for a 32-mile-long mainline, 17 interchanges and 64 signalized intersections. Detailed recommendations on interchange reconfigurations, addition and/or elimination of ramps, new collector-distributor roads, acceleration/ deceleration lanes, re-phasing and re-timing of signals throughout the corridor were developed.

Project Duties
• Traffic Signal Plans
• Advanced Flashing Beacon
• Striping / High Visibility Sidewalks
• Drafting
* = project experience prior to joining Bellecci
Appendix: Resumes (Bellecci)
Photo Not Yet Available










  
C.4.b
Packet Pg. 45
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 17
Keyi “Amy” Yang, PE, MSCE, LSIT
Associate, Professional Engineer
MSCE: University of Illinois at Urbana-Champaign
BSCE: University of Illinois at Urbana-Champaign

4.5 years with Bellecci
PE: CA 90849
Amy is one of Bellecci’s most valuable employee’s who represents the next generation of highly educated engineers. She is a problem solver who used her ingenuity to develop a custom Excel formula that automated a previous time consuming data gathering task for Rule 20 projects.

For Bellecci, she has demonstrated leadership by working on some of the company’s most complex projects for utilities, bicycle and pedestrian safety, Rule 20, and transportation projects for the cities throughout the region. Due to her exceptional performance on public sector projects, Amy was recently promoted to an Associate.

Middlefield Rd. Bicycle & Pedestrian Improvements • City of Redwood City $8.06M Professional Engineer: Complete Streets, Rule 20, pedestrian, bike safety, County coordination, new wider sidewalks, paver crosswalk,bioswale treatment, pedestrian safety, Class IV bike lanes.

Public Right-of-Way ADA Improvements • City of Santa Clara $8.6M Professional Engineer: The Project generally involves removal of barriers to accessibility in the public right-of-way in the near Levi’s Stadium. The work includes concrete sidewalks, curb ramps, driveways,asphalt repairs,pedestrian street crossings, parking lots, landscape areas, rail crossings, traffic signals, and other miscellaneous barriers
Contra Costa Blvd. / Taylor Blvd. Complete Streets Imp. • City of Pleasant Hill $5.4M Professional Engineer: for complete streets and traffic safety for 0.25 miles of Contra Costa Blvd. (CCB) Major improvements include new Class II buffered bike lanes (both sides),, bicycle detection at signalized intersection, buffered sidewalks, pedestrian level lighting, ADA compliant curb ramps, bus stop improvements, pavement resurfacing, LED street lights, drought‐tolerant landscape, irrigation, and hardscape to match the earlier phases, utility coordination, and obtain an E-76.

E. 14th Street Complete Streets • Alameda County PW $17.3M Professional Engineer: Project to construct 1 mile of corridor improvements which includes new pavement, a cycle track, widen sidewalks, enhanced crosswalks, bulb-outs, and undergrounding of all utilities. Also included are street tree plantings, improved medians, decorative pavers, and decorative streetlights for Ph. II which includes SR 185.

Fremont Avenue Pavement Rehab • City of Los Altos $1.2M Professional Engineer: OBAG project to rehab the pavement (CIR) for a 4,200 LF segment of this major arterial and gateway to the City. Complete streets treatments are also planned for this project.

Stanton Ave. Complete Streets Ph. II • Alameda County Public Works $6M Professional Engineer: Design services to prepare PS&E for new and replacement sidewalks, curb/gutter, conforms at existing driveways, new ADA curb ramps, retaining wall improvements, tree planting, storm water area planting, storm water quality (C.3) enhancements and pedestrian access enhancements; including RRFB improvements at mid-block crosswalk Fairmont Avenue (Arterial) - 1 Mile Pavement Rehab • Alameda County PW $2M Project Engineer: Bellecci designed 1-mile of pavement rehabilitation and a half a mile of pedestrian/ bicycle improvements along this high traffic volume County arterial. The scope of work included obtaining a Caltrans Encroachment Permit, signal modifications, curb ramps, signal cameras, Class 2 green bike lanes and pavement digouts and rubberized cape seal.

Mission Blvd. Complete Streets / R20, Ph. III • Alameda County PW $25M Professional Engineer: Project on a busy county corridor that connects I-238 and E.14th St. Scope includes PG&E base files, utility letters, JT Intent layouts, vaults, CAD, PG&E/ county coordination — she also has provided project management assistance.

Project Duties
• Project Management Assistance
• Drafting
• Design of Dry Utilities Plan & Profiles
• Technical/Admin. Assistance
Appendix: Resumes (Bellecci)










  
C.4.b
Packet Pg. 46
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 18
Appendix: Resumes (Bellecci)
Project Duties
• Project Management Assistance
• Drafting
• Design of Dry Utilities Plan & Profiles
• Technical/Admin. Assistance
* = project experience prior to joining Bellecci
Nick Natale, PE, ENV SP
Professional Engineer
16 years experience
Bachelor of Civil/Environmental Engineering: University of Nevada, Las Vegas, Las Vegas, NV Associate of Business: College of Southern Nevada, Las Vegas, NV PE #24571, Nevada Board of Professional Engineers & Land Surveyors PE #11405563-2202, Utah Division of Occupational and Professional Licensing NASSCO PACP #U-916-07005420
Nick has experience managing and designing various project including grading, hydraulics and hydrology, water network analysis and transient analysis, sanitary sewer design, condition assessments, and master planning. His software experience includes AutoCAD Civil 3D, Bentley Microstation, and ARCGIS. He is well acquainted with 3D pipe networks and related CAD features, for the production of civil BIM models. Nick also has experience with hydrology and hydraulic modeling software such as HEC-1, HEC-HMS, HEC-RAS, HY-8, WSPG, Bentley Flowmaster, Bentley WaterCad, Bentley Hammer, EPASWMM, INFOSWMM, XPSWMM, and WinTR55. He is also skilled in the review and ranking of over 200,000 linear feet of sanitary sewer CCTV per the guidelines specified in NASSCO PACP. He is well acquainted with AutoCAD/Civil 3D design features and drawing standards, as well as cut/fill work calculations, site grading and drainage, pipeline networks, corridor design, and importing and integrating topographic maps from GIS, and other survey data.

Conveyance Gravity Storm & Sanitary Sewers Replacement & Rehab* • City of Las Vegas Mr. Natale was responsible for review of CCTV and preparation of a Condition Assessment Report that evaluated pipeline and manhole serviceability per NASSCO guidelines. The condition assessment identified approximately 1,600 LF of 15-inch pipe and 10 manholes that require rehabilitation. It was also identified that a portion of sewer within Cheyenne Avenue will exceed capacity in the near future. The final design for this project included approximately 17,000 LF of 36 and 42-in diameter interceptor sewer to replace the undersized pipeline. He was responsible for preparing the design drawings and report for this project. He was also responsible for preparing calibrating the hydraulic model using Innovyze InfoSWMM software to ensure serviceability beyond the planning horizon of 2062.

Rancho Road System Storm Drain - Elkhorn Project* • City of Las Vegas The City of Las Vegas Rancho Road System Storm Drain - Elkhorn Project (“Project”) includes the design and construction of a storm drain system designated in the 2013 Clark County Regional Flood Control District (CCRFCD) Master Plan as facility RCHB 0295. The regional facility spans approximately 3,008 linear feet (LF) extending from approximately 450 LF west of the intersection of Elkhorn Road and N. Hualapai Way to an existing storm drain located approximately 150 LF west of the intersection of Elkhorn Road and N. Grand Canyon Drive. The Project includes the design and construction of a 7’ x 6’ reinforced concrete box (RCB) storm drain, a transition structure to an existing 6’ x 4’ reinforced concrete arch (RCA), a 12’ x 8’ grated access structure, as well as drop inlets, laterals, and other necessary appurtenances to make a complete, serviceable, and functional flood control system. Mr. Natale served as the Engineer of Record and was directly responsible for preparing all contract documents and provided engineering services during construction.

Reservoir R-08A* • City of Henderson
The City of Henderson Reservoir R-8A Project (“Project”) includes the design and construction of a new potable water reservoir at the existing Reservoir R-8 site near 1750 Equestrian Drive in Henderson, Nevada. The Project includes the design and construction of a new above grade 5 million gallon (MG) pre-stressed concrete reservoir, associated site improvements and piping, reservoir appurtenances, cathodic protection, as well as instrumentation and controls. The new R-8A reservoir will provide increased storage capacity and operational flexibility with the existing 3 MG partially buried R-8 reservoir (if it can be salvaged), as well as with the existing P-8 (2370 Pressure Zone) and P-8A (2500 Pressure Zone) Pumping Stations. The new R-8A Reservoir will also support future storage demands in the 2240 Pressure Zone, should R-8 not return to operation. Mr. Natale served as the Engineer of Record and was directly responsible for preparing the civil design.

Photo Not Yet Available










  
C.4.b
Packet Pg. 47
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 19
Emma Schoenthal, EIT
Associate, Project Engineer

3.5 years with Bellecci
BSCE: University of California, San Diego, Environmental Engineering Emma is a self starter who graduated summa cum laude with a 3.95 GPA from a prestigious University of California school. She was awarded the “Highest Academic Achievement in Environmental Engineering” and earned the John E. Starrett Memorial Scholarship award.

Her software experience includes AutoCAD, MATLAB, Solidworks, 3D Printing and programming for PTC Mathcad and Python. We are thrilled that Emma decided to join our new generation of outstanding academic achievers. Because of Emma’s dependability, outstanding communication and technical skills, she was recently promoted to an Associate.

E. 14th Street Complete Streets • Alameda County PW $17.3M Project Engineer: Project to construct 1 mile of corridor improvements which includes new pavement, a cycle track, widen sidewalks, enhanced crosswalks, bulb-outs, and undergrounding of all utilities. Also included are street tree plantings, improved medians, decorative pavers, and decorative streetlights for Ph. II which includes SR 185.

Contra Costa Blvd. / Taylor Blvd. Complete Streets Imp. • City of Pleasant Hill $5.4M Project Engineer: for complete streets and traffic safety for 0.25 miles of Contra Costa Blvd. (CCB) Major improvements include new Class II buffered bike lanes (both sides),, bicycle detection at signalized intersection, buffered sidewalks, pedestrian level lighting, ADA compliant curb ramps, bus stop improvements, pavement resurfacing, LED street lights, drought‐tolerant landscape, irrigation, and hardscape to match the earlier phases, utility coordination, and obtain an E-76.

Downtown Bike/ Ped. Improvements • City of Concord $3.8M Project Engineer: Features bulbouts, widened sidewalks, ADA ramps, new bike lanes, downtown business coordination, and high visibility crosswalks along one of the busiest City corridors in Concord.

Public Right-of-Way ADA Improvements • City of Santa Clara $8.6M Project Engineer: The Project generally involves removal of barriers to accessibility in the public right-of-way in the near Levi’s Stadium. The work includes concrete sidewalks, curb ramps, driveways,asphalt repairs,pedestrian street crossings, parking lots, landscape areas, rail crossings, traffic signals, and other miscellaneous barriers
Middlefield Rd. Bicycle & Pedestrian Improvements • City of Redwood City $8.06M Project Engineer: The project is a mile of undergrounding and the construction cost estimate for the composite drawings Bellecci has led 28 coordination meetings with representatives from PG&E, AT&T, Comcast, Astound, and the City of Redwood City. She also assisted with the review and preparation of the project specifications.

Stevens Creek Blvd. Quick Build Cycle Track to Apple • City of Cupertino $811k Project Engineer: for project that will construct Improvements for a major regional arterial road including new Class IV bike lanes, intersection bulb‐outs and curb returns, curb ramps, raised buffer island, and signal modifications at three intersections. We developed an innovative pre-cast cycle track island design in conjunction with a leading concrete manufacturer.

Stanton Ave. Complete Street Ph. II • Alameda Co. Public Works $6M Project Engineer: Design services to prepare PS&E for new and replacement sidewalks, curb/ gutter, conforms at existing driveways, new ADA curb ramps, retaining wall improvements, tree planting, storm water area planting, storm water quality (C.3) enhancements and pedestrian access enhancements; including RRFB improvements at mid-block crosswalks.

Project Duties
• Design of Improvements
• Curb Ramp Layout
• Grading & Drainage
• Street Layout
• Public Meeting/s & Support
Appendix: Resumes (Bellecci)










  
C.4.b
Packet Pg. 48
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 20
Anthony Nguyen, EIT
Project Engineer
4 years with Bellecci
BSCE: San Jose State University
Anthony brings a great can-do attitude combined with an engineer’s natural problem solving abilities. While earning his degree in Civil Engineering, he interned at San Jose Mineta Airport where he assisted with updating maps for SJC using ESRI ArcGIS and AutoCAD.

He also interned with the City of Campbell’s Engineering Department and used AutoCAD to create striping plans for street improvement projects. Other experience he gained included working on an application for a street improvement project that earned a Greenroads Silver Certification, and assisted the Land Development Department by working on an update of the City wide GIS Storm Drain Systems mapping.

Stanton Ave. Complete Streets • Alameda County PW $6M
Project Engineer: To prepare PS&E for new / replacement sidewalks, curb/gutter, driveway conforms, new ADA curb ramps, retaining wall improvements, tree planting, storm water area planting, C.3 and pedestrian access enhancements − including RRFB improvements at mid-block crosswalks for Ph. I & II.

E. 5th / Vecino St. Ped Safety Improvements • City of Benicia $520k Project Engineer: for this Fed. funded HSIP Project that will construct new sidewalk and a retaining wall terminating at the I-780 WB off ramp. Two new street lights, a bulb-out with a pedestrian hybrid beacon, striping, and ADA curb ramps at the I-780 on and off ramps are included. The project will require an encroachment permit from Caltrans.

E. 14th Street Complete Streets • Alameda County PW $17.3M Project Engineer: Project to create Class IV bike lanes, widen sidewalks, enhanced crosswalks, bulb-outs, and undergrounding of all utilities. Also included are street tree plantings, improved medians, decorative pavers, and decorative streetlights for Ph. II which includes SR 185.

Third Street Bicycle Corridor/Complete Streets • City of Davis $3.5M Project Engineer: for this downtown gateway to UC Davis. Bellecci was hired to design permeable pavers, urban rain gardens, bioswales, bulbouts, ADA curb ramps, storm drain, sewer, water, gas, joint trench, new sidewalks, and green street drainage.

Avenues 3-1 Utility & Curb Ramps • City of San Bruno $9.5M Project Engineer: Project to create sewer and water main replacements for over 5800 LF of pipes on City easements and between SR 82 (El Camino Real) . Part of the project also includes various curb ramps improvements within the project limits.

Downtown Bike/ Ped. Improvements • City of Concord $3.8M Project Engineer: Features bulbouts, widened sidewalks, ADA ramps, new bike lanes, downtown business coordination, and high visibility crosswalks along one of the busiest City corridors in Concord.

SR 152 at Hecker Pass Roundabout • Private Client (in Gilroy, CA) $1.09M Project Engineer: Bellecci was selected to design, and help guide this roundabout design through the regional Caltrans office. Now that this project is completed, the public can enjoy this modern roundabout and the more efficient flow of traffic through this busy corridor. The project also included close coordination with the City of Gilroy’s engineering department.

Project Duties
• Base Mapping / Drafting
• Street Layout
• Utility Coordination
• Notification to Utility Co’s
• Specifications
• Technical/Admin. Assistance
Appendix: Resumes (Bellecci)










  
C.4.b
Packet Pg. 49
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 21
Ryan Boyer
Assistant Engineer
3 years with Bellecci
BSCE: Brigham Young University, Idaho
Ryan is an experienced public works engineer who previously worked as a direct employee for the City of Livingston, CA. While employed for the Central Valley City, he prepared plans and specifications for City CIP projects, staff reports for the City council, and assisted with plan check reviews, project management, and verifying labor compliance requirements were met. His background also includes preparing improvement plans for pipelines, hydrants, services, and other water system facilities in both AutoCAD and Microstation.

Middlefield Rd. Bicycle & Pedestrian Improvements • City of Redwood City $8.06M Project Engineer: The project is a mile of undergrounding and the construction cost estimate for the composite drawings Bellecci has led 28 coordination meetings with representatives from PG&E, AT&T, Comcast, Astound, and the City of Redwood City. She also assisted with the review and preparation of the project specifications.
2018 Street Maintenance Project • City of Millbrae $992k bid Project Engineer: Worked on design for 12 citywide streets featuring asphalt concrete pavement repairs (0.5’ Deep), crack & slurry seal, 2” AC grind & 2” overlay, green bike lanes, sharrow striping, high-vis crosswalks, new street signs/poles.

Skyline Boulevard Slide Repair • City of Millbrae $410k Project Engineer: Worked on cost estimates and design for rock rip rap and reinforced earth slope repair options to repair a slide repair on Skyline Boulevard near the NB on ramp for Highway 280.

Design elements for this project include excavation, import of soil, and AC swale design, stabilization fabric, rock riprap, drain inlet, and 12” & 4” SDR pipe. 2019 Pavement Rehab Project • City of San Carlos $2.03M Project Engineer: Worked on design for street maintenance (7 locations) and repairs at 8 different sites. The construction work to be done includes: 2.25” AC grind, asphalt concrete base repairs (6”), AC inlay, AC digouts, replace PCC curb & gutter, ramps, sidewalks, valley gutters, striping, remove and replace detector loops, school crossing stripping/speed humps.

Downtown Bike/ Ped. Improvements • City of Concord $3.8M Project Engineer: Features bulbouts, widened sidewalks, ADA ramps, new bike lanes, downtown business coordination, and high visibility crosswalks along one of the busiest City corridors in Concord.

Mission Blvd. Complete Streets/R20, Ph. III • Alameda County PW $25M Professional Engineer: Project on a busy county corridor that connects I-238 and E.14th St. Scope includes PG&E base files, utility letters, JT Intent layouts, vaults, CAD, PG&E/ county coordination — she also has provided project management assistance.

City CIP Projects • City of Livingston, CA* various
Assistant Engineer: Worked on multiple project as a direct hire employee for this Central Valley City. Specific experience included preparation of PS&E for City CIP projects, staff reports for the City council, and assistance with plan check reviews. He also verified that labor compliance requirements were met for relevant projects.
* Experience from prior to joining Bellecci & Associates Project Support Duties
• Drafting
• Street Layout
• Design of Dry | Wet Utilities
• Plan & Profiles
• Technical/Administration Assistance
Appendix: Resumes (Bellecci)










  
C.4.b
Packet Pg. 50
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 22
Alexander Fong, PLS
Professional Land Surveyor, Survey Manager
28+ years experience • 28 years with Bellecci
LS License: CA 9252
Alex  is a Professional Land Surveyor with 25+ years of broad experience in boundary resolution, topography, GPS control  and construction surveying.  Alexander  has been in-charge of  the union field survey crews  and has been the primary surveyor preparing all of Bellecci’s survey maps. He is well known in the industry for skillfully coordinating between owners, contractors and builders for deadlines during all phases of the projects; from up-front mapping to final construction staking. Next to Frank Bellecci, Alex is perhaps the person who knows the City of Brentwood best. This is because he has been working on projects in the City for over two decades and has been the main contact on our existing On-Call survey contract with Brentwood.

Misc. Survey Projects • City of Brentwood ($ various)
Survey Manager: He has been involved with over two dozen survey projects for the City of Brentwood for the past three decades. He has Bellecci’s surveying efforts for: construction staking, corner record, legals / plats, parcel mergers, and topographic surveys. 2017 Pavement Rehab/Repair • City of Millbrae $2.2M
Survey Manager: Led topo & field surveying for pavement rehabilitation of 10 City streets that provided pavement base repairs, 2” pavement grinding, 2” overlay, new ADA curb ramps, sidewalk, curb, & gutter repairs. Bellecci also provided CM & inspection services for the project.

No. 6th & Solano Ave. Pave Rehab • City of Concord $2.4M Survey Manager: Led topo & field surveying to remove & replace asphalt, concrete pavement, construct ADA ramps, installation of storm drain pipe & inlets, & bikeway striping.

E. 14th Street - 1 Mile Pavement Rehab • Alameda County PW $17.3M Survey Manager: Led topo & field surveying to widen sidewalks, enhanced crosswalks, bulbouts, & undergrounding of all utilities. Also included are street tree plantings, improved medians, decorative pavers, & decorative streetlights. He created the topographic map for this project. 2015-16 Overlay Topo Survey • City of San Leandro $2.3M Survey Manager: Annual pavement overlay project. The survey scope covered 15 streets totaling approx. 11,079 LF & included over 3300 points & six field days for the survey crew. Alex oversaw creation of the topographic survey base map.

Fairmont Ave. (Arterial) Green Bike Lanes/Pave Rehab • Alameda County PW $2M Survey Manager: Bellecci designed 1-mile of pavement rehabilitation and a half a mile of pedestrian/ bicycle improvements along this high traffic volume County arterial. Bellecci prepared a life cycle cost analysis (LCCA) prior to the 35% submittal. The recommended solution for Fairmont Avenue was pavement repair areas (digouts) with a rubberized cape seal. The project scope of work included obtaining a Caltrans Encroachment Permit, signal modifications, curb ramps, signal cameras, Class 2 green bike lanes.

Campanile Way Pavement Rehab • UC Berkeley $1.3M
Survey Manager: Bellecci completed the pavement rehabilitation design for this historical road in approximately two months. Bellecci arranged for design pavement corings to be performed during the weekend while Spring semester was underway, to minimize impacts to the students and University staff. Bellecci created 90% / 100% plans topographic surveying and base mapping for this road.

Project Duties
• Survey Manager
• Manage and Schedule Survey Crew
• Oversee basemap development
• Resolved Field Survey Data
• Locate Property Lines
• Records Search
• Topographic survey of collected field data
• QA/QC
Appendix: Resumes (Bellecci)










  
C.4.b
Packet Pg. 51
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 23
Appendix: Resumes (Subconsultants)

 

 



);<-:
7.
$+1-6+-
1>14
6/16--:16/

&61>-:;1<A
7.
)41.7:61)
)<
-:3-4-A



)+0-47:
7.
$+1-6+-
1>14
6/16--:16/

&61>-:;1<A
7.
)41.7:61)
)<
-:3-4-A




 



1+-6;-,
1>14
6/16--:
$<)<-
7.
)41.7:61)




1+-6;-,
%:)..1+
6/16--:
$<)<-
7.
)41.7:61)








6;<1<=<-
7.
%:)6;87:<)<176
6/16--:;

5-:1+)6
!4)6616/
;;7+1)<176

5-:1+)6
$7+1-<A
7.
1>14
6/16--:;

(75)6E;
%:)6;87:<)<176
$-516):

 

• %:)6;87:<)<176
!4)6616/
)6,
58)+<

6)4A;1;
.7:
->-4785-6<;
$8-+1.1+
!4)6;

);<-:
!4)6;
)6,
-6-:)4
!4)6;

• $


584-5-6<)<176

• %:)6;1<
$A;<-5
!4)6616/
)6,
-;1/6

• 7::1,7:
$<=,1-;

• %:)..1+
)6,
%:)6;1<
)+141<A
!4)6616/
)6,

6/16--:16/

• %:)..1+
$1/6)4
)6,

1/0<16/
-;1/6

• !-,-;<:1)6
)6,
1+A+4-
!4)6616/
)6,
-;1/6

• %:)..1+
8-:)<176;
6)4A;-;
.7:
#7),?)A

6.:);<:=+<=:-
!:72-+<;




144
0);
57:-
<0)6


A-):;
7.
-@8-:1-6+-
16
<0-
84)6616/
)6,
,-;1/6
7.
<:)6;87:<)<176
;A;<-5;


:-/1;<-:-,
1>14
)6,
%:)..1+
6/16--:
01;
-@8-:1-6+-
:)6/-;
.:75
<:)6;87:<)<176
84)6616/
;<=,1-;
7.
:-/176?1,-
;1/61.1+)6+-
<7
<0-
84)6616/
)6,
,-;1/6
7.
158:7>-5-6<;
<7
47+)4
16<-:;-+<176;
)6,
:7),?)A;

144
0);
8:-8):-,
<0-
<:)6;87:<)<176
)6,
+1:+=4)<176
;-+<176;
.7:
6=5-:7=;
-6>1:765-6<)4
,7+=5-6<;
16+4=,16/
-6>1:765-6<)4
);;-;;5-6<;
51<1/)<-,
6-/)<1>-
,-+4):)<176;
-6>1:765-6<)4
158)+<
:-87:<;
#;
)6,
-6>1:765-6<)4
158)+<
;<)<-5-6<;
$;
)6,
1;
),-8<
)<
-6;=:16/
<0)<
158)+<;
):-
1,-6<1.1-,
)6,
<0)<
51<1/)<176
5-);=:-;
):-
),-9=)<-4A
),,:-;;-,
144E;
:-+-6<
?7:3
16
6<17+0
16+4=,-;
<0-
#7,,A
#)6+0
#-,->-4785-6<
4*-:;
#)6+0
%
$)6

)+16<7
!4)B)
++-;;
$<=,A
)6,
-4<)
)1:

8):<5-6<;
<:)6;87:<)<176
);;-;;5-6<
-
0);
;1/61.1+)6<
-@8-:1-6+-
?7:316/
76
7=;16/
4-5-6<
)6,
$


584-5-6<)<176
8:72-+<;
)6,
1;
+=::-6<4A
4-),16/
<0-

.1:5E;
?7:3
76
<0-;-
1<-5;
.7:
<0-
1<A
7.
!4-);)6<76


 


!)-
%

$)!%
%*(!$

"
#
$)
&
)

$




#&"
#
$))!%$

144
;
+=::-6<4A
;-:>16/
);
8:72-+<
5)6)/-:
.7:
<0-
1<A
7.
6<17+0E;
7=;16/
4-5-6<
&8,)<-
)6,
$


584-5-6<)<176
8:72-+<

-0:

!--:;
1;
;-:>16/
);
<0-
<:)6;87:<)<176
+76;=4<)6<
8:-8):16/
<0-
<-+061+)4
)6)4A;1;
;=887:<16/
<0-
1<AE;
=8,)<- <7
<0-
-6-:)4
!4)6E;
7=;16/
4-5-6<
;
8):<
7.
<01;
?7:3
<0-
.1:5
1;
8:-8):16/
)6)4A;1;
;=887:<16/
<0-
,->-4785-6<
7.
07=;16/
84)6;
)6,
8:7/:)5;
<0)<
?144
:-;=4<
16
*-6-.1+1)4
'
%
7=<+75-;
6
)
;-8):)<-
*=<
4163-,
81-+-
7.
?7:3
-0:

!--:;
1;
8:-8):16/
<0-
)6)4A;1;
)6,
=8,)<-;
<7
<0-
1<AE;
<:)6;87:<)<176
/=1,-416-;
.7:
<0-
.=44
1584-5-6<)<176
7.
$


)6,
<0-
=;-
7.
'
%
<7
->)4=)<-
8:72-+<;
?1<016
<0-
+1<A

'
$),%%

)
!

"

 %%"

'
$),%%




144
?);
8:72-+<
5)6)/-:
.7:
<0-
;1<-
;-4-+<176
)6,
->)4=)<176
;<=,A
8-:.7:5-,
<7
47+)<-
)6,
,-;1/6
)
.7=:<0
51,,4-
;+0774
16
:-6<?77,
)41.7:61)
%0-
;<=,A
->)4=)<-,
<0-
)57=6<
7.
>-01+4-
*=;
*1+A+4-
)6,
8-,-;<:1)6
<:)..1+
<0)<
?7=4,
*-
/-6-:)<-,
*A
<0-
;+0774
)6,
07?
>):17=;
;1<-;E
<:)6;87:<)<176
16.:);<:=+<=:-
?7=4,
;=887:<
<0-
8:72-+<
&4<15)<-4A
)
;1<-
?);
;-4-+<-,
)6,
-0:

!--:;
?7:3-,
?1<0
<0-
8:72-+<
<-)5
<7
,->-478
)
;).-
)6,
-..-+<1>-
;1<-
84)6
)6,
)++-;;
;A;<-5
<7
;=887:<
<0-
)6<1+18)<-,
)+<1>1<A
4->-4











  
C.4.b
Packet Pg. 52
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 24
Appendix: Resumes (Subconsultants)

 


 






  




%',)036
3*
!'-)2')
-:-0
2+-2))6-2+

%0-*362-%
30=8)',2-'
!8%8)
#2-:)67-8=
!%2

9-7

&-743








-:-0
2+-2))6
!8%8)
3*
%0-*362-%








• "6%**-'
!-+2%0
)7-+2

• 3%(;%=

-+,8-2+

• 3%(;%=
!-+2%+)
%2(
!86-4-2+

• 32')489%0
)7-+2
%2(
378
78-1%8-32

• "6%**-'
14%'8
2%0=7-7

• -'='0)
%2(
)()786-%2
0%22-2+

)7-+2

• ")1436%6=
"6%**-'
328630
0%27




%6/
.3-2)(
),6

))67
%*8)6
'3140)8-2+
,-7
'300)+)
)(9'%8-32
%8
%0-*362-%
30=8)',2-'
!8%8)
#2-:)67-8=
-2
!%2

9-7

&-743
)
;%7
(6%;2
-283
86%274368%8-32

)2+-2))6-2+
&)'%97)
3*
8,)
438)28-%0
83
-1463:)
8,)
&9-08
)2:-6321)28
%2(
83
730:)
)<'-8-2+
%2(
'3140)<
463&0)17
)
,%7
;36/)(
32
%
:%6-)8=
3*
463.)'87
7-2')
.3-2-2+
),6

))67
+%-2-2+
)<4)6-)2')
%2(
-28)6)78
-2
()7-+2
%2(
34)6%8-327
%2%0=7-7







-&,0-,
/'3#

-01!-
+./-3#+#,10
/$$'!
#0'%,
#/3'!#0
*#0,1-,



%6/
7)6:)(
%7
8,)
63.)'8

%2%+)6
463:-(-2+
)2+-2))6-2+
()7-+2
7)6:-')7
83

%''3113(%8)
8,)
463437)(
378'3
():)0341)28
-2
0)%7%2832
%0-*362-%
",)
;36/
-2'09()(
()7-+2
3*
8,6))
2);
86%**-'
7-+2%07
786))8
0-+,8-2+
"!
%2(
*-&)6
348-'
7-+2%0
-28)6'322)'8
%2(
7-+2%+)
%2(
786-4-2+
40%27
$)
;-00
%073
463:-()
'327869'8-32
7944368
(96-2+
'327869'8-32

-,2+#,1
*00

1&
6

#0'%,
#/3'!#0
-,!-/"
 

%6/
-7
7)6:-2+
%7
8,)
63.)'8

%2%+)6
*36
8,)
4%8,;%=
0-+,8-2+
%2(
7-+2%0

13(-*-'%8-327
!
7)6:-')7
*36
%
'0%77

&-/);%=
%032+
3291)28
390):%6(
-2

32'36(
%0-*362-%
),6

))67
%073
6)*-2)(
8,)
-28)67)'8-32
'32')48
*36
)%',
-28)67)'8-32
6):-);-2+
0%2)
'32*-+96%8-327
'322)'8-327
43-287
*36
86%-0
97)67
%2(
86%**-'
7-+2%0
4,%7-2+
*36
8,)
8;3
-28)67)'8-327
%032+
8,)
'366-(36
",-7
-2'09()(
13()0-2+
3*
86%**-'
34)6%8-32
-2
!=2',63
!-186%**-'
92()6
)<-78-2+
%2(
;-8,
463.)'8

'32(-8-327

*3#0
,!&
6
'%,*
#0'%,
#/3'!#0
'110 2/%



%6/
-7
7)6:-2+
%7
8,)
63.)'8

%2%+)6
*36
),6

))67
)**3687
-2
463:-(-2+

86%274368%8-32
)2+-2))6-2+
()7-+2
7)6:-')7
83
%((6)77
8,)
86%**-'6)0%8)(
1-8-+%8-32
1)%796)7
()8%-0)(
-2
8,)
32(-8-327
3*
4463:%0
*36
8,)
0:)7
%2',
40%22)(
():)0341)28
",)
;36/
-2'09()(
7-+2%0
13(-*-'%8-327
%8
32)
7-+2%0
7-+2%0
8-1-2+
7944368
%2(
'327869'8-32
7944368











  
C.4.b
Packet Pg. 53
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 25
Appendix: Resumes (Subconsultants)

 



























 
%98
"/8
4938/.
311=
+<.9=+
==9-3+>/=

8-
38


+8.
3=
+
</13=>/</.
:<90/==398+6

/8138//<


/
2+=
9@/<


C/+<=
90
/B:/<3/8-/
+=
+
=><?->?<+6
/8138//<
+8.
2+=
,//8
38@96@/.
38
>2/
./=318
90
8?7/<9?=
,<3.1/=
+8.
9>2/<
380<+=><?->?</
>C:/
=><?->?</=
>2<9?129?>
+6309<83+


3=
:<94/->
7+8+1/7/8>
+8.
./=318
/B:/<3/8-/
38-6?./=
,9>2
:?,63-
A9<5=
+8.
:<3@+>/
./@/69:7/8>
>C:/
:<94/->=
09<
:6+88381
=>?.3/=

@+6?/
/8138//<381
:<94/->=
>2/
-97:6/>/
#&
90
8/A
=><?->?</
37:<9@/7/8>=
+=
A/66
+=
A3./8381=

</><903>=
90
/B3=>381
=><?->?</=
+8.
90>/8
-98=><?->398
/8138//<381
=/<@3-/=
38-6?.381
-98=><?->398
$
$
+8.
-98=><?->398
7+8+1/7/8>


#!

!
%


)8)
7<6;@

;795
)5)/-
-8)19

!+:+
9?8>C


&><?->?<+6
98=?6>+8>
6/.
+8.
7+8+1/.
>2/
:/<09<7381
&3>/
+7+1/
==/==7/8>
98-/:>?+6
#<94/->
#<91<+7381
/=318
8138//<381
98=><?->398

8=:/->398=
98=><?->398
+8+1/<

9@/<=//381
>2/
=><?->?<+6
./=318
90
>2/
</>+38381
A+66=
+8.
>2/
-98=><?->398
7+8+1/7/8>
-98=><?->398
38=:/->398=
+8.
=:/-3+6
38=:/->398=
.?<381
>2/
./=318
+8.
-98=><?->398
90
=3B
/7/<1/8-C
<9+.A+C
=63./
</:+3<
:<94/->=
A23-2
38-6?./.
=96.3/<
:36/
</>+38381
A+66
+8.
1<+./
,/+7
98



:36/
09?8.+>398
=69:/
=>+,363D+>398
=><?->?</=
+=
A/66
+=
<9+.A+C
+8.
=69:/
</2+,363>+>398
'2/
=-9:/
38-6?./.
+==3=>381
!+:+
9?8>C
A3>2
=><?->?<+6
./=318
=/<@3-/=
+8.
-98=><?->398
7+8+1/7/8>
7983>9<381
+8.
38=:/->398
+=
A/66
+=
-99<.38+>398
+8.
9@/<=312>
90
>2/
7+>/<3+6
>/=>=
</;?3</.
,C
 
 *
+8.
+6><+8=

&/<@3-/
.+>/=




E





)8)
7<6;@
91,/-
-84)+-5-6;

972-+;:


!+:+
9?8>C


/.
+8.

7+8+1/.
>2/
-97:6/>/
:<94/->
./=318
/8138//<381
=/<@3-/=
09<
>2/
</:6+-/7/8>
90
>2<//
/B3=>381
9?8>C
,<3.1/=
>2+>
2+@/
,//8
>+11/.
+=
=><?->?<+66C
./03-3/8>
+8.
0?8->398+66C
9,=96/>/
'2/
,<3.1/=
38-6?./
236/=#9:/
)+66/C
%9+.
<3.1/
9@/<
236/=
<//5
<C
<//5
%9+.
<3.1/
9@/<
<C
<//5
+8.

+<8/>>
<//5
<3.1/
+>

<//8A99.
@/


-15-9;
4=,
91,/-
7=-9
)<:)4
9--3
"+56+8.

&><?->?</=
+8+1/<
09<
=/3=73-
</><903>
90
+
23=>9<3-



+<-2
,<3.1/
&/<@3-/=
38-6?./
:</63738+<C
/8138//<381
/8@3<987/8>+6
-6/+<+8-/
+8.
#&
-98=><?->398
.9-?7/8>=
09<
>2/
=/3=73-
</><903>
</./=318
90
>23=
23=>9<3-
,<3.1/
37:6/7/8>381
>2/
:<9:9=/.
+6>/<8+>3@/
</><903>
=><+>/1C
#/<
+6><+8=
</;?3</7/8>=
>2/
</./=318
A366
,/
:/<09<7/.
A3>2
+
>37/23=>9<C
=/3=73-
+8+6C=3=
38
63/?
90
+8
/6+=>3-.C8+73-
=/3=73-
+8+6C=3=
7/>29.

79;0
8916/
;9--;
$1,-616/
)6,
-0)*141;);176
9=
81/6/=

#<94/->
+8+1/<
09<
+=8//./.
&><?->?<+6
&?::9<>
&/<@3-/=
>9
=?::6/7/8>
>2/
3>CF=
-98=><?->398
=>+00
09<
>2/
!9<>2
&:<381
&><//>
)3+.?->
*3./8381
+8.
%/2+,363>+>398
#<94/->
'2/
099>
6981
=><?->?</
38-9<:9<+>/=
+


099>
,<3.1/
A3./8381
+8.
=/3=73-
</><903>
90
>2/
/B3=>381
,<3.1/
9@/<
>2/
/><96385
(#%%
><+-5=
+8.
>2/
9=
81/6/=
%3@/<

-4;1-9
7),
91,/-
7=-9
73-4<56-
1=-9


9.3


#<94/->
+8+1/<
09<
>2/

,<3.1/
</:6+-/7/8>
90
>2/
/B3=>381

099>6981
<3@/>/.
=>//6
>2<9?12
><?==
7+38
=:+8
=><?->?</
+8.

0//>
90
-98>38?9?=
7?6>3=:+8
%
=6+,
+::<9+-2
=><?->?</= *3>2
>2/
,<3.1/
8/+<381
>2/
/8.
90
3>=
./=318
630/

./@/69:/.
+
#<94/->
/+=3,363>C
&>?.C
/@+6?+>381
@+<39?=
</2+,363>+>398
+8.
</:6+-/7/8>
+6>/<8+>3@/=
>2+>
4?=>303/.
>9
+6><+8=
>2+>
</:6+-/7/8>
3=
>2/
79=>
-9=>/003-3/8>
+6>/<8+>3@/
>9
:?<=?/
>2<9?12
>2/

#
?8.381
1?3./638/=
'2/

'/+7
3=
89A
/81+1/.
38
038+6
./=318
?=381
>2/
</:6+-/7/8>
+6>/<8+>3@/
 !!


97.-::176)4
6/16--9
1=14







"!


 
1=14
6/16--916/
&+8>+
6+<+
(83@/<=3>C

+6><+8=
%/=3./8>

8138//<
-+./7C

 


!


98=><?->398

+8+1/7/8>
==9-3+>398

90
7/<3-+

7/<3-+8
&9-3/>C
90
3@36

8138//<=

&9?>2
+C
8138//<=

6?,

&-)9:
>1;0




!7;)4
&-)9:
?8-91-6+-












  
C.4.b
Packet Pg. 54
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 26
Appendix: Resumes (Subconsultants)






 


























,
/(:
6=,9


@,(9:
6-
,?7,90,5*,
05
;/,
+,:0.5
6-
;9(5:769;(;0659,3(;,+
:;9<*;<9,:
05*3<+05.
5,>
*65:;9<*;065
9,/()030;(;065
(5+
:,0:40*
9,;96-0;
6-
=(906<:
9(03
)90+.,
:;9<*;<9,:
/0./>(@
)90+.,:
7,+,:;90(5
)90+.,:
9,;(0505.
>(33
(5+
:6<5+>(33
:;9<*;<9,:
6/5
/(:
>692,+
65
5<4,96<:
#(5
9(5*0:*6
(@
9,(
6=,9*96::05.:
<5+,9*96::05.:
(5+
05;,9*/(5.,:
,
(3:6
/(:
,?7,90,5*,
>69205.
>0;/
&$
(5+
(3;9(5:
65
5<4,96<:
7961,*;:









$(+$/1

*3#

/(#&$
-3$/
!20!*

/$$)
(23(5+

!<(30;@
65;963

(5(.,9
-69
;/,

:,0:40*
9,;96-0;
(5+
9,/()030;(;065
6-
(
/0:;690*
(9*/
)90+.,
6=,9
#(<:(3
9,,2
(5+
4<3;0 :7(5
)90+.,
(7796(*/,:
05*69769(;05.
*(:;0573(*,
$),(4:
:<7769;,+
65
),5;:
>0;/
:79,(+
-66;05.:
$/,
:,0:40*
9,;96-0;
05*3<+,:
-0),9
9,05-69*,+
763@4,9
" 
*6476:0;,
*(:05.:
65
;/,
,?0:;05.
*63<45:
(5+
*96::
),(4:
$/,
)90+.,
9,/()030;(;065
05*3<+,:
;/,
9,46=(3
6-
;/,
,?0:;05.

6=,93(@
(5+
9,73(*,4,5;
>0;/
(
763@,:;,9
*65*9,;,
6=,93(@
9,7(0905.
*65*9,;,
:7(33:
9,73(*,4,5;
6-
769;065:
6-
;/,
,?0:;05.
)(990,9
9(0305.
9,73(*,4,5;
6-
1605;
:,(3:
(;
;/,
/05.,:
(5+
73(*,4,5;
6-
:367,
7(=05.
;6
(++9,::
,96:065
*65*,95:
$/,
7961,*;
(3:6
05*3<+,:
9,73(*,4,5;
6-
;/,
*65*9,;,
*9(+3,
:<7769;:
-69
;/,
,?0:;05.
B
>(;,9
305,

'(*$0
-.$

!**$6
-!#

/(#&$
-3$/

'(*$0

/$$)


(7(
6<5;@
 !<(30;@

65;963

(5(.,9
-69
(
;>6:7(5
76:;
;,5:065,+
*65*9,;,
:3()
)90+.,
>0;/
:,(;
()<;4,5;:
:<7769;,+
65
(
;(5.,5;
703,
9,;(0505.
>(33
>0;/
:63+0,9
703,:
6<9
;(5.,5;
703,
9,;(0505.
>(33:
>0;/
:63+0,9
703,:
>,9,
(3:6
9,8<09,+
(;
(33
-6<9
)90+.,
*695,9:

/6

/$$)
-!#

/(#&$
-3$/

/6

/$$)


(7(
6<5;@
 !<(30;@
65;963

(5(.,9
-69
(
:05.3,:7(5
)90+.,
05*69769(;05.
79,*(:;
79,:;9,::,+
*65*9,;,
>0+,
-3(5.,
.09+,9:
>0;/
(
*65*9,;,
+,*2
$/,
()<;4,5;:
05*69769(;,
:,(;,+
()<;4,5;:
:<7769;,+
65
(

703,
-66;05.
;/(;
0:
+,:0.5
-69
:*6<9

$//6$00!

/$$)

/(#&$
$.*!"$+$,1
!1
-,1!&2$
5./$004!6

0370;(:


961,*;

5.05,,9
-69
;/,
+,:0.5
(5+
*65:;9<*;065
:,9=0*,:
-69
(
)90+.,
9,73(*,4,5;
:;9<*;<9,
;>6
-366+>(33:
(5+
5<4,96<:
9,;(0505.
>(33:
9,8<09,+
;6
9(0:,
;/,
796-03,
.9(+,
6-
65;(.<,

?79,::>(@
(7796?04(;,3@
-,,;
(;
,99@,::(
9,,2

$/,
)90+.,
9,73(*,4,5;
:;9<*;<9,
*65:0:;:
6-
(
-66;
365.
)@
-66;
>0+,
:0473,:7(5
*(:;0573(*,
*65*9,;,
:3()
:<7,9:;9<*;<9,
:<7769;,+
65
+0(7/9(.4
()<;4,5;:
(5+
79,*(:;
*65*9,;,
+90=,5
703,:
(;
;/,
()<;4,5;:

$/,
)90+.,
>033
),
*65:;9<*;,+
05
;/9,,
:;(.,:
;6
-(*030;(;,
;9(--0*
67,9(;065:
(365.

65;(.<,
?79,::>(@


$*1($/
-!#

/(#&$
-3$/
-)$*2+,$
(3$/


6+0


#;9<*;<9,:

(5(.,9
-69

;/,
)90+.,
9,73(*,4,5;
6-
;/,
,?0:;05.

-66;
365.
90=,;,+
:;,,3
;/96<./
;9<::
4(05
:7(5
:;9<*;<9,
(5+

-,,;
6-
*65;05<6<:
4<3;0:7(5
"
:3()
(7796(*/
:;9<*;<9,


79,30405(9@
;,*/50*(3
:;<+@
>(:
+,=,367,+
,=(3<(;05.
;/,
=(906<:
(3;,95(;0=,:
>0;/05
;/,

-<5+05.
.<0+,305,:

2*!/$

-2,16

/(#&$
$.*!"$+$,10

!*"'
!/)
-!#
!,#
-!#

 


$<3(9,
6<5;@

!<(30;@
65;963

5.05,,9
-69
;/,
9,73(*,4,5;
6-
;>6
-<5*;065(33@
6):63,;,
)90+.,:
05
$<3(9,
6<5;@
(;
(3*/
(92
"6(+
(5+
"6(+
 
6;/




/-%$00(-,!*
,&(,$$/

(3(*

 








(3(*
,&(,$$/(,&


#(5
6:,
#;(;,
%50=,9:0;@









4,90*(5
#6*0,;@

6-
0=03
5.05,,9:




4,90*(5
<)30*

'692:
::6*0(;065




#6<;/
(@

$9(5:769;(;065
--0*0(3:

::6*0(;065




#6<;/
(@

5.05,,9:C
3<)

$!/0
4(1'

-1!*
$!/0
5.$/($,"$











  
C.4.b
Packet Pg. 55
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 27
Appendix: Resumes (Subconsultants)


 




























02/03
0:
(
9,.0:;,9,+
!96-,::065(3
5.05,,9
(5+
"<(30-0,+
$'!!!
,=,367,9
05
(30-6950(
02/03B:
9,:765:0)030;0,:
05*3<+,
3(@6<;
6-
:;9<*;<9(3
+9(>05.:
:;9<*;<9(3
+,:0.5
(5+
(5(3@:0:
796+<*;065
6-
*65;9(*;
+6*<4,5;:
05=63=,4,5;
05
*669+05(;065
0::<,:
>0;/
6;/,9
*65:<3;(5;:
:<7,9=0:065
6-
+9(-;:4,5
(5+
9,=0,>
6-
6;/,9
,5.05,,9B:
>692
-69
05 /6<:,
8<(30;@
*65;963
,
/(:
6=,9

@,(9:
6-
,?7,90,5*,
05
*65:;9<*;065
4(5(.,4,5;
(5+
,5.05,,905.
+,:0.5












$%'!-
*+!

''!1
*

,% #!
*0!,
$%'!-
,!!&


(7(
6<5;@

!961,*;

5.05,,9
-69
(
;>6:7(5
76:;
;,5:065,+
*65*9,;,
:3()
)90+.,
>0;/
:,(;
()<;4,5;:
:<7769;,+
65
(
;(5.,5;
703,
9,;(0505.
>(33
>0;/
:63+0,9
703,:
6<9
;(5.,5;
703,
9,;(0505.
>(33:
>0;/
:63+0,9
703,:
>,9,
(3:6
9,8<09,+
(;
(33
-6<9
)90+.,
*695,9:

,1
,!!&
*

,% #!
*0!,
,1
,!!&


(7(
6<5;@

!961,*;
5.05,,9
-69

(
:05.3,:7(5
)90+.,
05*69769(;05.
79,*(:;
79,:;9,::,+
*65*9,;,
>0+,
-3(5.,
.09+,9:
>0;/
(
*65*9,;,
+,*2
%/,
()<;4,5;:
05*69769(;,
:,(;,+
()<;4,5;:
:<7769;,+
65
(
 

703,
-66;05.
;/(;
0:
+,:0.5
-69
:*6<9

,)!..
,!!&
,% #!
!+'
!(!).


(7(
6<5;@


!961,*;
5.05,,9
-69
;/,

9,73(*,4,5;
6-
(95,;;
9,,2
90+.,
;/(;
/(:
),,5
;(..,+
(:
:;9<*;<9(33@
+,-0*0,5;
(5+
-<5*;065(33@
6):63,;,
#,:765:0)030;0,:
05*3<+,
79,7(905.
73(5:
:7,*0-0*(;065:
(5+
,:;04(;,:
!$
79,7(905.
;@7,
:,3,*;065
9,769;
(5+
*669+05(;05.
>0;/
:<) *65:<3;(5;:
(5+
6;/,9
+0:*07305,:

!%(!,.
'0
,% #!
*0!,

/-
'
,!!&
(23(5+

$;(--
5.05,,9
-69
:,0:40*
9,;96-0;
6-
(
/0:;690*


(9*/
)90+.,
$,9=0*,:
05*3<+,
79,30405(9@
,5.05,,905.
,5=09654,5;(3
*3,(9(5*,
(5+
!$
*65:;9<*;065
+6*<4,5;:
-69
;/,
:,0:40*
9,;96-0;
9,+,:0.5
6-
;/0:
/0:;690*
)90+.,
0473,4,5;05.
;/,
79676:,+
(3;,95(;0=,
9,;96-0;
:;9(;,.@
!,9
(3;9(5:
9,8<09,4,5;:
;/,
9,+,:0.5
>033
),
7,9-694,+
>0;/
(
;04,/0:;69@
:,0:40*
(5(3@:0:
05
30,<
6-
(5
,3(:;0*+@5(40*
:,0:40*
(5(3@:0:
4,;/6+

!'.%!,
*

,% #!
*0!,
*&!'/()!
%0!,



6+0


!961,*;
5.05,,9
-69
;/,

)90+.,
9,73(*,4,5;
6-
;/,
,?0:;05.

-66;365.
90=,;,+
:;,,3
;/96<./
;9<::
4(05
:7(5

:;9<*;<9,
(5+

-,,;
6-
*65;05<6<:
4<3;0:7(5
#
:3()
(7796(*/
:;9<*;<9,:


79,30405(9@
;,*/50*(3
:;<+@
>(:
+,=,367,+
,=(3<(;05.
;/,
=(906<:
(3;,95(;0=,:
>0;/05
;/,
!
<5+05.
.<0+,305,:

%.1
*"
*/.$

)

,
)%-*
,% #!
,!0!).
.%0!

%).!)
)!
,*#,
(
$6<;/
$(5
9(5*0:*6
(30-6950(
!961,*;
5.05,,9

796=0+05.
:;9<*;<9(3
+,:0.5
,5.05,,905.
-69

)90+.,:
05
;/,
0;@
6-
$6<;/
$(5
9(5*0:*6
<5+,9
;/,
(3;9(5:B
90+.,
!9,=,5;(;0=,
(5+

(05;,5(5*,
!96.9(4
!
!
:
(
7(9;
6-
;/,:,
:,9=0*,:
0..:
(9+6:(
::6*0(;,:
,=(3<(;,+
;/,
0;@B:
796.9(44,+
!
!
>0;/
;/,
(3;9(5:

#
$
4(05;,5(5*,
9,769;:
(5+
7,9-694,+
(
-0,3+
9,=0,>
(::,::4,5;
;6
*65-094
;/,
*6473,;,5,::
6-
;/,
30:;,+
+,;,9069(;065
9,*644,5+(;065:

(5+
79676:,+
9,7(09:
79069
;6
79,7(905.
;/,
$$
! !
%
!

<7+(;,
9,8<,:;
+6*<4,5;(;065


%/,
79,=,5;(0=,
>692
.,5,9(33@
*65:0:;:
6-

9,7(09
*9(*2:
05
)90+.,
:6--0;:
*65*9,;,
703,:
70,9
>(33:
(5+
()<;4,5;:


*3,(505.
(5+
7(;*/05.
*65*9,;,
:7(33:


+,*2
;9,(;4,5;


1605;
:,(3
9,73(*,4,5;
(5+



-03305.
=60+
<5+,9
;/,
:;9<*;<9,
(7796(*/
:3()
(5+
:0+,>(32
9,7(09





,*"!--%*)
'

)#%)!!,


%0%'


 


"<(30-0,+
$'!!!

,=,367,9

 


*),!.!

%!'
!-.%)#

!$)%%
)
A
9(+,




.,/./,
'

)#%)!!,%)#
&50=,9:0;@
6-
(30-6950(
$(5

0,.6



%0%'

)

)0%,*)(!).
'

)#%)!!,%)#

&50=,9:0;@
6-
(30-6950(
(=0:



























  
C.4.b
Packet Pg. 56
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 28
Sunnyvale, City of
Hendy Avenue Complete Street & Pavement Rehab
• 2016 APWA Silicon Valley Project of the Year (Transportation $2M–$5M) Orchard Gardens Park Expansion *
• 2016 APWA Silicon Valley Honor Award (Environmental/Parks <$2M) University of California, Berkeley
CA Memorial Stadium Seismic Renovation *
• “Best of the Best Projects” - Engineering News & Record: 2013 • ENR Best Sports/Entertainment Project: 2013
• SCUP/ AIA Excellence In Architecture, Honor Award: 2013 • Berkeley Design Advocates Biennial Award For Design Excellence Vallejo, City of
Downtown Streetscape Phase I–III (10+ Blocks)
• Solano Transportation Authority, TLC Award: 2013
*Bellecci was the Civil/Survey subconsultant
Belmont, City of
Belmont Pavement Rehabilitation 2015
• 2016 APWA Silicon Valley Project of the Year (Sustainable/Green $2M–$5M) Burlingame, City of
Burlingame Avenue Streetscape Project *
• 2015 APWA Silicon Valley Project of the Year (Sustainable/Green $5M−$25M) Easton Addition | Ray Park Sewer Rehab CM- PhII
• APWA Silicon Valley 2018 Project of the Year (Utilities <$2M) Concord, City of
Ellis Lake Park New Playground and Restrooms
• 2018 APWA Northern CA (Structures <$5M)
Davis, City of
Third Street Corridor/Complete Streets Project *
• 2019 APWA Sacramento Project of the Year (Transportation/Streetscape) El Cerrito, City of
San Pablo Ave. (SR 123) Rain Gardens & Streetscape: 2012 * • 2012 ICMA Program Excellence Award In Community Sustainability Santa Clara, City of
San Tomas Expressway & Monroe Street Park Project *
• 2019 APWA Silicon Valley Project of the Year (Environmental/ Parks ) Burlingame Avenue Streetscape APWA Silicon Valley Project of Year (Sustainable/Green) Appendix: Awards










  
C.4.b
Packet Pg. 57
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 29
Appendix: Qualification Letters










  
C.4.b
Packet Pg. 58
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 30
Appendix: Qualification Letters
February 23, 2022
Daniel Leary, PE
Bellecci & Associates
7077 Koll Center Parkway, Suite 210
Pleasanton, CA 95566
Subject: Request for Qualifications, RFQ No. ROA20211095 On-Call Civil Engineering, Environmental, and Right of Way Professional Services
Dear Mr. Leary:

This is to inform you that Bellecci & Associates and its associated consultant team has been selected to be offered a contract to provide on-call professional services to the Alameda County Public Works Agency.

We are reviewing your proposal and preparing a draft of the Professional Services Agreement contract for your review. Please contact Amber Lo, Project Manager, at 510-670-5485, or email at [email protected] at your convenience to schedule a meeting with representatives of your firm to negotiate terms of the contract.

You may contact me at 510-670-5569, or email at [email protected], if you have any questions.

We look forward to working with you and your consultant team.

Yours truly,
Anita Franklin
Anita Franklin
Contract Administrator











  
C.4.b
Packet Pg. 59
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 31
Appendix: Qualification Letters
.HQ%DUWRQ
6XEMHFW
):
3:DQG3:6WDWHPHQWRI4XDOLILFDWLRQV
&ƌŽŵ͗Argand,Edrees<[email protected]>
^ĞŶƚ͗Tuesday,November02,20214:17PM
dŽ͗RobertBroestl<[email protected]>
Đ͗Buenting,Scott<[email protected]>;Medeiros,Lori<[email protected]> ^ƵďũĞĐƚ͗P.W.700Ͳ1andP.W.700Ͳ2StatementofQualifications HiRobert,
WewouldliketocongratulateyouthatwehavechosenBellecci&AssociatesforourOnͲCallProfessionalCivil EngineeringDesignServicesandOnͲCallLandSurveyingServices.Wearecurrentlyputtingtogetherbothcontractsfor AsͲNeededservices.
Regards,
Edrees Argand
Assistant Engineer | Capital Improvements Division

: (925) 779-6130
ᏟᏠᏡᏢᏣᏤᏥ: (925) 250-7549

: www.antiochca.gov
Public Works Department | 200 ‘H’ Street, Antioch, CA 94509-1005 









  
C.4.b
Packet Pg. 60
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 32
Appendix: Qualification Letters
November 17, 2021
Bellecci & Associates, Inc.
7077 Koll Center Parkway, Ste.210
Pleasanton, CA 94566
Attn: Daniel Leary
RE: Statement of Qualifications for Civil Engineering Consultant Services Thank you for submitting a Statement of Qualifications (SOQ) in response to the City of Cupertino's Request for Qualifications (RFQ) issued October 1, 2021, for Civil Engineering Consultant Services.

The City has reviewed your SOQ and is pleased to inform you that your firm has been placed on a list of firms that are deemed eligible to provide civil engineering services on City projects for the next two years. No further action is required on your part. The City is currently reviewing Capital Improvement Project schedules for this fiscal year and a project manager may contact you directly with specific project information once this year's project list is finalized.

Occasionally, if required for a specific project, the City may request that your firm participate in an interview so we may discuss specific firm capabilities that would result in a best fit for the project. Otherwise, the City project management team will select a consultant off the list that, in their opinion, would best fit a specific project based on the information you've already provided in the SOQ.

Should you have questions, please contact me at (408) 777-3100 or via email at [email protected].

Sincerely,

John Raaymakers, PE
Public Works Project Manager










  
C.4.b
Packet Pg. 61
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Brentwood • Civil/Structural Design Services 33
Appendix: Qualification Letters
0D\, 2021
Request for Qualifications (RFQ) #2021-03 for the On-Call ENV and PS&E Services The STA has completed its evaluation of proposals and conducted interviews in response to this RFQ in accordance with the RFQ terms and conditions.

The top ranking five (5) firms are selected to be on STA’s on-call bench of consultants.

1. Bellecci

2. Dokken

3. DKS

4. Bennet Engineering

5. HQE
As these firms are ranked, the top firm may be selected at any time without further public competition. The remaining bench of consultants will be available for mini-RFP or Small Purchase Procudure procurement. STA member agencies may utilize this list as a publicly advertised and awarded source of consultants for STA involved projects.

This notice is NOT an acceptance of any offer, and the STA retains the right to reject any proposal or withdraw the RFQ in its entirety.

In accordance with the subject RFQ, this notice shall NOT create rights, interests, or claims of entitlement in the apparent best-evaluated proposer or any vendor. No vendor shall acquire any such right unless and until a contract is fully signed by all appropriate STA officials.

Respectfully,
Anthony Adams
Project Manager for RFQ #2021-03 for On-Call ENV and PS&E Services

1. Bellecci
the top firm may be selected at any time without further public competition.










  
C.4.b
Packet Pg. 62
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Concord Office Pleasanton Office
2290 Diamond Blvd., Suite 100 925 • 685 • 4569 7077 Koll Center Pkwy., Suite 210 Concord, CA 94520 bellecci.com Pleasanton, CA 94566

Reimbursable expenses shall include, but are not limited to the following:

In House Printing Bond: $0.25/sf • Mylar: $5/sf
Large Format Color Presentation $2.50/sf
Color Copies: 8.5 x 11” $1.00 / ea
Color Copies: 11 x 17” $1.90 / ea
Other Direct Project Expenses cost + 10%
Subcontractors cost + 10%
Outside Printing & Delivery Service cost + 10%
Effective Through December 31, 2022
Personnel Description Hourly Billing Rate
Principal Engineer II $270
Principal Engineer I $228
Construction Manager $228
Professional Engineer III $210
Professional Engineer II $196
Professional Engineer I $190
Design Engineer III $180
Design Engineer II $174
Design Engineer I $168
Assistant Engineer II $160
Assistant Engineer I $150
Senior Public Works Inspector $168
Public Works Inspector $148
Public Works Inspection Assistant $120
Land Surveying Services
Professional Land Surveyor $228
Survey Coordinator $192
Survey Technician $170
Flag Person $110
1‐Man Survey Crew $218
2‐Man Survey Party $312
3‐Man Survey Party $398
Legal & Expert Services
Depositions and Trial Testimony $425
Client authorized overtime work will be charged at 135% of the standard hourly rates. 









  
C.4.b
Packet Pg. 63
Attachment: Bellecci & Associates Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) PSA_City Attorney Approved Version 040821

AGREEMENT FOR ON-CALL CIVIL/STRUCTURAL DESIGN SERVICES
BKF Engineers
THIS AGREEMENT is made and entered into as of the _____ day of __________________, 2022 by and between the City of Brentwood, a municipal corporation of the State of California ("City"), and BKF Engineers, a California Corporation ("Consultant") (each a “Party” and collectively, the “Parties”).

RECITALS
A. City requires the professional services of a consultant specifically trained and experienced in civil/structural design services, which are professional services outside of services offered by City.

B. Consultant has the professional skills and experience necessary to perform the services described in this Agreement.

C. Consultant customarily engages in these services as part of its independently established trade, occupation, and/or business, separately from its work for City.

D. City desires to engage Consultant to provide these services by reason of its qualifications and experience in performing such services
E. Consultant has submitted a proposal to City and has affirmed its willingness and ability to perform such work on the terms and manner set forth in this Agreement.

NOW, THEREFORE, in consideration of these recitals and the mutual covenants contained herein, the Parties agree as follows:

1. Scope of Work.

1.1 City retains Consultant, as an independent contractor, to perform, and Consultant agrees to render, those services (the "Services") that are described in the attached Exhibit "A," which is incorporated by this reference, pursuant to this Agreement’s terms and conditions.

1.2 Consultant will control the manner and the means of the work to be performed, and be responsible for the professional quality, technical accuracy and coordination of the Services. Consultant will, without additional compensation, correct or revise any errors or deficiencies in the Services.

1.3. Consultant will keep City informed on a regular basis that the Services are being performed in accordance with the requirement and intentions of this Agreement.

1.4 If applicable, Consultant has designated those persons listed in Exhibit “A” to provide the Services to the City. Consultant will not change or reassign those persons described in Exhibit “A” without prior written notice to City, and will not replace those individuals with individuals to whom City has a reasonable objection.

2. Standard of Performance. Consultant acknowledges that in entering into this Agreement the City is relying on Consultant's special skills and experience to do and perform the Services. While performing the Services, Consultant will exercise the reasonable professional care and skill customarily exercised by reputable members of Consultant's profession practicing in the Northern California area. The acceptance of the Services by City does not release Consultant from these obligations.

Consultant will be responsible for employing or engaging all persons necessary to perform the Services.

Consultant will control the manner and means of the services to be performed by its employees and subconsultants. All of Consultant's staff will be qualified by training and experience to perform their assigned tasks. Consultant will give its personal attention to the fulfillment of the provisions of this Agreement by all of its employees and subcontractors, if any, and will keep the Services under its control. 












 
C.4.c
Packet Pg. 64
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 2 PSA_City Attorney Approved Version 040821
On demand of City, if any employee or subcontractor of Consultant fails or refuses to carry out the provisions of this Agreement or appears to be incompetent or to act in a disorderly or improper manner, he or she will be discharged immediately from the Services.

3. Term. Unless earlier terminated, the term of this Agreement will be effective for a period of one year from the date first above written. The City Manager may amend the Agreement to extend it for two additional one-year periods or parts thereof in an amount not to exceed one hundred thousand dollars ($100,000) per Agreement year. Extensions will be based upon a satisfactory review of Consultant's performance, City needs, and appropriation of funds by the City Council. The parties will prepare a written amendment indicating the effective date and length of the extended Agreement.

4. Schedule. Consultant will generally adhere to the schedule set forth in Exhibit “A” provided, that City will grant reasonable extensions of time for the performance of the Services occasioned by unusually lengthy governmental reviews of Consultant’s work product or other unavoidable delays occasioned by unforeseen circumstances; provided, further, that such unavoidable delay will not include strikes, lockouts, work stoppages, or other labor disturbances conducted by, or on behalf of, Consultant’s officers or employees.

Consultant acknowledges the importance to City of City’s project schedule and agrees to put forth its best professional efforts to perform the Services in a manner consistent with that schedule. City understands, however, that Consultant’s performance must be governed by sound practices. Consultant will work such overtime or engage such personnel and equipment as necessary to maintain the schedule, without additional compensation.

5. Compensation.

5.1 The total fee payable for the Services to be performed during the term of this Agreement will be a not to exceed amount of one hundred thousand dollars ($100,000) as may be further specified in the attached Exhibit “A.” No other compensation for the Services will be allowed except for items covered by subsequent amendments to this Agreement. The City reserves the right to withhold a ten percent (10%) retention until City has accepted the Services.

5.2 Payment will occur only after receipt by City of invoices sufficiently detailed to include hours performed, hourly rates, and related activities and costs for approval by City.

5.3 Within thirty (30) days after receipt of any applicable progress payment request, City will verify the accuracy of the request, correct the charges where appropriate, and make payment to Consultant in an amount equal to the amount of such application, as verified or corrected by City. No payment made prior to completion and acceptance of the Services will constitute acceptance of any part of the Services.

City reserves the right to withhold payment from Consultant on account of Services not performed satisfactorily, delays in Consultant's performance of Services, or other defaults hereunder.

6. Status of Consultant. Consultant will perform the Services as an independent contractor, free from the control and direction of City, in pursuit of Consultant’s independent calling, and not as an employee of City. The persons used by Consultant to provide the Services under this Agreement will not be considered employees of City for any purposes whatsoever and City will not pay any tax, workers’ compensation insurance, retirement contributions or unemployment contributions on behalf of Consultant or its employees or subcontractors. Consultant agrees to indemnify and pay City within thirty (30) days for any tax, retirement contribution, social security, overtime payment, unemployment payment or workers’ compensation payment, including, but not limited to, those based on any provision of the Federal Affordable Care Act, which City may be required to make on behalf of Consultant or any agent, employee, or contractor of Consultant for work done under this Agreement. The payment made to Consultant pursuant to the Agreement will be the full and complete compensation to which Consultant is entitled. City will not make any federal or state tax withholdings on behalf of Consultant or its agents, employees or subcontractors.

At the City’s election, City may deduct the amounts paid pursuant to this Section, from any balance owing to Consultant.













 
C.4.c
Packet Pg. 65
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 3 PSA_City Attorney Approved Version 040821

7. Subcontracting. Consultant's services are being requested by City because they are unique and personal. Except as may be specified in Exhibit “A”, Consultant will not subcontract any portion of the Services without prior written approval of City Manager or his/her designee. If Consultant subcontracts any of the Services, Consultant will be fully responsible to City for the acts, errors and omissions of Consultant's subcontractor and of the persons either directly or indirectly employed by the subcontractor, as Consultant is for the acts and omissions of persons directly employed by Consultant. Nothing contained in this Agreement will create any contractual relationship between any subcontractor of Consultant and City.

Consultant will be responsible for payment of subcontractors. Consultant will bind every subcontractor and every subcontractor of a subcontractor by the terms of this Agreement applicable to Consultant's work unless specifically noted to the contrary in the subcontract and approved in writing by City.

8. Other Consultants. The City reserves the right to employ other consultants in connection with the Services.

9. Indemnification. Consultant agrees to indemnify, including the cost to defend, City, its officers, agents, volunteers and employees from any and all claims, demands, costs or liability that arise out of, or pertain to, or relate to the negligence, recklessness, or willful misconduct of Consultant and its agents in the performance of services under this Agreement, but this indemnity does not apply to liability for damages for death or bodily injury to persons, injury to property, or other loss, arising from the sole negligence, willful misconduct or defects in design by City or the agents, servants, or independent contractors who are directly responsible to City, or arising from the active negligence of City.

10. Insurance. Consultant will obtain and maintain, at its cost and expense, for the duration of the Agreement and any and all amendments, insurance against claims for injuries to persons or damage to property which may arise out of or in connection with performance of the Services by Consultant or Consultant’s agents, representatives, employees or subcontractors. The insurance will be obtained from an insurance carrier admitted and authorized to do business in the State of California. The insurance carrier is required to have a current Best's Key Rating of not less than "A:VII."

10.1 Coverages and Limits. Consultant will maintain the types of coverages and minimum limits indicated below, unless Risk Manager or City Manager, in consultation with the City Attorney approves a lower amount. These minimum amounts of coverage will not constitute any limitations or cap on Consultant's indemnification obligations under this Agreement. City, its officers, agents, volunteers and employees make no representation that the limits of the insurance specified to be carried by Consultant pursuant to this Agreement are adequate to protect Consultant. The coverage will contain no special limitations on the scope of its protection to the above-designated insureds except for Workers Compensation and errors and omissions insurance. Consultant will obtain occurrence coverage, excluding Professional Liability, which will be written as claims-made coverage. If Consultant believes that any required insurance coverage is inadequate, Consultant will obtain such additional insurance coverage, as Consultant deems adequate, at Consultant's sole expense.

10.1.1 Commercial General Liability Insurance. $2,000,000 combined single-limit per occurrence for bodily injury, personal injury and property damage. If the submitted policies contain aggregate limits, general aggregate limits will apply separately to the work under this Agreement or the general aggregate will be twice the required per occurrence limit.

10.1.2 Automobile Liability. $1,000,000 combined single-limit per accident for bodily injury and property damage.

10.1.3 Workers' Compensation and Employer's Liability. Workers' Compensation limits as required by the California Labor Code and Employer's Liability limits of $1,000,000 per accident for bodily injury. Workers' Compensation and Employer's Liability insurance will not be required if Consultant has no employees and provides, to City's satisfaction, a declaration stating this. 












 
C.4.c
Packet Pg. 66
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 4 PSA_City Attorney Approved Version 040821

10.1.4 Professional Liability. Errors and omissions liability appropriate to Consultant’s profession with limits of not less than $1,000,000 per claim.

10.2 Endorsements. For Commercial General Liability Insurance, Consultant will ensure that the policies are endorsed to name the City, its officers, agents, volunteers and employees as additional insureds. Prior to City's execution of this Agreement, Consultant will furnish, to the satisfaction of the City, certificates of insurance and endorsements.

10.3 Cancellation. Insurance will be in force during the life of the Agreement and any extensions of it and will not be canceled without thirty (30) days prior written notice to City sent pursuant to the notice provisions of this Agreement.

10.4 Failure to Maintain Coverage. If Consultant fails to maintain any of these insurance coverages, then City will have the option to declare Consultant in breach of this Agreement, or may purchase replacement insurance or pay the premiums that are due on existing policies in order to maintain the required coverages. Consultant is responsible for any payments made by City to obtain or maintain insurance and City may collect these payments from Consultant or deduct the amount paid from any sums due Consultant under this Agreement.

10.5 Submission of Insurance Policies. City reserves the right to require, at any time, complete and certified copies of any or all required insurance policies and endorsements.

10.6 Primary Coverage. For any claims related to the Services and this Agreement, the Consultant’s insurance coverage will be primary insurance with respect to City, its officers, agents, volunteers and employees. Any insurance or self-insurance maintained by City for itself, its officers, agents, volunteers and employees, will be in excess of Consultant’s insurance and not contributory with it.

10.7 Reduction in Coverage/Material Changes. Consultant will notify City in writing pursuant to the notice provisions of this Agreement thirty (30) days prior to any reduction in any of the insurance coverage required pursuant to this Agreement or any material changes to the respective insurance policies.

10.8 Waiver of Subrogation. The policies shall contain a waiver of subrogation for the benefit of City.

11. Business License. Consultant will obtain and maintain a City of Brentwood Business License for the term of the Agreement, as it may be amended from time-to-time.

12. Maintenance of Records. Consultant will maintain complete and accurate records with respect to costs incurred under this Agreement. All records will be clearly identifiable. Consultant will allow a representative of City during normal business hours to examine, audit, and make transcripts or copies of records and any other documents created pursuant to this Agreement. Consultant will allow inspection of all work, data, documents, proceedings, and activities related to the Agreement for a period of three (3) years from the date of final payment under this Agreement.

13. Ownership of Documents.

13.1 All product produced by Consultant or its agents, employees, and subcontractors pursuant to this Agreement (the “Work Product”) is the property of City. In the event this Agreement is terminated, all Work Product produced by Consultant or its agents, employees and subcontractors pursuant to this Agreement will be delivered to City pursuant to the termination clause of this Agreement. Consultant will have the right to make one (1) copy of the Work Product for Consultant’s records.

13.2 The Work Product may be used by City and its agents, employees, representatives, and assigns, in whole or in part, or in modified form, for all purposes City may deem advisable, without further employment of or payment of any compensation to Consultant; provided, however, that if this Agreement is terminated for any reason prior to completion of the Project and if under such circumstances City uses, 












 
C.4.c
Packet Pg. 67
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 5 PSA_City Attorney Approved Version 040821
or engages the services of and directs another consultant to use, the Work Product, City agrees to hold Consultant harmless from any and all liability, costs, and expenses relative to claims arising out of matters and/or events which occur subsequent to the termination of this Agreement as a result of causes other than the fault or negligence of Consultant, or anyone for whose acts it is responsible, in preparation of the Work Product. Consultant will not be responsible for deficiencies solely attributable to modifications of the Work Product performed by others, or that arise from use of the Documents in connection with a project or site other than that shown in the Work Product.

14. Copyrights. Consultant agrees that all copyrights that arise from the Services will be vested in City and Consultant relinquishes all claims to the copyrights in favor of City.

15. Confidentiality. All documents, reports, information, data, and exhibits prepared or assembled by Consultant in connection with the performance of the Services pursuant to the Agreement are confidential until released by the City to the public, and the Consultant will not make any of these documents or information available to any individual or organization not employed by the Consultant or the City without the written consent of the City before any such release.

16. Notices. Any notices relating to this Agreement shall be given in writing and shall be deemed sufficiently given and served for all purposes when delivered personally, by facsimile or by generally recognized overnight courier service, or five (5) days after deposit in the United States mail, certified or registered, return receipt requested, with postage prepaid, addressed as follows:

For City:

City of Brentwood
150 City Park Way
Brentwood, CA 94513
Phone No. (925) 516-5307
Attn: Jigar Shah
For Consultant:

Name: BKF Engineers
Title: Principal/Vice President
Address: 1646 N. California Blvd., #400
Walnut Creek, CA 94596
Phone: O: (925) 940-2214/C: (650) 280-0309
Attn: Daniel G. Schaefer
Either Party may change its address for purposes of this section by giving the other Party written notice of the new address in the manner set forth above.

17. Conflicts of Interest.

17.1 City will evaluate Consultant’s duties pursuant to this Agreement to determine whether disclosure under the Political Reform Act and City’s Conflict of Interest Code is required of Consultant or any of Consultant’s employees, agents, or subcontractors. Should it be determined that disclosure is required, Consultant or Consultant’s affected employees, agents, or subcontractors will complete and file with the City Clerk those schedules specified by City and contained in the Statement of Economic Interests Form 700.

17.2 Consultant understands that its professional responsibility is solely to City. Consultant warrants that it presently has no interest, present or contemplated, and will not acquire any direct or indirect interest, that would conflict with its performance of this Agreement. Consultant further warrants that neither Consultant, nor Consultant’s agents, employees, subcontractors and consultants have any ancillary real property, business interests or income that will be affected by this Agreement or, alternatively, that Consultant will file with the City an affidavit disclosing this interest. Consultant will not knowingly, and will take reasonable steps to ensure that it does not, employ a person having such an interest in the performance of this Agreement. If after employment of a person, Consultant discovers that it has employed a person with a direct or indirect interest that would conflict with its performance of this Agreement, Consultant will promptly disclose the relationship to the City and take such action as the City may direct to remedy the conflict.













 
C.4.c
Packet Pg. 68
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 6 PSA_City Attorney Approved Version 040821

18. General Compliance with Laws. Consultant will keep fully informed of federal, state and local laws and ordinances and regulations which in any manner affect those employed by Consultant, or in any way affect the performance of the Services by Consultant. Consultant will at all times observe and comply with these laws, ordinances, and regulations and will be responsible for the compliance of the Services with all applicable laws, ordinances and regulations.

19. Pandemic Health Laws. Consultant’s duty to comply with Laws includes compliance by Consultant with all local, state, or federal Laws that have been or may be enacted in response to the COVID-19 pandemic (collectively, “Health Laws”), which include all of the County of Contra Costa Health Orders. Failure to fully comply with the Health Laws constitutes a material default, subject to all available remedies including suspension or termination.

20. Discrimination and Harassment Prohibited. Consultant will comply with all applicable local, state and federal laws and regulations prohibiting discrimination and harassment.

21. Termination. In the event of the Consultant's failure to prosecute, deliver, or perform the Services, City may terminate this Agreement for nonperformance by notifying Consultant in writing pursuant to the notice provisions of this Agreement. Consultant has five (5) business days to deliver any documents owned by City and all work in progress to City address contained in this Agreement. City will make a determination of fact based upon the work product delivered to City and of the percentage of work that Consultant has performed which is usable and of worth to City in having the Agreement completed. Based upon that finding City will determine the final payment of the Agreement. In the event City elects to terminate, City will have the right to immediate possession of all Work Product and work in progress prepared by Consultant, whether located at the project site, at Consultant's place of business, or at the offices of a subconsultant.

Either Party, upon tendering thirty (30) calendar days written notice to the other Party, may terminate this Agreement for convenience. In this event and upon request of City, Consultant will assemble the work product without charge and put it in order for proper filing and closing and deliver it to City. Consultant will be paid for work performed to the termination date; however, the total will not exceed the lump sum fee payable under this Agreement. City will make the final determination as to the portions of tasks completed and the compensation to be made.

22. Covenants Against Contingent Fees. Consultant warrants that Consultant has not employed or retained any company or person, other than a bona fide employee working for Consultant, to solicit or secure this Agreement, and that Consultant has not paid or agreed to pay any company or person, other than a bona fide employee, any fee, commission, percentage, brokerage fee, gift, or any other consideration contingent upon, or resulting from, the award or making of this Agreement. For breach or violation of this warranty, City will have the right to terminate this Agreement for nonperformance, or, in its discretion, to deduct from the Agreement price or consideration, or otherwise recover, the full amount of the fee, commission, percentage, brokerage fees, gift, or contingent fee.

23. Claims And Lawsuits. By signing this Agreement, Consultant agrees that any Agreement claim submitted to City must be asserted as part of the Agreement process as set forth in this Agreement and not in anticipation of litigation or in conjunction with litigation. Consultant acknowledges that if a false claim is submitted to City by Consultant, it may be considered fraud and Consultant may be subject to criminal prosecution. Consultant acknowledges that California Government Code sections 12650 et seq., the False Claims Act, applies to this Agreement and, provides for civil penalties where a person knowingly submits a false claim to a public entity. These provisions include false claims made with deliberate ignorance of the false information or in reckless disregard of the truth or falsity of information. If City seeks to recover penalties pursuant to the False Claims Act, it is entitled to recover its litigation costs, including attorney's fees. Consultant acknowledges that the filing of a false claim may subject Consultant to an administrative debarment proceeding as the result of which Consultant may be prevented to act as a Consultant on any public work or improvement for a period of up to five (5) years. Consultant acknowledges debarment by another jurisdiction is grounds for City to terminate this Agreement. 












 
C.4.c
Packet Pg. 69
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 7 PSA_City Attorney Approved Version 040821

24. Jurisdiction, Venue and Governing Law. Any action at law or in equity brought by either of the Parties for the purpose of enforcing a right or rights provided for by this Agreement will be tried in a court of competent jurisdiction in the County of Contra Costa, State of California, and the Parties waive all provisions of law providing for a change of venue in these proceedings to any other county. This agreement will be governed by the laws of the State of California.

25. Testimony. Consultant will testify at City's request if litigation is brought against City in connection with Consultant's services under this agreement. Unless the action is brought by Consultant, or is based upon Consultant's actual or alleged negligence or other wrongdoing, City, upon prior written agreement with Consultant will compensate Consultant for time spent in preparation for testimony, testimony, and travel at Consultant's standard hourly rates at the time of actual testimony.

26. Successors and Assigns. It is mutually understood and agreed that this Agreement will be binding upon the Parties and their respective successors. Neither this Agreement nor any part of it nor any monies due or to become due under it may be assigned by Consultant without the prior written consent of City, which will not be unreasonably withheld.

27. Section Headings. Section headings as used in this Agreement are for convenience only and will not be deemed to be a part of such sections and will not be construed to change the meaning of the section.

28. Waivers. The waiver by either Party of any breach or violation of any term, covenant, or condition of this Agreement or of any applicable law will not be deemed to be a waiver of such term, covenant, condition or law or of any subsequent breach or violation of same or of any other term, covenant, condition or law. The acceptance by either Party of any fee or other payment which may become due under this Agreement will not be deemed to be a waiver of any preceding breach or violation by the other Party of any term, covenant, or condition of this Agreement or any applicable law.

29. Entire Agreement. This Agreement, together with any other written document referred to or contemplated by it embody the entire Agreement and understanding between the parties relating to the subject matter of it. The City Manager is authorized, in consultation with the City Attorney, to agree to nonmaterial amendments to this Agreement. Neither this Agreement nor any of its provisions may be amended, modified, waived or discharged except in a writing signed by both parties.

30. Authority. The individuals executing this Agreement and the instruments referenced in it on behalf of Consultant each represent and warrant that they have the legal power, right and actual authority to bind Consultant to the terms and conditions of this Agreement.

31. Severability. If any term, provision, condition or covenant of this Agreement or its application to any party or circumstances shall be held, to any extent, invalid or unenforceable, the remainder of this Agreement, or the application of the term, provision, condition or covenant to persons or circumstances other than those as to whom or which it is held invalid or unenforceable, shall not be affected, and shall be valid and enforceable to the fullest extent permitted by law. 












 
C.4.c
Packet Pg. 70
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 8 PSA_City Attorney Approved Version 040821

32. Signatures.

32.1 Counterparts. This Agreement may be executed in two or more counterparts, each of which together will be deemed an original, but all of which together will constitute the same instrument.

32.2 Digital/Electronic Signatures. Using a City-approved method, this Agreement may be executed through the use of digital or electronic signatures in accordance with Government Code Section

16.5. The presence of an electronic signature on this Agreement will be construed as the Parties’ consent to do business electronically.

CONSULTANT:
* By:

Printed Name: Daniel G. Schaefer
Title: Chairman/Vice President
** By:

Printed Name: Jean Chen
Title: CFO
CITY:

By:

Tim Y. Ogden, City Manager
ATTEST:

By:

Margaret Wimberly, City Clerk
APPROVED AS TO FORM:

By:

Damien Brower, City Attorney
If required by City, proper notarial acknowledgment of execution by Consultant must be attached. If a Corporation, Agreement must be signed by one corporate officer from each of the following two groups. *Group A. **Group B.

Chairman, Secretary,
President, or Assistant Secretary,
Vice-President CFO or Assistant Treasurer
Otherwise, the corporation must attach a resolution certified by the secretary or assistant secretary under corporate seal empowering the officer(s) signing to bind the corporation.

If an LLC:
x The Agreement must be signed by a Managing Member or the LLC must attach a resolution empowering the signatory to bind the LLC.

If a partnership:
x The Agreement must be signed by the Managing Partner or the Partner authorized to execute agreements of this type. Additional documentation, such as the partnership agreement, confirming this signature authority may be required.

If a sole proprietorship:
x The Agreement must be signed by the owner.













 
C.4.c
Packet Pg. 71
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 9 PSA_City Attorney Approved Version 040821
EXHIBIT “A”

SCOPE OF SERVICES













 
C.4.c
Packet Pg. 72
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

CIVIL/STRUCTURAL DESIGN SERVICES

FOR INFRASTRUCTURE PROJECTS

CITY OF BRENTWOOD

STATEMENT OF QUALIFICATIONS
MARCH 8, 2022













 
C.4.c
Packet Pg. 73
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

BKF ENGINEERS
1646 N. California Blvd., Suite 400, Walnut Creek, CA 94596 | t. 925.940.2200 March 8, 2022
City of Brentwood, Public Works Department
Attention: Renee Payette
150 City Park Way, Brentwood, CA 94513
68%-(&7
6WDWHPHQWRI4XDOLÀFDWLRQVIRU&LYLO6WUXFWXUDO'HVLJQ6HUYLFHVIRU,QIUDVWUXFWXUH3URMHFWV %.)(QJLQHHUV
%.)
ZHOFRPHVWKHRSSRUWXQLW\WRVXEPLWRXU6WDWHPHQWRI4XDOLÀFDWLRQV 624
WRVXSSRUWWKH
City of Brentwood (City) for Civil/Structural Design Services. We believe BKF is well suited to support the City based on our experience, services, management, and commitment as demonstrated throughout our response. 6LPLODU/RFDO([SHULHQFH
Since 1915, one of BKF’s longest standing traditions is to serve and support our local FRPPXQLWLHV%.)ZLOOVXSSRUWWKH&LW\IURPRXUORFDO:DOQXW&UHHNR඼FHWKDWLVVWDරHGZLWKSURIHVVLRQDOV Firm-wide we currently maintain over 50 active civil engineering and surveying on-call contracts throughout West &RDVWWKURXJKRXUR඼FHQHWZRUNDQGSURIHVVLRQDOV2XUORFDOR඼FHKDVUHFHQWO\VHUYLFHGWKHIROORZLQJ on-call contracts:
- City of Brentwood
- East County Fire
Protection District
- City of Concord
- City of Pittsburg
- City of Walnut Creek
- City of Antioch
- City of Richmond
- Town of Moraga
- City of San Ramon
- City of Hercules
- City of Napa
- City of St. Helena
- Alameda County
- California State Parks
7HDP([SHULHQFH
BKF’s team consists of experienced individuals who are committed to delivering successful on-call projects. We have also included subconsultants with which we have worked on numerous past projects on RQFDOOHQJDJHPHQWV)RUHDFKWDVNRUGHUZHZLOOSURYLGHWKH&LW\ZLWKDIRFXVHGSURSRVDOLQGLFDWLQJWKHVWDරDQG FRQVXOWDQWVQHHGHGWRIXOÀOOWKHVFRSHRIZRUN2XUWHDPDQGVXEFRQVXOWDQWSDUWQHUVLQFOXGH

([WHQVLYH6HUYLFHV
:HSURYLGHDUDQJHRIPXQLFLSDOVHUYLFHVWRDJHQFLHVDQGDUHFRQÀGHQWWKDWZHFDQSURYLGH \RXZLWKWKHDQWLFLSDWHGVHUYLFHVGHÀQHGLQWKH6FRSHRI:RUN6LPLODUVHUYLFHVKDYHFRYHUHGDQDUUD\RIVHUYLFHV including:
- Civil design of public CIP transportation, utility,
parks, and ancillary projects
- Water, wastewater, and stormwater gravity,
pressure, and pumping systems
- 7UD඼FHOHFWULFDODQG6&$'$FRQWUROVGHVLJQ
- Landscaping and parks improvements
- Grant and permitting assistance
- Construction support services
0DQDJHPHQW$SSURDFK
2XUFRPPLWPHQWWRVHUYLQJWKHVHFOLHQWVLVEDVHGRQPHHWLQJH[SHFWDWLRQV by communicating clearly and delivering quality products. We understand our role with enhanced interGHSDUWPHQWDOVWDNHKROGHU V
DQGFRQVXOWDQWWHDPFRRUGLQDWLRQ2XUSURFHVVIRUSURYLGLQJRQFDOOVHUYLFHV EHJLQVZLWKFOHDUO\GHÀQLQJWKHJRDOVWKHQHVWDEOLVKLQJDEDVLVRIGHVLJQIUDPHZRUNZKLFKOHDGVWRURDGPDSIRU documenting deliverables.
4-48-4 Commitment: We are committed to a 4-48-4 (4 hour emergency, 48 hour task scope, and 4 week turn around) response time to meet the City's needs. BKF understands that emergencies or schedule changes KDSSHQDQGDUHRIWHQXQSUHGLFWDEOH%.)SULGHVLWVHOILQRරHULQJUDSLGUHVSRQVHZLWKTXDOLW\VHUYLFHE\QRWRYHU committing our resources allocated to an on-call contract.

BKF has the experience and resources to meet the project’s timeline, objectives, and funding commitments. We would appreciate the opportunity to provide our services to assist the City of Brentwood. Please contact me if you have any questions regarding our submittal.

Respectfully,
%.)(1*,1((56
Dan Schaefer, PE, LEED AP, QSD
Principal-in-Charge/Project Manager
%.) (1*,1((56
D S h f PE LE
- Dan Schaefer, PE, Principal/Project Manager
- Joe Young, PE, Deputy Project Manager
- Alex Croskey, PE, Roadway Engineer
- -Hර:DQJ3(7UD඼F(QJLQHHU
- Michael Steele, PE, Buildings/Site Work Engineer
- Erik Moreno, PE, Water Resources Engineer
- Biggs Cardosa, Structural Engineering
- Gates & Associates, Landscape Architects
- BSK, Geotechnical Engineer
- David J. Powers & Associates, CEQA/NEPA
Environmental Consultant (DBE)
- DTN, Electrical Engineering, SCADA, and Controls













 
C.4.c
Packet Pg. 74
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

SUBCONTRACTORS
SOQ for Civil/Structural Design Services for
Infrastructure Projects 2 BKF ENGINEERS

SUBCONTRACTORS
Biggs Cardosa Associates
865 The Alameda
San Jose, CA 95126
408.296.5515
Biggs Cardosa will provide structural engineering
services
Gates & Associates
2671 Crow Canyon Rd
San Ramon, CA 94583
925.736.8176
Gates will provide landscape architecture services
BSK Associates
399 Lindbergh Avenue
Livermore, CA 94551
925.315.3151
BSK will provide geotechnical services
David J Powers & Associates, Inc.
1611 Telegraph Avenue, Ste. 1002
Oakland, CA 94612
408.248.3500
David Powers will provide environmental
consulting
DTN Engineers
1305 Franklin Street
Oakland, CA 94612
510.267.0441
DTN Engineers will provide electrical engineering
services













 
C.4.c
Packet Pg. 75
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

SUBMITTAL APPROACH / FIRMS QUALIFICATIONS
SOQ for Civil/Structural Design Services for
Infrastructure Projects 3 BKF ENGINEERS
Delivering Inspired Infrastructure for over 100 years
BKF Engineers

STAFF AVAILABILITY
%HORZLVDFXUUHQWVQDSVKRWRIHDFKVWDරPHPEHU·VPDMRUFRPPLWPHQWVDQGFXUUHQW DYDLODELOLW\:HKDYHLGHQWLÀHGVWDරWKDWFDQFRPPLWWRFRPSOHWLQJWKLVSURMHFW ZLWKLQWKHVSHFLÀHG
GD\GHVLJQZLQGRZ
6WDઊ0HPEHU Availability
'DQ6FKDHIHU, Principal/Project Manager 40%
-DVRQ:KLWH, QA/QC Manager 30%
-RVHSK<RXQJ, Deputy Project Manager 65%
-H෇:DQJ7UD඼F(QJLQHHU   30%
0LFKDHO6WHHOH, Buildings & Site Work Engineer 40%
(ULN0RUHQR, Water Resources Engineer 30%
$OH[&URVNH\, Roadway Engineer 40%

BRIEF HISTORY
For more than 100 years, BKF Engineers has served California, developing and rehabilitating public infrastructure including utility systems, streets, educational and healthcare facilities. We remain a privately held, locally RZQHGÀUPZLWKDVWDරRIRYHUHQJLQHHUVVXUYH\RUVDQGSODQQHUV 7KURXJKRXUQHWZRUNRIZHVWFRDVWR඼FHV%.)SURYLGHVFLYLO engineering, land surveying, and land planning services for government agencies, institutions, developers, design professionals, contractors, school districts, and corporations. Facilitating the unique permitting and expertise requirements of projects, we provide a number of specialty services, including Agency permit expediting, sustainable infrastructure, VLWHDFFHVVLELOLW\FRQVXOWLQJK\GURORJ\K\GUDXOLFVWUD඼FVLJQDODQGWUD඼F handling designs, utility locating services, automated construction surveying monitoring, and 3D laser scanning.

Civil Engineering • Surveying • Planning
Transportation • Water Resources •
Construction Management • Utility Design
Project & Program Management

SERVICES
1646 N. California Blvd, Suite 400
Walnut Creek, CA 94596
925.940.2200

OFFICE LOCATION













 
C.4.c
Packet Pg. 76
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

SUBMITTAL APPROACH / FIRMS QUALIFICATIONS
SOQ for Civil/Structural Design Services for
Infrastructure Projects 4 BKF ENGINEERS
-H෇:DQJ3(
7UD඼F(QJLQHHU

BKF ENGINEERS
0LFKDHO6WHHOH3(/(('$3
Buildings & Site Work
Engineer

BKF ENGINEERS
(ULN0RUHQR3(46'3
Water Resources Engineer

BKF ENGINEERS
$OH[&URVNH\3(/(('$3
46'3
Roadway Engineer

BKF ENGINEERS

TRAFFIC BUILDINGS
6,7(:25. :$7(55(6285&(6 52$':$<
352-(&70$1$*(0(17
'DQ6FKDHIHU3(/(('$346'
Principal-in-Charge
& Project Manager

BKF ENGINEERS
48$/,7<&21752/
-DVRQ:KLWH3(
QA/QC Manager

BKF ENGINEERS
(19,5210(17$/ LANDSCAPE ARCHITECTURE *(27(&+1,&$/
:LOO%XUQV$,&3
Environmental Consultant
'$9,'-32:(56 $662&,$7(6
&KXFN*DUGHOOD5/$
Landscape Architect
GATES
&ULVWLDQR0HOR3(*(
Geotechnical Engineer
BSK

STRUCTURAL ELECTRICAL
7RP6ZD\]H3(6(
Structural Engineer
%,**6&$5'26$
'LHS1JX\HQ3(
Electrical Engineer
DTN
-RVHSK<RXQJ3(
Deputy Project Manager

BKF ENGINEERS

ORGANIZATIONAL CHART
%.)(1*,1((566859(<2563/$11(56
683325767$))













 
C.4.c
Packet Pg. 77
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

SUBMITTAL APPROACH / PROJECT TEAM
SOQ for Civil/Structural Design Services for
Infrastructure Projects 5 BKF ENGINEERS

TEAM ROLES
2XUUHFRUGRIVXFFHVVIXOO\FRPSOHWHGDQGFRQVWUXFWHGSURMHFWVUHÁHFWVWKHGHGLFDWLRQDQGYHUVDWLOLW\RIRXUVWDරWR manage small-scale and large-scale projects. As previously mentioned, services provided for this contract will be PDQDJHGE\'DQ6FKDHIHU3(/(('$346'RXWRIRXU:DOQXW&UHHNR඼FH7KHSURSRVHGWHDPEHORZZLOOVWD\ LQYROYHGIRUWKHSURMHFWGXUDWLRQHQVXULQJFRQWLQXLW\DQGPLQLPL]LQJLQH඼FLHQFLHV,IWKHVFKHGXOHGHPDQGVZH can utilize the assistance of other BKF team members and subconsultants in order to meet the project deadline. 'DQ6FKDHIHU3(/(('$346'
&$Ã1R

 will serve as 3ULQFLSDOLQ&KDUJHDQG3URMHFW
0DQDJHU of the project. Dan will manage the overall
FRQWUDFWZLWKWKH&LW\DQGVXSSRUWWKHWHDP·VHරRUWV
with contract and overall project management. He
will ensure that the proper resources are allocated
for each project the City assigns. Dan has 32 years of
experience with public projects focusing on on-call
engagements.
-DVRQ:KLWH3(/(('$346'3
&$Ã1R

will serve as the 4$4&0DQDJHU. Jason has
25 years of experience and will perform QA/QC for our
projects. As an independent advisor, he will ensure that quality is maintained throughout the process.
-RVHSK<RXQJ3(
&$Ã1R

 will serve
as the 'HSXW\ 3URMHFW0DQDJHUJoseph will work
directly with the BKF team members and oversee the
production of the project documents. His expertise and
managerial skills in tracking and maintaining schedules and budgets ensures project delivery success.
-H෇:DQJ3(
&$Ã1R
will serve as the
7UD෈F(QJLQHHUJHරZLOOOHDGWKHWUD඼FVHUYLFHV+H
KDVOHGSURMHFWVLQYROYLQJWUD඼FV\VWHPVWKURXJKRXW
the Bay Area for more than 31 years at BKF. His
expertise with federally-funded projects, knowledge
RIWUD඼FGHVLJQSULQFLSOHVDQGZD\VWRUHGXFHWKH
schedule and stay within budget will be an asset to the City.
0LFKDHO6WHHOH3(/(('$3
&$Ã1R



will serve as the %XLOGLQJVDQG6LWH:RUN(QJLQHHU.

He has over 13 years of experience providing the
knowledge to manage and prepare detailed planning
DQGFRQVWUXFWLRQGRFXPHQWVIRUOLEUDULHVÀUHVWDWLRQV civic buildings, and community and park facilities
throughout the San Francisco Bay Area.
(ULN0RUHQR 3(46'3
&$Ã1R

will
serve as the :DWHU5HVRXUFHV(QJLQHHU. Erik has over
11 years of water resources engineering experience
in the San Francisco Bay Area. He has a wide range
of project experience that includes stormwater
management planning, hydrologic and hydraulic
modeling, green and grey stormwater infrastructure
design, creek and river restorations, stormwater
monitoring, and third-party technical review.
$OH[&URVNH\3(/(('$346'3
&$Ã1R

will serve as the 5RDGZD\(QJLQHHU. Alex has
15 years of experience in the engineering design and
enhancement of projects including roadways, roadway
rehabilitation, streetscape, complete streets, trails, and transportation.

TEAM COMMITMENT
9 7KHWHDPZLOOVWD\LQYROYHGIRUWKHSURMHFWGXUDWLRQHQVXULQJFRQWLQXLW\DQGPLQLPL]LQJLQHઋFLHQFLHV 9 Our team of engineers are dedicated to the delivery of the project 9 Our team is assigned based on relevant project history, years of experience, and current workload schedules
9 5HFRJQL]LQJWKDWVFKHGXOHVDQGWLPHOLQHVDUHRIWHQDGMXVWHGWRPHHWRWKHURXWVLGHLQÁXHQFHV%.)KDV WKHDELOLW\EDVHGRQRXUVL]HDQGÀUPFXOWXUHWRDGMXVWRXUZRUNVFKHGXOHVDQGPDQSRZHUWRPHHW WKHGHPDQGRUVSHFLÀFUHTXHVWVDVVRFLDWHGZLWKWKHSURMHFW 












 
C.4.c
Packet Pg. 78
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

SUBMITTAL APPROACH / PROJECT EXPERIENCE
SOQ for Civil/Structural Design Services for
Infrastructure Projects 6 BKF ENGINEERS
CITY OF BRENTWOOD ON-CALL CIVIL (2019-22) Brentwood, CA

EL CERRITO ON-CALL ENGINEERING & PROJECT MANAGEMENT
El Cerrito, CA
BKF provided the City of Brentwood with on-call civil
engineering services for the years 2019-2022. The
projects BKF completed or is working on include the
following:
'HHU5LGJH)URQWDJH/DQGVFDSLQJ,PSURYHPHQWV
BKF provided land surveying services and preparation
RIÀQDOGHVLJQDQGFRQVWUXFWLRQGRFXPHQWVDVVRFLDWHG
with the conversion of the former Deer Ridge
Golf Course frontage landscape improvement from a private to public landscape and maintenance facility in the City of Brentwood. When constructed, project elements will include new plantings, trees, and trees and irrigation at parkway strips. Existing water IRXQWDLQHQWU\IHDWXUHVZLOOEHUHWURÀWWHGWRFRQYHUWWKHSULYDWHQRQZRUNLQJV\VWHPWRD new working publicly maintained municipal system. Additionally, new PG&E service meters are needed to supply power to the new irrigation controller and water features to segregate them from the private former golf facility.
'RZQWRZQ$OOH\5HKDELOLWDWLRQ
BKF is providing the civil engineering and land surveying services associated with the rehabilitation Midway and Parkway, and each City Street crossing location for the two DOOH\ZD\VLQFOXGLQJWKHVWDUWDQGHQGSRLQWV%.)SURYLGHGWKHÀHOGZRUNWRSUHSDUH DWRSRJUDSKLFPDSIRUWKHSURMHFWVLWH2XUVHUYLFHVDOVRLQFOXGHXWLOLW\RXWUHDFKDQG pavement evaluation and reconstruction, sewer and water replacement, preparation of SODQVVSHFLÀFDWLRQVDQGHVWLPDWHDQGFRQVWUXFWLRQVXSSRUW BKF was selected by the City of El Cerrito to provide
on-call engineering and project management services
for the years 2018 through 2021. The work will be
assigned on an as-needed basis for various projects
and city programs. The projects vary from discrete,
short-term assignments to larger capital projects or
planning projects. To date, BKF has worked on the
following projects:
'HO1RUWH72'&RPSOHWH6WUHHWV,PSURYHPHQWV
7KH(O&HUULWRGHO1RUWH7UDQVLW2ULHQWHG'HYHORSPHQW
72'
&RPSOHWH6WUHHWVSURMHFWLV
SDUWRIWKH&LW\·V6DQ3DEOR$YHQXH6SHFLÀF3ODQDQG$FWLYH7UDQVSRUWDWLRQ3ODQ7KHJRDO is to relieve crowing, improve accessibility, reduce fare evasion, and enhance the customer H[SHULHQFHDWWKH(O&HUULWRGHO1RUWH%$57VWDWLRQDQGVXUURXQGLQJ72'7KLVSURMHFWZLOO implement multimodal transportation improvements and consists of safety and circulation improvements for bicyclists, pedestrians, buses, and automobiles in the area. Project elements include new signalized crossings for pedestrians, new bicycle lanes, conversion of one-way to two-ways streets, signalization changes, signing and streetscape enhancements and potentially green infrastructure. These improvements are being funded through a combination of State of California Proposition 1B Funds, Contra Costa County Measure J Funds, and other funds.

COST
Varied

COMPLETION
DATE
2019-2022

REFERENCE
Lori Sanders
-RH2GU]\ZROVNL
Meghan Laporta

KEY STAFF
Dan Schaefer
Alex Croskey
Michael Steele
Joseph Young
-Hර:DQJ
COST
Varied

COMPLETION
DATE
2018-2021

REFERENCE
<YHWWHK2UWL]
Public Works
Director/City
Engineer
City of El Cerrito
510.215.4382
[email protected]cerrito.ca.us

KEY STAFF
Dan Schaefer
Jason White













 
C.4.c
Packet Pg. 79
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

SUBMITTAL APPROACH / PROJECT EXPERIENCE
SOQ for Civil/Structural Design Services for
Infrastructure Projects  BKF ENGINEERS
%DUUHWW$YHQXH3DUFHO0HUJHU3ODQ5HYLHZ
BKF provided plan checks of the legal description and plat for the Parcel Merger. 6DQ3DEOR$YHQXH3ODQ5HYLHZ
BKF provided plan review for compliance with storm water best management compliance, site accessibility, grading and drainage, earthwork, and public improvements consistent with the City’s standards.

ALAMEDA PUBLIC WORKS ON-CALL (2016-22)
Hayward, CA
BKF was retained by Alameda County’s Public
Works Development in 2016 for a three-year
contract to supplement their engineering
DQGVXUYH\HරRUWVIRUYDULRXVSXEOLFZRUNV
engagements throughout the County and was
granted a two-year extension through 2021.

Two sample projects that we have assisted the
County with to date include:
+HVSHULDQ%RXOHYDUG&RUULGRU,PSURYHPHQWV
The Hesperian Boulevard Corridor Improvement Project intends to improve multimodal access through the corridor. The project envisioned repurposing the once former VWDWHKLJKZD\LQWRDFRPSOHWHVWUHHWGHVLJQHGWREHQHÀWSHGHVWULDQVELF\FOLVWVDV well as motorists. The streetscape improvements derive from the historic 1940’s Lorenzo Theatre, an art deco building that forms the center commercial district within the corridor. The 1.5-mile streetscape was constructed in two phases. A Rule 20A utility undergrounding project converted wood joint poles and overhead utilities to underground facilities at the northern and southernmost sections of the corridor. The Streetscape Plan provides:

Urban Design elements that create public spaces, enhanced pedestrian walkways, DQGWUD඼FFDOPLQJPHDVXUHVFRQVLVWHQWZLWKWKH+HVSHULDQ6WUHHWVFDSH0DVWHU3ODQ 3URSRVHGIHDWXUHVWKDWUHÁHFWERWKWKHFRPPXQLW\·VFKDUDFWHUDQGKLVWRU\LQFOXGH

- Gateway markers and sidewalk plaza architectural features - Revisions to the bridge barriers
- Special paving and furnishings such as lights, benches, and recycling receptacles - Green street components that include rain gardens and permeable pavement Landscape Design integrated street trees and other planting which is durable, low maintenance, and drought tolerant. The irrigation system was consistent with EBMUD’s latest water conservation measures. Engineering includes new concrete curbs, gutters, sidewalks, and pedestrian ramps that comply with the Americans with Disability Act, &DOWUDQVDQG$$6+72VWDQGDUGVDORQJZLWKQHZXUEDQ1$&72JXLGHOLQHVIRUXUEDQ bikeway design. Additional improvements include:
- 1HZWUD඼FVLJQDOV\VWHPVDWHDFKLQWHUVHFWLRQ
- 5HYLVLRQVWRWKHVWRUPGUDLQV\VWHPWRDFFRPPRGDWHURDGZD\PRGLÀFDWLRQV - 0RGLÀFDWLRQVWRURDGZD\VWULSLQJDQGVLJQDJH
- Pavement Rehabilitation
- Integrated bus stops with separated bikeways
COST
Varied

COMPLETION
DATE
2022
(anticipated)

REFERENCE
Tam Nguyen,
Project Engineer
Alameda County
Public Works
Agency
510.670.5758
[email protected]

KEY STAFF
Dan Schaefer
Alex Croskey
-Hර:DQJ













 
C.4.c
Packet Pg. 80
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

SUBMITTAL APPROACH / PROJECT EXPERIENCE
SOQ for Civil/Structural Design Services for
Infrastructure Projects 8 BKF ENGINEERS

OAKLEY DOWNTOWN STREETSCAPE
Oakley, CA
)RU\HDUV0DLQ6WUHHWLQ2DNOH\ZDVD6WDWH
KLJKZD\ZKHUHPRVWWUD඼FLQFOXGLQJKHDY\WUXFNV
XVHGDVDE\SDVV7KLVUHVXOWHGLQVLJQLÀFDQWZHDU
and tear on the roadway. Given the high volume
RIWUD඼FXVLQJ0DLQ6WUHHWWKHSDYHPHQWZDV
VHYHUHO\GHWHULRUDWHGZKLFKZDVUHÁHFWHGLQWKH
visual landscape of the corridor. With Caltrans’
construction of the State Route 4 Extension, Main
6WUHHWZDVUHOLQTXLVKHGWRWKH&LW\RI2DNOH\
8SRQJDLQLQJMXULVGLFWLRQRYHUWKHLUGRZQWRZQFRUULGRUWKH&LW\LGHQWLÀHGVHYHUDO improvements along Main Street that would improve the longevity, safety and attractiveness of the street. These utility, pavement and pedestrian improvements were FRPELQHGLQWRRQHKLJKO\FRRUGLQDWHGFDUHIXOO\VWDJHGFRQVWUXFWLRQHරRUWWRPLQLPL]H impacts to residents, businesses, and schools.

Project elements included pavement analysis and rehabilitation, bulbout and sidewalks, curb and gutter, median reconstruction, decorative paving, storm water treatment

ELRUHWHQWLRQDUHDV
XWLOLW\UHORFDWLRQGUDLQDJHGHVLJQVDQLWDU\VHZHUGHVLJQWUD඼F signal design, signing and striping, seat walls, landscaping and tree wells, lighting, and gateway monument. The project was constructed in three continuous phases:

Ł Phase 1: Utility relocation and drainage improvements Ł Phase 2: Pavement rehabilitation and streetscape from Norcross Lane to 2nd Street Ł Phase 3: Pavement widening and streetscape improvements from 2nd Street to 5th Street
To minimize impact to the traveling public, the project implemented night time construction through the use of planned detours. This allowed the Contractor to have a larger work-area which expedited construction and minimized impacts to the City’s downtown core. Every morning, the roadway was opened prior to the start of the peak-hour commute. BKF also assisted the City with the E-76 documentation to ensure compliance for project funding.

COST
Firm Cost
$706,350
Total Project
Cost
$2,300,000

COMPLETION
DATE
2017

REFERENCE
Kevin Rohani
Public Works
Director/City
Engineer
&LW\RI2DNOH\
925.625.7000
rohani@
ci.oakley.ca.us

KEY STAFF
-Hර:DQJ
6DQ0LJXHO$YHQXH6LGHZDONDQG3DYLQJ,PSURYHPHQWV
BKF provided civil engineering design for the installation of pedestrian enhancements along San Miguel Avenue which serves residential use. Detailed plans were prepared to install sidewalks, curbs, drainage, and pavement improvements without encroachment onto private property. As this project received federal funding, BKF coordinated the E76 process through CALTRANS.













 
C.4.c
Packet Pg. 81
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

SUBMITTAL APPROACH / PROJECT APPROACH
SOQ for Civil/Structural Design Services for
Infrastructure Projects 

BKF ENGINEERS

PROJECT UNDERSTANDING
BKF understands the City of Brentwood’s need to
deliver Capital Improvement Projects. By selecting an
RQFDOOSURIHVVLRQDOFRQVXOWLQJÀUPWKH&LW\ZLOOEH
able to expand its capabilities to meet ever changing
QHHGV%.)FDQSURYLGHWKHVWD඼QJDQGVHUYLFHV
needed to meet the demand. We have a robust history
SURYLGLQJ2Q&DOOVHUYLFHVWRSXEOLFDJHQFLHVDQG
currently serve over 50 on-call contracts throughout
the Bay Area.

For these agencies, we are providing a range of
engineering services similar to what is being requested LQ\RXU5)3:HDUHH[FLWHGWRRරHURXUSURSRVDODQG
DUHFRQÀGHQWWKDWZHFDQSURYLGHTXDOLW\VHUYLFHVWR
meet your needs.

Services similar to those requested that we provide to
our clients include: roadway design; site development;
stormwater, wastewater, and domestic water utility

LQIUDVWUXFWXUH
EULGJHVDQGVWUXFWXUHV
WUD඼FFRQWURO
handling and signals; and landscaping, trails, and park improvements.

These services could help guide projects with project
VSHFLÀFUHSRUWVRUEDVLVRIGHVLJQ7KH\FRXOGDOVR
FXOPLQDWHLQSODQVVSHFLÀFDWLRQDQGHVWLPDWHV
36(

used to bid and construct a project. Additionally we
have provided construction management support
services to complete projects.
2XUZRUNZLOOEHDSSURSULDWHWRWKHSURMHFWVHWWLQJ
whether it be urban or rural. We realize that urban
design solutions are not necessarily applicable to rural settings. It is important that our designs emphasize
preserving existing trees, creek areas, and other natural features. Coordination and permitting with other
agencies, such as the Regional Water Quality Control
Board, Caltrans, or U.S. Army Corps of Engineers, will
need to be incorporated into a project’s schedule and
considered in developing design solutions.
4-48-4 RESPONSE OBJECTIVES
%.)UHFRJQL]HVWKDWDYDULHW\RIGLරHUHQWSURMHFW
types may be involved under this agreement. The key
WRSURYLGLQJ\RXZLWKDQHරHFWLYHUHVSRQVHWRHDFK
project/task order is in our ability to quickly understand WKHVSHFLÀFSURMHFWVFRSHDQGRUJDQL]HRXUSURMHFW
team accordingly. To facilitate this, our Response Time objectives include:
2XUPDLQREMHFWLYHZLOOEHWRGHÀQHHDFKSURMHFW·V
objectives, constraints, and approach at the beginning
in order to tailor the scope, schedule, and fee to meet the City’s needs.
2QFHGHÀQHGRXUQH[WREMHFWLYHVZLOOIRFXVRQ
developing design solutions which are appropriate
WRVSHFLÀFSURMHFWUHTXLUHPHQWV
FRRUGLQDWLQJVXE
consultants; verifying that the long-term maintenance
is accounted for; and ensuring that the design solutions ÀWZLWKLQHVWDEOLVKHGEXGJHWVDQGVFKHGXOHV
Timely communications between client and design
team is essential. Regular meetings coupled with
detailed written communication (e.g. Project Status
Updates) can provide the necessary exchange of ideas
and document resolutions to provide team members a
clear understanding of the project status and their role in successful project completion.
%.)UHFRJQL]HVWKHQHHGWREHÁH[LEOHLQRXUUHVSRQVH
WRHDFKVSHFLÀFSURMHFWDVVLJQPHQW:HZLOOPRGLI\RXU project management approach and design ideas to
best address project requirements.

DELIVERY APPROACH TO CAPITAL

IMPROVEMENT PROJECTS
For Capital Improvement Projects, BKF’s approach is
based on our four-step work plan which was developed
based on years of experience and implementation.
2QFHWKH&LW\DVVLJQV%.)ZLWKD3URMHFW:RUN2UGHU
ZHZLOOXVHWKLVEDVLFDSSURDFKDQGWDLORULWWRÀWWKH VSHFLÀFSURMHFWUHTXLUHPHQWV
:KHQZHLQLWLDOO\UHFHLYHD3URMHFW:RUN2UGHU'DQ
Schaefer the Principal-in-Charge and Project Manager
will review the material provided and establish the job tasks necessary to proceed with the project. Through
preliminary discussions with the City, a detailed scope of work will be developed. We may include scopes of
work for sub-consultants such as landscape, structural,

RESPONSE TIMES
• (PHUJHQF\6XSSRUW
Within 4 hours
of a County request
• 2Q&DOO6FRSHRI:RUN
Within 48
hours of contact
• 'HVLJQ6HUYLFHV
Within 4 weeks of
notice to proceed
• &RPPXQLFDWLRQ
Continual throughout
4-48-4













 
C.4.c
Packet Pg. 82
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

SUBMITTAL APPROACH / PROJECT APPROACH
SOQ for Civil/Structural Design Services for
Infrastructure Projects  BKF ENGINEERS
environmental and electrical services, as required
or needed. These tasks will then be matched with
DSSURSULDWHSHUVRQQHOWRIRUPDVSHFLÀFGHVLJQWHDP
After our scope of work is negotiated and accepted,
BKF will initiate the design process. The design process FDQYDU\VLJQLÀFDQWO\IURPSURMHFWWRSURMHFWGHSHQGLQJ upon the type of work to be performed, the magnitude
RISURSRVHGLPSURYHPHQWVHWF2XWOLQHGEHORZDUH
typical phases of a project that help gain momentum
throughout the design, permitting and construction…
task order by task order.

PHASE 1 – MANAGE THE PROCESS…to minimize risks
- Communication, status reporting, and check-in strategy - Quality monitoring of team’s work
- Review of project budget burn rate and scheduling
- Meet to review plans and progress of the work
PHASE 2 – DEFINE THE WORK PLAN…to establish goals
- Discuss project goals and identify stakeholders
- Determine background information
- 5HYLHZVLWHFRQGLWLRQVLQWKHÀHOG
- 'HYHORSGHWDLOHGVFRSHRIZRUNOHYHORIHරRUWDQGVFKHGXOH PHASE 3 – DEVELOP ALTERNATIVES WITH OPTIONS…for cost/benefit analysis - Validate existing conditions and constraints
- Determine and assess options and menu of costs
- Develop Basis of Design to document parameters
- Coordinate deliverables with team
PHASE 4 – VALIDATE IN COMPLETION…through outreach to stakeholders - Dialogue with stakeholders (e.g. agencies or local interest groups) - Provide PS&E submittals at agreed upon milestones
- Engage with the City in bidding the work
- Facilitate the construction and closeout of the project

QUALITY ASSURANCE AND

QUALITY CONTROL
BKF weaves quality throughout
the life of projects and task
orders. Quality Assurance
begins with the project
initiation in developing the
scope of work and consultant
responsibilities. Quality control
is performed prior to submittals
as indicated below. We have
LGHQWLÀHGDVSHFLDOL]HG4$
QC Manager that is not part of
the design team to review and
ensure the quality performance.













 
C.4.c
Packet Pg. 83
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

SUBMITTAL APPROACH / PROJECT APPROACH
SOQ for Civil/Structural Design Services for
Infrastructure Projects 11 BKF ENGINEERS

ADDITIONAL SUPPORT

PROVIDED BY
%.)(QJLQHHUVBSKGeotechnical Engineer'71Electrical/SCADA%LJJV&DUGRVDStructural Engineer*DWHV $VVRFLDWHVLandscape Architect &LYLO'HVLJQ
LQFOXGLQJ6WUHHW6HZHU6WRUP
'UDLQ,PSURYHPHQWV
Curb, gutter, sidewalk and driveways O
Street pavement design O O
Grading and drainage design O O
:HW8WLOLW\'HVLJQDQG
+\GURORJ\+\GUDXOLFV6WXGLHV
Water Supply, Storage & Distribution System O O
Sanitary Sewer System, Storage and Treatment Facility O O Storm Drain System and Storage/Detention Basin O
6WUXFWXUDO
Bridge/Steel Structures O O
Drainage Structures O O
Building Structures O O
Special Foundation Design O O
Slope Design and Stability O O
7UD෈FDQG(OHFWULFDO
7UD඼F6LJQDO
1HZDQG0RGLÀFDWLRQVWR([LVWLQJ
O
Signing and Striping O
7UD඼F'HWRXU&RQWURO3ODQVDQG&RQVWUXFWLRQ3KDVLQJ O
&RPPXQLFDWLRQ&RQGXLW3ODQV
7UD඼F6LJQDO,QWHUFRQQHFW
DQG)LEHU2SWLF
 O O
7UD඼F6WXG\5HYLHZ O
Alignment Studies (Intersection, Segments) O
Street Lighting Layouts O O
Modern Roundabouts O
Joint Trench O O
/DQGVFDSH,PSURYHPHQW
Landscaping and Irrigation O O
Medians and Parkways O O
Trails O O
2XWOLQHGEHORZDUHW\SLFDOSKDVHVDQGDVVRFLDWHGWDVNVWKDWWKURXJKRXU past experience, we understand may be expected for a renovation or new FRQVWUXFWLRQ2IFRXUVHHDFKVFRSHRIZRUNZLOOEHWDLORUHGWRHDFKVSHFLÀF project assignment and will vary some. The tasks below are presented only to show the type of work that we believe could be required for Brentwood’s projects. Smaller projects may not require all tasks listed.

TYPICAL TASKS ASSOCIATED WITH ON-CALL CIVIL PROJECTS:

SCOPE OF WORK













 
C.4.c
Packet Pg. 84
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) SOQ for Civil/Structural Design Services for
Infrastructure Projects BKF ENGINEERS 12

SUBMITTAL APPROACH / QUALITY OF WORK

SAMPLE IMPROVEMENT PLAN













 
C.4.c
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

SUBMITTAL APPROACH / QUALITY OF WORK
SOQ for Civil/Structural Design Services for
Infrastructure Projects 13 BKF ENGINEERS
:HVW&RXQW\+HDOWK$QQH[
-DQXDU\

3DJHRI
%.)(QJLQHHUV
7$%/(RI&217(176
352-(&7'$7$ 352-(&76(77,1* EĂƌƌĂƚŝǀĞ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰ

džŝƐƚŝŶŐ^ŝƚĞŽŶĚŝƚŝŽŶƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰ ŽŶƐƚƌĂŝŶƚƐĂŶĚKƉƉŽƌƚƵŶŝƚŝĞƐĨŽƌ^ƚŽƌŵǁĂƚĞƌŽŶƚƌŽů͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰ /2:,03$&7'(9(/230(17'(6,*1675$7(*,(6 KƉƚŝŵŝnjĂƚŝŽŶŽĨ^ŝƚĞ>ĂLJŽƵƚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϱ hƐĞŽĨWĞƌŵĞĂďůĞWĂǀĞŵĞŶƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲ ŝƐƉĞƌƐĂůŽĨZƵŶŽĨĨƚŽWĞƌǀŝŽƵƐ;^ĞůĨͲZĞƚĂŝŶŝŶŐͿƌĞĂƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲ /ŶƚĞŐƌĂƚĞĚDĂŶĂŐĞŵĞŶƚWƌĂĐƚŝĐĞƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϲ '2&80(17$7,212)'5$,1$*('(6,*1 ĞƐĐƌŝƉƚŝŽŶŽĨ
ĂĐŚƌĂŝŶĂŐĞDĂŶĂŐĞŵĞŶƚƌĞĂ;DͿ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϳ /ŶƚĞŐƌĂƚĞĚDĂŶĂŐĞŵĞŶƚWƌĂĐƚŝĐĞ;/DWͿĞƐĐƌŝƉƚŝŽŶ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϴ dĂďƵůĂƚŝŽŶĂŶĚ^ŝnjŝŶŐĂůĐƵůĂƚŝŽŶƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϵ 6285&(&21752/0($685(6

^ŝƚĞĐƚŝǀŝƚŝĞƐĂŶĚWŽƚĞŶƚŝĂů^ŽƵƌĐĞƐŽĨWŽůůƵƚĂŶƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϵ ^ŽƵƌĐĞŽŶƚƌŽůdĂďůĞ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϵ 67250:$7(5)$&,/,7<0$,17(1$1&( KǁŶĞƌƐŚŝƉĂŶĚZĞƐƉŽŶƐŝďŝůŝƚLJĨŽƌDĂŝŶƚĞŶĂŶĐĞŝŶWĞƌƉĞƚƵŝƚLJ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϭ ^ƵŵŵĂƌLJŽĨDĂŝŶƚĞŶĂŶĐĞZĞƋƵŝƌĞŵĞŶƚƐ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϭ &216758&7,213/$1&&+(&./,67 &(57,),&$7,21 ),*85(6
&ŝŐƵƌĞϭ͗>ŽĐĂƚŝŽŶŽĨϭϯϱϴϱ^ĂŶWĂďůŽǀĞ͕^ĂŶWĂďůŽ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰ &ŝŐƵƌĞϮ͗
džŝƐƚŝŶŐŽŶĚŝƚŝŽŶ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϰ &ŝŐƵƌĞϯ͗ŝŽƌĞƚĞŶƚŝŽŶƌŽƐƐ^ĞĐƚŝŽŶ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϴ 7$%/(6
d>
ϭ͗WƌŽũĞĐƚĂƚĂ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϯ d>
Ϯ͗DĂƚĂ^ŚĞĞƚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϳ d>
ϯ͗^ŽƵƌĐĞŽŶƚƌŽů͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϵ d>
ϰ͗ŽŶƐƚƌĐƵƚŝŽŶWůĂŶ͘ϯŚĞĐŬůŝƐƚ͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘͘ϭϮ $33(1',;
WW
E/y͗EZ^^Žŝů^ƵƌǀĞLJĂƚĂ
WW
E/y͗^ƚƌŽŵǁĂƚĞƌŽŶƚƌŽů
džŚŝďŝƚ
WW
E/y͗KƵƚƉƵƚĨƌŽŵƚŚĞ/DW^ŝnjŝŶŐĂůĐƵůĂƚŽƌ

TABLE OF CONTENTS

SAMPLE STORMWATER MANAGEMENT PLAN













 
C.4.c
Packet Pg. 86
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

SUBMITTAL APPROACH / QUALITY OF WORK
SOQ for Civil/Structural Design Services for
Infrastructure Projects 14 BKF ENGINEERS

REQUIRED STATEMENTS

CONFLICT OF INTEREST
%.)KDVQRFRQÁLFWVUHJDUGLQJWKLVZRUN%.)KDVQRZRUNLQJUHODWLRQVWKDW PD\EHSHUFHLYHGDVDFRQÁLFW

CLAIMS OR LITIGATIONS
BKF has had no claims and/or litigations over the past three (3) years.

SAMPLE TECHNICAL MEMORANDUM













 
C.4.c
Packet Pg. 87
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

ATTACHMENTS / RESUMES
SOQ for Civil/Structural Design Services for
Infrastructure Projects BKF ENGINEERS
('8&$7,21
B.S., Civil Engineering,
California Polytechnic
State University, San
/XLV2ELVSR
5(*,675$7,21
Professional Civil
Engineer, CA No. 51158
Professional Civil
(QJLQHHU251R

೉3(
Professional Civil
Engineer, WA No.
20100278
Professional Civil
Engineer, UT No.
11644474-2202
4XDOLÀHG6:333
Developer (QSD)
$)),/,$7,216
LEED Accredited
Professional, U.S. Green
Building Council
727$/<($56

EXPERIENCE
\HDUVZLWKÀUP

DAN SCHAEFER, PE , LEED AP, QSD

PRINCIPAL-IN-CHARGE & PROJECT MANAGER
Dan’s 33 years of joint public and private experience provide a unique perspective to projects. He focuses on working with clients during the feasibility, alternative analysis, and planning stages to ensure that a project’s viability is considered early, as well as throughout project implementation. The result is a clear, shared vision between client and consultant. This vision, along with Dan’s experience and lessons learned, maximizes value for all his clients and enables him to implement practical solutions with clear intent.

SELECT PROJECT EXPERIENCE
Brentwood On-Call Services
Brentwood
%UHQWZRRG,QQRYDWLRQ&HQWHU0DVWHU
Plan
Brentwood
ECCFD On-Call and Ironhouse Joint
Facilities Project
Brentwood
City of Brentwood Community Center
Brentwood
Sakurai Street
Antioch
+LOOFUHVW6WDWLRQ6SHFLÀF3ODQ
Antioch
Alameda County Public Works Agency
On-Call Services
Alameda County
City of Richmond On-Call Services
Richmond
(O&HUULWR2Q&DOO(QJLQHHULQJ 30
El Cerrito
7RZQRI0RUDJD2Q&DOO6HUYLFHV
Moraga
City of Pittsburg On-Call Surveying/
Engineering Services
Pittsburg
City of San Ramon On-Call Services
San Ramon
City of Pinole On-Call Services
Pinole
CV Sanitary District On-Call
Castro Valley
City of Pittsburg On-Call Engineering/
Surveying Services (2018-20)
Pittsburg
0DVWHU&RQWUDFW5LFKPRQG2Q&DOO
Design Services 2018-2021
Richmond
City of Walnut Creek On-Call Plan
Check Services
Walnut Creek
Oakland On-Call Civil Engineering
2DNODQG
Livermore On-Call Civil & Survey
Livermore
City of San Ramon On-Call Services
San Ramon
Walnut Creek On-Call
Walnut Creek
Alameda County Development
Services Agency, On-Call Services
Hayward













 
C.4.c
Packet Pg. 88
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

ATTACHMENTS / RESUMES
SOQ for Civil/Structural Design Services for
Infrastructure Projects BKF ENGINEERS
('8&$7,21
B.S., Civil Engineering,
San Jose State University
5(*,675$7,21
Professional Civil
Engineer, CA No. 84619
$)),/,$7,216
American Society of Civil
Engineers
727$/<($56

EXPERIENCE
\HDUVZLWKÀUP

JOSEPH YOUNG, PE

DEPUTY PROJECT MANAGER
Since joining BKF Engineers, Joseph has consistently proven his strong work ethic, focus to customer service, and creative approach to all his designs. He has developed and designed many projects in the Bay Area that include conceptual design, underground utility design, site development, grading plans, construction administration, and coordination with local, state, and federal agencies.

SELECT PROJECT EXPERIENCE
Sand Creek Road Extension
Brentwood
-RKQ0XLU+HDOWK%UHQWZRRG
Outpatient Center
Brentwood
0DUVK&UHHN3HGHVWULDQ%ULGJH
2DNOH\
PG&E Antioch Service Center
Antioch
Broadway Plaza Construction
Engineering Service
Walnut Creek
CCWD District Center Building
Improvements
Concord
City of El Cerrito On-Call
El Cerrito
Hercules On-Call, Willow Avenue
Rehabilitation
Hercules
3* (0LVVLRQ6XEVWDWLRQ
San Francisco
Port of Richmond On-Call Services
Richmond
1715 Elm Street Plan Review Support
El Cerrito
Arlington/Brewster PS&E
El Cerrito
Booker T. Anderson Pedestrian Bridge
Richmond
Contra Costa Boulevard Corridor
Improvements
Pleasant Hill
Downtown Walnut Creek Sidewalk
Replacement
Walnut Creek
Nevin Avenue Pedestrian
Improvements
Richmond
San Pablo Avenue, Streets/Pedestrian
Connectivity
San Pablo
TLC Grant for Pedestrian/Bicycle
Improvements
Walnut Creek
Civic Park Bocce Courts
Walnut Creek
Elm Park
Richmond
Richmond Family Justice Center
Richmond
Richmond Swim Center
Richmond
City of El Cerrito 2019 Storm Drain
Repairs
El Cerrito













 
C.4.c
Packet Pg. 89
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

ATTACHMENTS / RESUMES
SOQ for Civil/Structural Design Services for
Infrastructure Projects BKF ENGINEERS
('8&$7,21
M.S., Civil Engineering,
San Jose State University
B.S., Civil Engineering,
The Citadel, The Military
College of South
Carolina
5(*,675$7,21
Professional Civil
Engineer, CA No. 78661
4XDOLÀHG6:333
Developer/
4XDOLÀHG6:333
Practitioner
&HUWLÀFDWH1R
$)),/,$7,216
LEED AP, U.S. Green
Building Council
American Society of Civil
Engineers
727$/<($56

EXPERIENCE
\HDUVZLWKÀUP

ALEX CROSKEY, PE, LEED AP, QSD/P

ROADWAY ENGINEER
As an engineering manager at BKF, Alex has been involved extensively in the engineering design and enhancement of projects including hospital, educational campuses, residential and commercial development, roadways, and public XWLOLWLHV+HKDVHරHFWLYHO\PDQDJHGODUJHGHVLJQWHDPVDQGZRUNHGFORVHO\ZLWK public agencies, community organizations, utility companies, institutions, and SULYDWHRZQHUVWRLQFRUSRUDWHVSHFLÀFFRQFHUQVDQGUHJXODWLRQVLQWRGHVLJQ

SELECT PROJECT EXPERIENCE
City of Brentwood On-Call Civil
Engineering (2019-22)
Brentwood
Brentwood Downtown Infrastructure
Brentwood
Sand Creek Road Extension
Brentwood
Port of Richmond Engineering
Services
Richmond
2016-2022 Alameda PW On-Call
Alameda County
California Shakespeare Theater
Renovation
2ULQGD
Farm Bureau Road Complete Streets
Plan
Concord
Grant/East Streets Pavement
Rehabilitation
Concord
Salvio Street Streetscape Project
Concord
2DN3DUNDQG0RQWLFHOOR
Improvements
Pleasant Hill
Chestnut Avenue Bicycle Boulevard
Concord
Sycamore Avenue Pavement
Rehabilitation
Hercules
6DQ/HDQGUR6WUHHWV0DSSLQJ
San Leandro
Sausalito 2016-2019 Street
Rehabilitation
Sausalito
Hesperian Boulevard Streetscape
Hayward
San Pablo/Buchanan Pedestrian
Safety Project
Albany
Columbus Parkway/Rose Drive
Benicia
0LOO9DOOH\6WUHHW6HZHU5HKDELOLWDWLRQ
Mill Valley
Sir Francis Drake Boulevard Corridor
Rehabilitation
San Rafael
0LOOHU$YHQXH6WUHHWVFDSH
Implementation Plan
Mill Valley
Final Design Napa Junction Road
American Canyon
St. Helena Downtown Improvements
St. Helena













 
C.4.c
Packet Pg. 90
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

ATTACHMENTS / RESUMES
SOQ for Civil/Structural Design Services for
Infrastructure Projects BKF ENGINEERS
('8&$7,21
M.S., Civil Engineering,
San Jose State University
%6+LJKZD\DQG7UD඼F
Engineering, Tonji
University, Shanghai,
China
5(*,675$7,21
Professional Civil
Engineer, CA No. 57006
727$/<($56

EXPERIENCE
\HDUVZLWKÀUP

JEFF WANG, PE

TRAFFIC ENGINEER
-HරKDV\HDUVRIH[SHULHQFHLQWKHÀHOGRIWUDQVSRUWDWLRQHQJLQHHULQJ+H LVDQH[SHUWLQJHRPHWULFGHVLJQWUD඼FVLJQDOGHVLJQLQWHUVHFWLRQDQDO\VLV signing and striping plans, construction detour design, and staged construction SODQSUHSDUDWLRQ-HරH[SHULHQFHLQFOXGHVWKHGHVLJQRIWKRXVDQGVRIPLOHVRI roadway in the San Francisco Bay Area and Central Valley for both public and private sector clients. He has the reputation of providing innovative solutions and optimizing the design by meeting the project operational requirements and minimizing costs.

SELECT PROJECT EXPERIENCE
CD Building Parking Lot Addition
Brentwood
Highway 4 & Nancy St. Intersection
Brentwood
Hwy 4 & Sunset Rd./Intersection
Improvements
Brentwood
Lone Tree Way Undercrossing @
UPRR
Brentwood
L Street Bikeway and Streetscape
Improvement Project
Antioch
SR 4 East Widening, Contra Loma Blvd
to G Street
Antioch
Phillips Road Extension
Antioch
.DLVHU$QWLRFK2ઊ6LWH,PSURYHPHQW
Plan
Antioch
2DNOH\'RZQWRZQ0DLQ6W
Improvements
2DNOH\
Oakley Laurel/Rose Intersection &
Signalization
2DNOH\
Oakley Recreation Center Project
2DNOH\
East County Hall of Justice
Dublin
Gilroy Bus Stop-Arroyo Circle at
Camino Arroyo
Gilroy
Newark Town Center
Newark
Santa Clara County Civic Center
0DVWHU3ODQ
San Jose
Oakland On-Call Civil Engineering
2DNODQG
33rd 0DFGRQDOG,QWHUVHFWLRQ76 
Bulbout Project
Richmond
Cerrito Creek Greenway Project
El Cerrito
Downtown Gateway Plaza Roadway &
Parking Lot Project
2DNOH\
El Cerrito City Hall
El Cerrito
Honda Port of Entry
Richmond
0DF'RQDOG$YH&RUULGRU
Richmond
0DFGRQDOG$YHQXH6WUHHWVFDSH
Richmond
0DULQD%D\3DUNZD\*UDGH6HSDUDWLRQ
Richmond
2DN3DUN 0RQWLFHOOR,PSURYHPHQWV
Pleasant Hill













 
C.4.c
Packet Pg. 91
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

ATTACHMENTS / RESUMES
SOQ for Civil/Structural Design Services for
Infrastructure Projects BKF ENGINEERS
('8&$7,21
B.S., Civil Engineering,
University of California,
Davis
5(*,675$7,21
Professional Civil
Engineer, CA No. 81983
4XDOLÀHG6:333
Developer No. 26096
$)),/,$7,216
American Society of Civil
Engineers (ASCE) former
member
727$/<($56

EXPERIENCE
\HDUVZLWKÀUP

ERIK MORENO, PE, QSD/P

WATER RESOURCES ENGINEER
Erik has over a decade of water resources engineering experience in the Francisco Bay Area, working for both the public and private sectors. He has a wide range of project experience that includes stormwater management planning, hydrologic and hydraulic modeling, green and grey stormwater infrastructure design, creek and river restorations, stormwater monitoring, and third-party technical review.

SELECT PROJECT EXPERIENCE
Castro Valley Sanitary District On-Call
Castro Valley
'RZQWRZQ0DLQ6WUHHW,PSURYHPHQWV
2DNOH\
Del Norte TOD Complete Streets
Improvement Project
El Cerrito
Saratoga Via Regina Road
Improvements
Saratoga
%RDUGZDON3ODFH&UHHN0LWLJDWLRQ
San Ramon
Delta Coves, Bethel Island
2DNOH\
Laguna Creek Restoration, Preliminary
Engineering & Environmental
Planning
Moraga
940 Commercial Street San Carlos
Drainage Evaluation
San Carlos
0LVVLRQ%D\3XPS6WDWLRQ
San Francisco
%RDUGZDON3ODFH&UHHN0LWLJDWLRQ
San Ramon
1304 ECR Recycled Water Report
Redwood City
1601 ECR Dual Plumbing Report
Redwood City
A2 - Phase 2 Drainage Improvements
Hillsborough
Cañada Road Drainage Improvements
Woodside
Casa Baywood Creek Bank
Stabilization
San Mateo
EBRPD Anthony Chabot Regional Park
Sewerage System improvements
Castro Valley
Laguna Creek Restoration -
Preliminary Engineering &
Environmental Planning
Moraga
/DWKURS&URVVURDGV0XUSK\
Parkway Storm Drain Review
Lathrop
Lookout Road Drainage
Improvements
Hillsborough
0DULQ&LW\3RQG)ORRG5HGXFWLRQ
Marin
0LVVLRQ%D\6WRUP'UDLQ3XPS
6WDWLRQ
San Francisco
Rehabilitation of Storm Drain Outfall
Sunnyvale
Treasure Island Stage 2 & 3
6WRUPZDWHU0DQDJHPHQW
Treasure Island













 
C.4.c
Packet Pg. 92
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

ATTACHMENTS / RESUMES
SOQ for Civil/Structural Design Services for
Infrastructure Projects BKF ENGINEERS
('8&$7,21
B.S., Civil Engineering,
California Polytechnic
State University, San
/XLV2ELVSR
5(*,675$7,21
Professional Civil
Engineer, CA No. 79197
727$/<($56

EXPERIENCE
\HDUVZLWKÀUP

MICHAEL STEELE, PE, LEED AP

BUILDINGS & SITE WORK ENGINEER
Michael’s experience provides the knowledge to manage and prepare detailed planning and construction documents for a wide range of projects, including public roadways, utility infrastructure, site development projects, and community and park facilities throughout the San Francisco Bay Area. Michael focuses on adding value to projects by understanding client expectations and goals, being a strong advocate for clients and projects throughout the design and construction process, and delivering designs that utilize creative and pragmatic problem solving.

SELECT PROJECT EXPERIENCE
Brentwood Water Emergency Back-up
Generators
Brentwood
530 Sand Creek Road
Brentwood
5DLQÁRZ&DU:DVK
Brentwood
&RZHOO5DQFK-RKQ0DUVK6WDWH
Historic Park
Brentwood
New Deca Deal
Antioch
Somersville Towne Center
Antioch
2101 Loveridge
Pittsburg
Concord Villages
Concord
&RUWVHQ5RDG3DUFHO0DS
Pleasant Hill
2DN3DUNDQG0RQWLFHOOR
Improvements
Pleasant Hill
Rossmoor Facilities Plan
Walnut Creek
850 Seven Hills Ranch Road
Walnut Creek
Carmel Drive
Walnut Creek

10DLQ0L[HG8VH
Walnut Creek
&RQWUD&RVWD&RXQW\6KHULઊ%XLOGLQJV
Martinez
6115 Potrero Avenue
El Cerrito
%URZQ$YHQXH7UDઋF6LJQDO
Lafayette
FORA On-Call Engineering
Monterey
0XQLFLSDO&RPPXQLFDWLRQV1HWZRUN
Richmond
Port of Richmond On-Call Service
Richmond
Richmond Engineering On-Call
Services
Richmond
1188 East 14th Street
San Leandro













 
C.4.c
Packet Pg. 93
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

ATTACHMENTS / RESUMES
SOQ for Civil/Structural Design Services for
Infrastructure Projects BKF ENGINEERS
('8&$7,21
B.S., Civil Engineering,
University of California,
Los Angeles
5(*,675$7,21
Professional Civil
Engineer No. 62281
Professional Civil
(QJLQHHU251R
96835PE
Professional Civil
Engineer, WA No.
20119813
4XDOLÀHG6:333
Developer and
Practitioner (QSD/P),
No. 20316
$)),/,$7,216
LEED Accredited
Professional,
U.S. Green Building
Council
American Society of
Civil Engineers
727$/<($56

EXPERIENCE
\HDUV
ZLWKÀUP

JASON WHITE, PE, LEED AP, QSD/P

QA/QC MANAGER
Jason has worked on projects of varying sizes across many market sectors throughout his 25-year career, from supporting local agencies with curb ramp replacements to 500-acre master planned communities. He continues to act as a trusted advisor to clients across many industries including healthcare, educational, industrial, residential, and public agencies. His passion lies in utilizing a collaborative process for the development of infrastructure design solutions that are reliable, sustainable, and constructible. Jason is able to leverage his breadth of experience to address the unique challenges that today’s institutions face as they plan for the future.

SELECT PROJECT EXPERIENCE
Hercules Hilltown Plan Review
Hercules
City of Pinole On-Call Engineering
Services
Pinole
City of Berkeley On-Call Engineering
Services
Berkeley
City of Seaside On-Call Land
Development Services
Seaside
CCWD District Center Building
Improvements
Concord
+HUFXOHV2Q&DOO0XLU3RLQWH)LQDO
Development Plan
Hercules
PG&E Facility On-Call
San Francisco
Richmond Engineering On-Call
Services
Richmond
Walnut Creek Plan Check Engineering
Walnut Creek
10810 San Pablo Avenue Plan
Review
El Cerrito
El Cerrito On-Call Engineering &
30
El Cerrito
PG&E Service Center
Antioch
-RKQ0XLU+HDOWK&RQFRUG
Concord
-RKQ0XLU+HDOWK0DVWHU$JUHHPHQW
Walnut Creek
1313 Galindo
Concord
Connect Orinda
2ULQGD
-RKQ0XLU+HDOWK%UHQWZRRG
Outpatient Center
Brentwood
%DUUHWW$YHQXH3DUFHO0HUJHU3ODQ
Review
El Cerrito
Broadway Plaza Construction
Engineering Service
Walnut Creek
3* (0DVWHU6HUYLFHV$JUHHPHQW
San Ramon
10810 San Pablo Avenue Plan Review
El Cerrito













 
C.4.c
Packet Pg. 94
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

ATTACHMENTS / RESUMES
SOQ for Civil/Structural Design Services for
Infrastructure Projects BKF ENGINEERS
('8&$7,21
M.S., Civil Engineering,
University of Idaho
B.S., Civil Engineering,
University of Idaho
5(*,675$7,21
Geotechnical Engineer,
CA No. 2756
Civil Engineer, CA No.
64025
Civil Engineer, NV No.
27349
$)),/,$7,216
American Public Works
Association (APWA)
Northern California
Chapter
American Society of Civil
Engineers, San Francisco
Geo-Institute
727$/<($56

EXPERIENCE
21 years, 8 with BSK
%6.$662&,$7(6

CRISTIANO MELO, PE, GE

PRINCIPAL GEOTECHNICAL ENGINEER
Cristiano is a licensed Civil and Geotechnical Engineer in the State of California with over 20 years of engineering experience throughout the San Francisco Bay $UHDDQG&HQWUDO9DOOH\+HVHUYHVDV%6.·V/LYHUPRUHR඼FHEUDQFKPDQDJHUDQG principal engineer. His experience focuses on geotechnical investigations and materials testing for primarily public sector clients with numerous public works/ capital improvements projects to include the typical projects which fall under on-call contracts: roadway improvements, pipelines and utility corridor projects, bridges, trails/pedestrian improvements, parks, sanitary sewer rehabilitations, associated vertical structures, emergency repairs, and peer review, to name a few. He manages numerous on-call contracts with public agencies to include the Cities of Brentwood, Berkeley, San Ramon, Walnut Creek, Dublin, Belmont, Contra Costa County Public Works, and Hayward Area Recreation and Park District.

SELECT PROJECT EXPERIENCE
Park Road Improvements and
Widening
Benicia
Vasco Road Safety Improvements
Unincorporated Contra Costa County
Lowell Avenue and Lincoln Boulevard
Pavement Rehabilitation
Tracy
CCTA, State Route 4/Sand Creek Road
Interchange
Brentwood
San Pablo Avenue Sanitary Sewer
Rehabilitation
Berkeley
6WDQOH\0XUULHWD6WRUP'UDLQ
Livermore
Delta Diablo, Pump Station Assessment
and Upgrades
Pittsburg, Antioch
0LG3HQLQVXOD:DWHU'LVWULFW:DWHU
0DLQ5HSODFHPHQW
San Carlos, Belmont
ACWD, Curtner Road/Canyon Heights
Booster Stations
Fremont

New Ferry Point Pump Station
Richmond
0XQLFLSDO6HUYLFH&HQWHU
Brentwood
Oakley Recreation Center
2DNOH\
1HZ3ROLFH+HDGTXDUWHUV
Vallejo
Intermodal Facility
Martinez
)LUH6WDWLRQ
2DNOH\
Alhambra Valley Road Bridge
Replacement, Washout Repair
Martinez
Happy Valley Road Embankment Repair
Unincorporated Contra Costa County
Fallon Sports Park Ph. III
Dublin
H.A.R.D., Via Toledo Park
Hayward
0F&R\&UHHN7UDLO3KDVH,,
Suisun City













 
C.4.c
Packet Pg. 95
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

ATTACHMENTS / RESUMES
SOQ for Civil/Structural Design Services for
Infrastructure Projects BKF ENGINEERS
('8&$7,21
B.S., Landscape
Architecture, University
of California, Davis
5(*,675$7,21
Landscape Architect
#4721, California
$)),/,$7,216
California Parks and
Recreation Society
727$/<($56

EXPERIENCE
\HDUVZLWKÀUP
*$7(6 $662&,$7(6

CHUCK GARDELLA, RLA

LANDSCAPE ARCHITECT
Chuck has worked on a wide range of public and private projects with a focus on construction documentation and administration. He has managed many projects in his 24 years of experience and is highly familiar with their unique issues. Chuck is well versed in the design of LEED, CHPS, and Bay-Friendly projects. He is a Bay- )ULHQGO\4XDOLÀHG/DQGVFDSH3URIHVVLRQDODQGWKHUHIRUHKDVH[WHQVLYHVXVWDLQDEOH design expertise.

SELECT PROJECT EXPERIENCE
&LW\RI0LOOEUDH0LOOEUDH5HFUHDWLRQ
Center Landscape Design Review
Millbrae
Steinberg Group, Northside Library
Santa Clara
Colma Police Facility
Colma
Almaden Library and Community
Center
San Jose
Berryessa Library
San Jose
West Sacramento Community Center
West Sacramento
5-Way Intersection Roundabout
Healdsburg
Highway 101 at Airport Boulevard
Sonoma County
City of Pleasanton, I-580/ El Camino
Interchange
Pleasanton
I-680 / Bernal Improvements
Pleasanton
0DULQD%D\*UDGH6HSDUDWLRQ
Richmond
Stoneridge Drive Extension
Richmond
Simon Premium Outlets, San
Francisco Premium Outlets Drive
Livermore
061&
Petaluma
0610LWLJDWLRQ 2UDQJH$YHQXH
Soundwall; Novato & Unincorporated
County of Marin
SR 92/ 82 El Camino Interchange
San Mateo
Santa Clara Valley Transportation, VTA
0DWKLOGD$YHQXH/DQGVFDSLQJ3URMHFW
Sunnyvale
Plymouth & Space Realignment
Mountain View
Warm Springs Bart Plaza & West Side
Bridge Access
Fremont
&ROOHJHRI6DQ0DWHR(GLVRQ/RW
San Mateo
La Gonda Bridge
Danville
%D\IDLU0DOO3DUNLQJ/RW5HYLVLRQV
San Mateo













 
C.4.c
Packet Pg. 96
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

ATTACHMENTS / RESUMES
SOQ for Civil/Structural Design Services for
Infrastructure Projects BKF ENGINEERS
('8&$7,21
B.S., Architectural
Engineering, California
Polytechnic University,
6DQ/XLV2ELVSR
5(*,675$7,21
Professional Engineer,
CA, No. C39948
Structural Engineer, CA,
No. S3302
727$/<($56

EXPERIENCE
\HDUVZLWKÀUP
%,**6&$5'26$$662&,$7(6
THOMAS L. SWAYZE, PE , SE

STRUCTURAL PROJECT MANAGER
Tom Swayze has over 30 years of professional structural engineering design and management experience. After graduating from California Polytechnic State University, he began his career engineering commercial buildings. He soon expanded his focus to include all types of infrastructure and building projects.

Tom’s responsibilities include client development, contract negotiations, project VWD඼QJSURMHFWVFKHGXOLQJVXSHUYLVLRQRISURMHFWHQJLQHHUVDQGGUDIWVPHQ quality control and job cost control for projects under his supervision.

SELECT PROJECT EXPERIENCE
San Jose Airport Aircraft Rescue and
Fire Fighting Facility (ARFF Fire Station
20)
San Jose
Vallejo Water District, Vallejo Dams
Maintenance Platform and Hoist
Vallejo
Maximus Park, Merced Pedestrian
2YHUFURVVLQJ
San Francisco
1HZDUN8QLÀHG6FKRRO'LVWULFW+$
Snow Elementary School Foundation
Assessment and Rehabilitation
Newark
Senior Center Bridge Railing
Replacement
Napa
Sand Creek Bridge
Brentwood
1HZDUN8QLÀHG6FKRRO'LVWULFW
Newark Junior High School
Newark
Cambridge Parking Structure
Assessment
Palo Alto
:HVW&OLઊ6ORSH6WDELOL]DWLRQ
Capitola
4th Street Bridge Peer Review
San Francisco
6)07$&HQWUDO6XEZD\6HZHU/LQH
Rehabilitation
San Francisco
6HQHFD/DQH0XGVOLGH6HZHU
Stabilization-Tie-back Walls
San Mateo County
Caltrans, Sonoma Creek Bridge
6HLVPLF5HWURÀW
Solano and Sonoma Counties
Alpine Road Slide Repairs and Creek
Re-route
San Mateo County
Napa Pipe Development Bridges.

Diagonal Ditch and Bedford Slough
Napa
:HVW&RQWUD&RVWD8QLÀHG6FKRRO
District, Sylvester Greenwood
Academy
Richmond
Corporation Yard
Santa Cruz
San Jose Fire Training Facility and
Emergency Operations Center
San Jose
Tara Creek Soil Nail Walls
San Pablo
San Rafael Public Safety Center
San Rafael













 
C.4.c
Packet Pg. 97
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

ATTACHMENTS / RESUMES
SOQ for Civil/Structural Design Services for
Infrastructure Projects BKF ENGINEERS
('8&$7,21
M.S., Electrical
Engineering, Power
Systems, Santa Clara
University
B.S., Electrical
Engineering, Power
Systems, San Francisco
State University
5(*,675$7,21
Professional Electrical
Engineer, CA No. 10687
Professional Control
Systems Engineer, CA
No. 7072
Professional Fire
Protection Engineer, CA
No. 1317
$)),/,$7,216
Life Member ISA, IEEE,
NFPA
727$/<($56

EXPERIENCE
46 years, 22 with DTN
'71(1*,1((56

DIEP NGUYEN, PE

ELECTRICAL ENGINEER
Diep has over 46 years of practical experience and has provided hands-on electrical, instrumentation and control system design and construction startup support services in mostly public funded projects. His expertise includes the design and construction support of electrical systems including low and medium voltage power distribution, system grounding, low and medium voltage variable IUHTXHQF\GULYHVOLJKWLQJÀUHDODUPDQGVHFXULW\V\VWHPVXQGHUJURXQGGXFW bank systems, emergency and standby power systems, Photovoltaic (PV) Systems. +LVH[SHUWLVHDOVRLQFOXGHVGHVLJQDQGVSHFLÀFDWLRQVRISURFHVVLQVWUXPHQWDWLRQ and wired and wireless control systems ranging from programmable logic controller (PLC) networks, supervisory control and data acquisition (SCADA) systems to conventional Distributed Control System (DCS) control systems which LQFOXGHVRIWZDUHHQJLQHHULQJDQGFRPSXWHUQHWZRUNFRQÀJXUDWLRQ

SELECT PROJECT EXPERIENCE
Hesperian Blvd Streetscape Project
San Leandro
City of Oakland LED Street Light
Replacement Project
2DNODQG
Oakland Coliseum Lighting
Improvement Project
2DNODQG
Berkeley South Cove Lighting
Improvement Project
Berkeley
6DXVDOLWR0DULQ&LW\6DQLWDU\'LVWULFW
0DLQ::73([SDQVLRQ5HPRWH
Pump Stations Emergency Power
Upgrade
Sausalito
SFPUC Ground Water Supply Phase 1
and 2
San Francisco
SFPUC Treasure Island Remote Pump
Stations Project
San Francisco
SFPUC Recycled Water Pump Station
Project
San Francisco













 
C.4.c
Packet Pg. 98
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

ATTACHMENTS / RESUMES
SOQ for Civil/Structural Design Services for
Infrastructure Projects BKF ENGINEERS
('8&$7,21
B.A., Environmental
Studies and Global
Studies, University of
California, Santa Barbara
$)),/,$7,216
Association of
Environmental
Professionals
American Planning
Association
American Institute of
&HUWLÀHG3ODQQHUV
727$/<($56

EXPERIENCE
\HDUVZLWKÀUP
'$9,'-32:(56 $662&,$7(6

WILL BURNS, AICP

ENVIRONMENTAL CONSULTANT
Will Burns is a Vice President and Principal Project Manager for the company DQGKDV\HDUVRIH[SHULHQFHLQWKHHQYLURQPHQWDOÀHOGSUHSDULQJGRFXPHQWV for both private and public sector projects. His project experience includes URDGZD\ZLGHQLQJDQGPRGLÀFDWLRQEULGJHUHSODFHPHQWVPXOWLXVHSDWKZD\ and pedestrian/bicycle safety projects. Will is an expert in managing the environmental process to meet the requirements of Caltrans and local, State, and federal permitting agencies.

SELECT PROJECT EXPERIENCE
U.S. Highway 101 BPOC IS/CE
Santa Rosa
- Principal/Project Manager for the preparation of a CEQA IS and NEPA CE with Caltrans and the City of Santa Rosa for a bike and pedestrian bridge over U.S. 101
- Technical reports/memos required by Caltrans include noise, air quality, ELRORJLFDOFXOWXUDOYLVXDOLPSDFWFRPPXQLW\LPSDFWWUD඼FKD]DUGRXV materials, and hydraulics.

Grand Boulevard Improvements NEPA/CEQA
South San Francisco
- Project Manager for preparation of Caltrans technical memos for air quality, biological resources, and visual impacts resulting from multi-modal improvements to El Camino Real in the City of South San Francisco - Project also required preparation of NEPA and CEQA CEs Churchill Avenue/El Camino Real Intersection Improvements CE Palo Alto
- Principal for preparation of a CEQA CE for the City of Palo Alto - Project included several bicycle and pedestrian improvements within the existing right-of-way along Churchill Avenue
- Preparation of the Notice of Exemption and overseeing the preparation of a Background & Assumptions Memo for the project detailing why the project TXDOLÀHGIRUD&ODVV,([LVWLQJ)DFLOLWLHV&(













 
C.4.c
Packet Pg. 99
Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

BKF ENGINEERS

PROFESSIONAL SERVICES RATE SCHEDULE
EFFECTIVE MARCH 28, 2022

CLASSIFICATION HOURLY RATE

PROJECT MANAGEMENT
Principal/Vice President $272.00
Senior Associate/Vice President $244.00
Associate $237.00
Senior Project Manager | Senior Technical Manager $237.00 Project Manager | Technical Manager $231.00
Engineering Manager | Surveying Manager | Planning Manager $213.00

TECHNICAL STAFF
Senior Project Engineer | Senior Project Surveyor | Senior Project Planner $198.00 Project Engineer | Project Surveyor | Project Planner $174.00 Design Engineer | Staff Surveyor | Staff Planner $151.00 BIM Specialist I, II, III $151.00 - $174.00 - $198.00
Technician I, II, III, IV $144.00 - $153.00 - $168.00 - $181.00 Drafter I, II, III, IV $113.00 - $124.00 - $134.00 - $149.00 Engineering Assistant | Surveying Assistant | Planning Assistant $94.00

FIELD SURVEYING
Survey Party Chief $198.00
Instrument Person $170.00
Survey Chainperson $127.00
Utility Locator I, II, III, IV $103.00 - $146.00 - $175.00 - $199.00 Apprentice I, II, III, IV $78.00 - $105.00 - $116.00 - $123.00

CONSTRUCTION ADMINISTRATION
Senior Consultant $259.00
Senior Construction Administrator $225.00
Resident Engineer $167.00
Field Engineer I, II, III $151.00 - $174.00 - $198.00

PROJECT ADMINISTRATION
Project Coordinator $126.00
Senior Project Assistant $109.00
Project Assistant $96.00
Clerical | Administrative Assistant $81.00
Expert witness rates are available upon request.

Subject to the terms of a services agreement:
x Charges for outside services, equipment, materials, and facilities not furnished directly by BKF Engineers will be billed as reimbursable expenses at cost plus 10%. Such charges may include, but shall not be limited to:
printing and reproduction services; shipping, delivery, and courier charges; subconsultant fees and expenses; agency fees; insurance; transportation on public carriers; meals and lodging; and consumable materials.
x Allowable mileage will be charged at the prevailing IRS rate per mile. x Monthly invoices are due within 30 days from invoice date. Interest will be charged at 1.5% per month on past due accounts.
x The rates shown are subject to periodic increases, including January 1st of each year. 












 
C.4.c
Packet Pg. 100 Attachment: BKF Engineers Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) PSA_City Attorney Approved Version 040821

AGREEMENT FOR ON-CALL CIVIL/STRUCTURAL DESIGN SERVICES
CSG Consultants, Inc.

THIS AGREEMENT is made and entered into as of the _____ day of __________________, 2022 by and between the City of Brentwood, a municipal corporation of the State of California ("City"), and CSG Consultants, Inc. an S Corporation ("Consultant") (each a “Party” and collectively, the “Parties”).

RECITALS
A. City requires the professional services of a consultant specifically trained and experienced in civil/structural design services, which are professional services outside of services offered by City.

B. Consultant has the professional skills and experience necessary to perform the services described in this Agreement.

C. Consultant customarily engages in these services as part of its independently established trade, occupation, and/or business, separately from its work for City.

D. City desires to engage Consultant to provide these services by reason of its qualifications and experience in performing such services
E. Consultant has submitted a proposal to City and has affirmed its willingness and ability to perform such work on the terms and manner set forth in this Agreement.

NOW, THEREFORE, in consideration of these recitals and the mutual covenants contained herein, the Parties agree as follows:

1. Scope of Work.

1.1 City retains Consultant, as an independent contractor, to perform, and Consultant agrees to render, those services (the "Services") that are described in the attached Exhibit "A," which is incorporated by this reference, pursuant to this Agreement’s terms and conditions.

1.2 Consultant will control the manner and the means of the work to be performed, and be responsible for the professional quality, technical accuracy and coordination of the Services. Consultant will, without additional compensation, correct or revise any errors or deficiencies in the Services.

1.3. Consultant will keep City informed on a regular basis that the Services are being performed in accordance with the requirement and intentions of this Agreement.

1.4 If applicable, Consultant has designated those persons listed in Exhibit “A” to provide the Services to the City. Consultant will not change or reassign those persons described in Exhibit “A” without prior written notice to City, and will not replace those individuals with individuals to whom City has a reasonable objection.

2. Standard of Performance. Consultant acknowledges that in entering into this Agreement the City is relying on Consultant's special skills and experience to do and perform the Services. While performing the Services, Consultant will exercise the reasonable professional care and skill customarily exercised by reputable members of Consultant's profession practicing in the Northern California area. The acceptance of the Services by City does not release Consultant from these obligations.

Consultant will be responsible for employing or engaging all persons necessary to perform the Services.

Consultant will control the manner and means of the services to be performed by its employees and subconsultants. All of Consultant's staff will be qualified by training and experience to perform their assigned tasks. Consultant will give its personal attention to the fulfillment of the provisions of this Agreement by all of its employees and subcontractors, if any, and will keep the Services under its control. 





 
 





C.4.d
Packet Pg. 101 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 2 PSA_City Attorney Approved Version 040821
On demand of City, if any employee or subcontractor of Consultant fails or refuses to carry out the provisions of this Agreement or appears to be incompetent or to act in a disorderly or improper manner, he or she will be discharged immediately from the Services.

3. Term. Unless earlier terminated, the term of this Agreement will be effective for a period of one year from the date first above written. The City Manager may amend the Agreement to extend it for two additional one-year periods or parts thereof in an amount not to exceed one hundred thousand dollars ($100,000) per Agreement year. Extensions will be based upon a satisfactory review of Consultant's performance, City needs, and appropriation of funds by the City Council. The parties will prepare a written amendment indicating the effective date and length of the extended Agreement.

4. Schedule. Consultant will generally adhere to the schedule set forth in Exhibit “A” provided, that City will grant reasonable extensions of time for the performance of the Services occasioned by unusually lengthy governmental reviews of Consultant’s work product or other unavoidable delays occasioned by unforeseen circumstances; provided, further, that such unavoidable delay will not include strikes, lockouts, work stoppages, or other labor disturbances conducted by, or on behalf of, Consultant’s officers or employees.

Consultant acknowledges the importance to City of City’s project schedule and agrees to put forth its best professional efforts to perform the Services in a manner consistent with that schedule. City understands, however, that Consultant’s performance must be governed by sound practices. Consultant will work such overtime or engage such personnel and equipment as necessary to maintain the schedule, without additional compensation.

5. Compensation.

5.1 The total fee payable for the Services to be performed during the term of this Agreement will be a not to exceed amount of one hundred thousand dollars ($100,000) as may be further specified in the attached Exhibit “A.” No other compensation for the Services will be allowed except for items covered by subsequent amendments to this Agreement. The City reserves the right to withhold a ten percent (10%) retention until City has accepted the Services.

5.2 Payment will occur only after receipt by City of invoices sufficiently detailed to include hours performed, hourly rates, and related activities and costs for approval by City.

5.3 Within thirty (30) days after receipt of any applicable progress payment request, City will verify the accuracy of the request, correct the charges where appropriate, and make payment to Consultant in an amount equal to the amount of such application, as verified or corrected by City. No payment made prior to completion and acceptance of the Services will constitute acceptance of any part of the Services.

City reserves the right to withhold payment from Consultant on account of Services not performed satisfactorily, delays in Consultant's performance of Services, or other defaults hereunder.

6. Status of Consultant. Consultant will perform the Services as an independent contractor, free from the control and direction of City, in pursuit of Consultant’s independent calling, and not as an employee of City. The persons used by Consultant to provide the Services under this Agreement will not be considered employees of City for any purposes whatsoever and City will not pay any tax, workers’ compensation insurance, retirement contributions or unemployment contributions on behalf of Consultant or its employees or subcontractors. Consultant agrees to indemnify and pay City within thirty (30) days for any tax, retirement contribution, social security, overtime payment, unemployment payment or workers’ compensation payment, including, but not limited to, those based on any provision of the Federal Affordable Care Act, which City may be required to make on behalf of Consultant or any agent, employee, or contractor of Consultant for work done under this Agreement. The payment made to Consultant pursuant to the Agreement will be the full and complete compensation to which Consultant is entitled. City will not make any federal or state tax withholdings on behalf of Consultant or its agents, employees or subcontractors.

At the City’s election, City may deduct the amounts paid pursuant to this Section, from any balance owing to Consultant.






 
 





C.4.d
Packet Pg. 102 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 3 PSA_City Attorney Approved Version 040821

7. Subcontracting. Consultant's services are being requested by City because they are unique and personal. Except as may be specified in Exhibit “A”, Consultant will not subcontract any portion of the Services without prior written approval of City Manager or his/her designee. If Consultant subcontracts any of the Services, Consultant will be fully responsible to City for the acts, errors and omissions of Consultant's subcontractor and of the persons either directly or indirectly employed by the subcontractor, as Consultant is for the acts and omissions of persons directly employed by Consultant. Nothing contained in this Agreement will create any contractual relationship between any subcontractor of Consultant and City.

Consultant will be responsible for payment of subcontractors. Consultant will bind every subcontractor and every subcontractor of a subcontractor by the terms of this Agreement applicable to Consultant's work unless specifically noted to the contrary in the subcontract and approved in writing by City.

8. Other Consultants. The City reserves the right to employ other consultants in connection with the Services.

9. Indemnification. Consultant agrees to indemnify, including the cost to defend, City, its officers, agents, volunteers and employees from any and all claims, demands, costs or liability that arise out of, or pertain to, or relate to the negligence, recklessness, or willful misconduct of Consultant and its agents in the performance of services under this Agreement, but this indemnity does not apply to liability for damages for death or bodily injury to persons, injury to property, or other loss, arising from the sole negligence, willful misconduct or defects in design by City or the agents, servants, or independent contractors who are directly responsible to City, or arising from the active negligence of City.

10. Insurance. Consultant will obtain and maintain, at its cost and expense, for the duration of the Agreement and any and all amendments, insurance against claims for injuries to persons or damage to property which may arise out of or in connection with performance of the Services by Consultant or Consultant’s agents, representatives, employees or subcontractors. The insurance will be obtained from an insurance carrier admitted and authorized to do business in the State of California. The insurance carrier is required to have a current Best's Key Rating of not less than "A:VII."

10.1 Coverages and Limits. Consultant will maintain the types of coverages and minimum limits indicated below, unless Risk Manager or City Manager, in consultation with the City Attorney approves a lower amount. These minimum amounts of coverage will not constitute any limitations or cap on Consultant's indemnification obligations under this Agreement. City, its officers, agents, volunteers and employees make no representation that the limits of the insurance specified to be carried by Consultant pursuant to this Agreement are adequate to protect Consultant. The coverage will contain no special limitations on the scope of its protection to the above-designated insureds except for Workers Compensation and errors and omissions insurance. Consultant will obtain occurrence coverage, excluding Professional Liability, which will be written as claims-made coverage. If Consultant believes that any required insurance coverage is inadequate, Consultant will obtain such additional insurance coverage, as Consultant deems adequate, at Consultant's sole expense.

10.1.1 Commercial General Liability Insurance. $2,000,000 combined single-limit per occurrence for bodily injury, personal injury and property damage. If the submitted policies contain aggregate limits, general aggregate limits will apply separately to the work under this Agreement or the general aggregate will be twice the required per occurrence limit.

10.1.2 Automobile Liability. $1,000,000 combined single-limit per accident for bodily injury and property damage.

10.1.3 Workers' Compensation and Employer's Liability. Workers' Compensation limits as required by the California Labor Code and Employer's Liability limits of $1,000,000 per accident for bodily injury. Workers' Compensation and Employer's Liability insurance will not be required if Consultant has no employees and provides, to City's satisfaction, a declaration stating this. 





 
 





C.4.d
Packet Pg. 103 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 4 PSA_City Attorney Approved Version 040821

10.1.4 Professional Liability. Errors and omissions liability appropriate to Consultant’s profession with limits of not less than $1,000,000 per claim.

10.2 Endorsements. For Commercial General Liability Insurance, Consultant will ensure that the policies are endorsed to name the City, its officers, agents, volunteers and employees as additional insureds. Prior to City's execution of this Agreement, Consultant will furnish, to the satisfaction of the City, certificates of insurance and endorsements.

10.3 Cancellation. Insurance will be in force during the life of the Agreement and any extensions of it and will not be canceled without thirty (30) days prior written notice to City sent pursuant to the notice provisions of this Agreement.

10.4 Failure to Maintain Coverage. If Consultant fails to maintain any of these insurance coverages, then City will have the option to declare Consultant in breach of this Agreement, or may purchase replacement insurance or pay the premiums that are due on existing policies in order to maintain the required coverages. Consultant is responsible for any payments made by City to obtain or maintain insurance and City may collect these payments from Consultant or deduct the amount paid from any sums due Consultant under this Agreement.

10.5 Submission of Insurance Policies. City reserves the right to require, at any time, complete and certified copies of any or all required insurance policies and endorsements.

10.6 Primary Coverage. For any claims related to the Services and this Agreement, the Consultant’s insurance coverage will be primary insurance with respect to City, its officers, agents, volunteers and employees. Any insurance or self-insurance maintained by City for itself, its officers, agents, volunteers and employees, will be in excess of Consultant’s insurance and not contributory with it.

10.7 Reduction in Coverage/Material Changes. Consultant will notify City in writing pursuant to the notice provisions of this Agreement thirty (30) days prior to any reduction in any of the insurance coverage required pursuant to this Agreement or any material changes to the respective insurance policies.

10.8 Waiver of Subrogation. The policies shall contain a waiver of subrogation for the benefit of City.

11. Business License. Consultant will obtain and maintain a City of Brentwood Business License for the term of the Agreement, as it may be amended from time-to-time.

12. Maintenance of Records. Consultant will maintain complete and accurate records with respect to costs incurred under this Agreement. All records will be clearly identifiable. Consultant will allow a representative of City during normal business hours to examine, audit, and make transcripts or copies of records and any other documents created pursuant to this Agreement. Consultant will allow inspection of all work, data, documents, proceedings, and activities related to the Agreement for a period of three (3) years from the date of final payment under this Agreement.

13. Ownership of Documents.

13.1 All product produced by Consultant or its agents, employees, and subcontractors pursuant to this Agreement (the “Work Product”) is the property of City. In the event this Agreement is terminated, all Work Product produced by Consultant or its agents, employees and subcontractors pursuant to this Agreement will be delivered to City pursuant to the termination clause of this Agreement. Consultant will have the right to make one (1) copy of the Work Product for Consultant’s records.

13.2 The Work Product may be used by City and its agents, employees, representatives, and assigns, in whole or in part, or in modified form, for all purposes City may deem advisable, without further employment of or payment of any compensation to Consultant; provided, however, that if this Agreement is terminated for any reason prior to completion of the Project and if under such circumstances City uses, 





 
 





C.4.d
Packet Pg. 104 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 5 PSA_City Attorney Approved Version 040821
or engages the services of and directs another consultant to use, the Work Product, City agrees to hold Consultant harmless from any and all liability, costs, and expenses relative to claims arising out of matters and/or events which occur subsequent to the termination of this Agreement as a result of causes other than the fault or negligence of Consultant, or anyone for whose acts it is responsible, in preparation of the Work Product. Consultant will not be responsible for deficiencies solely attributable to modifications of the Work Product performed by others, or that arise from use of the Documents in connection with a project or site other than that shown in the Work Product.

14. Copyrights. Consultant agrees that all copyrights that arise from the Services will be vested in City and Consultant relinquishes all claims to the copyrights in favor of City.

15. Confidentiality. All documents, reports, information, data, and exhibits prepared or assembled by Consultant in connection with the performance of the Services pursuant to the Agreement are confidential until released by the City to the public, and the Consultant will not make any of these documents or information available to any individual or organization not employed by the Consultant or the City without the written consent of the City before any such release.

16. Notices. Any notices relating to this Agreement shall be given in writing and shall be deemed sufficiently given and served for all purposes when delivered personally, by facsimile or by generally recognized overnight courier service, or five (5) days after deposit in the United States mail, certified or registered, return receipt requested, with postage prepaid, addressed as follows:

For City:

City of Brentwood
150 City Park Way
Brentwood, CA 94513
Phone No. (925) 516-5307
Attn: Jigar Shah
For Consultant:

Name: CSG Consultants, Inc.

Title: President
Address: 550 Pilgrim Drive
Foster City, CA 94404
Phone: (650) 522-2500
Email: [email protected]
Attn: Cyrus Kianpour
Either Party may change its address for purposes of this section by giving the other Party written notice of the new address in the manner set forth above.

17. Conflicts of Interest.

17.1 City will evaluate Consultant’s duties pursuant to this Agreement to determine whether disclosure under the Political Reform Act and City’s Conflict of Interest Code is required of Consultant or any of Consultant’s employees, agents, or subcontractors. Should it be determined that disclosure is required, Consultant or Consultant’s affected employees, agents, or subcontractors will complete and file with the City Clerk those schedules specified by City and contained in the Statement of Economic Interests Form 700.

17.2 Consultant understands that its professional responsibility is solely to City. Consultant warrants that it presently has no interest, present or contemplated, and will not acquire any direct or indirect interest, that would conflict with its performance of this Agreement. Consultant further warrants that neither Consultant, nor Consultant’s agents, employees, subcontractors and consultants have any ancillary real property, business interests or income that will be affected by this Agreement or, alternatively, that Consultant will file with the City an affidavit disclosing this interest. Consultant will not knowingly, and will take reasonable steps to ensure that it does not, employ a person having such an interest in the performance of this Agreement. If after employment of a person, Consultant discovers that it has employed a person with a direct or indirect interest that would conflict with its performance of this Agreement, Consultant will promptly disclose the relationship to the City and take such action as the City may direct to remedy the conflict.






 
 





C.4.d
Packet Pg. 105 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 6 PSA_City Attorney Approved Version 040821

18. General Compliance with Laws. Consultant will keep fully informed of federal, state and local laws and ordinances and regulations which in any manner affect those employed by Consultant, or in any way affect the performance of the Services by Consultant. Consultant will at all times observe and comply with these laws, ordinances, and regulations and will be responsible for the compliance of the Services with all applicable laws, ordinances and regulations.

19. Pandemic Health Laws. Consultant’s duty to comply with Laws includes compliance by Consultant with all local, state, or federal Laws that have been or may be enacted in response to the COVID-19 pandemic (collectively, “Health Laws”), which include all of the County of Contra Costa Health Orders. Failure to fully comply with the Health Laws constitutes a material default, subject to all available remedies including suspension or termination.

20. Discrimination and Harassment Prohibited. Consultant will comply with all applicable local, state and federal laws and regulations prohibiting discrimination and harassment.

21. Termination. In the event of the Consultant's failure to prosecute, deliver, or perform the Services, City may terminate this Agreement for nonperformance by notifying Consultant in writing pursuant to the notice provisions of this Agreement. Consultant has five (5) business days to deliver any documents owned by City and all work in progress to City address contained in this Agreement. City will make a determination of fact based upon the work product delivered to City and of the percentage of work that Consultant has performed which is usable and of worth to City in having the Agreement completed. Based upon that finding City will determine the final payment of the Agreement. In the event City elects to terminate, City will have the right to immediate possession of all Work Product and work in progress prepared by Consultant, whether located at the project site, at Consultant's place of business, or at the offices of a subconsultant.

Either Party, upon tendering thirty (30) calendar days written notice to the other Party, may terminate this Agreement for convenience. In this event and upon request of City, Consultant will assemble the work product without charge and put it in order for proper filing and closing and deliver it to City. Consultant will be paid for work performed to the termination date; however, the total will not exceed the lump sum fee payable under this Agreement. City will make the final determination as to the portions of tasks completed and the compensation to be made.

22. Covenants Against Contingent Fees. Consultant warrants that Consultant has not employed or retained any company or person, other than a bona fide employee working for Consultant, to solicit or secure this Agreement, and that Consultant has not paid or agreed to pay any company or person, other than a bona fide employee, any fee, commission, percentage, brokerage fee, gift, or any other consideration contingent upon, or resulting from, the award or making of this Agreement. For breach or violation of this warranty, City will have the right to terminate this Agreement for nonperformance, or, in its discretion, to deduct from the Agreement price or consideration, or otherwise recover, the full amount of the fee, commission, percentage, brokerage fees, gift, or contingent fee.

23. Claims And Lawsuits. By signing this Agreement, Consultant agrees that any Agreement claim submitted to City must be asserted as part of the Agreement process as set forth in this Agreement and not in anticipation of litigation or in conjunction with litigation. Consultant acknowledges that if a false claim is submitted to City by Consultant, it may be considered fraud and Consultant may be subject to criminal prosecution. Consultant acknowledges that California Government Code sections 12650 et seq., the False Claims Act, applies to this Agreement and, provides for civil penalties where a person knowingly submits a false claim to a public entity. These provisions include false claims made with deliberate ignorance of the false information or in reckless disregard of the truth or falsity of information. If City seeks to recover penalties pursuant to the False Claims Act, it is entitled to recover its litigation costs, including attorney's fees. Consultant acknowledges that the filing of a false claim may subject Consultant to an administrative debarment proceeding as the result of which Consultant may be prevented to act as a Consultant on any public work or improvement for a period of up to five (5) years. Consultant acknowledges debarment by another jurisdiction is grounds for City to terminate this Agreement. 





 
 





C.4.d
Packet Pg. 106 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 7 PSA_City Attorney Approved Version 040821

24. Jurisdiction, Venue and Governing Law. Any action at law or in equity brought by either of the Parties for the purpose of enforcing a right or rights provided for by this Agreement will be tried in a court of competent jurisdiction in the County of Contra Costa, State of California, and the Parties waive all provisions of law providing for a change of venue in these proceedings to any other county. This agreement will be governed by the laws of the State of California.

25. Testimony. Consultant will testify at City's request if litigation is brought against City in connection with Consultant's services under this agreement. Unless the action is brought by Consultant, or is based upon Consultant's actual or alleged negligence or other wrongdoing, City, upon prior written agreement with Consultant will compensate Consultant for time spent in preparation for testimony, testimony, and travel at Consultant's standard hourly rates at the time of actual testimony.

26. Successors and Assigns. It is mutually understood and agreed that this Agreement will be binding upon the Parties and their respective successors. Neither this Agreement nor any part of it nor any monies due or to become due under it may be assigned by Consultant without the prior written consent of City, which will not be unreasonably withheld.

27. Section Headings. Section headings as used in this Agreement are for convenience only and will not be deemed to be a part of such sections and will not be construed to change the meaning of the section.

28. Waivers. The waiver by either Party of any breach or violation of any term, covenant, or condition of this Agreement or of any applicable law will not be deemed to be a waiver of such term, covenant, condition or law or of any subsequent breach or violation of same or of any other term, covenant, condition or law. The acceptance by either Party of any fee or other payment which may become due under this Agreement will not be deemed to be a waiver of any preceding breach or violation by the other Party of any term, covenant, or condition of this Agreement or any applicable law.

29. Entire Agreement. This Agreement, together with any other written document referred to or contemplated by it embody the entire Agreement and understanding between the parties relating to the subject matter of it. The City Manager is authorized, in consultation with the City Attorney, to agree to nonmaterial amendments to this Agreement. Neither this Agreement nor any of its provisions may be amended, modified, waived or discharged except in a writing signed by both parties.

30. Authority. The individuals executing this Agreement and the instruments referenced in it on behalf of Consultant each represent and warrant that they have the legal power, right and actual authority to bind Consultant to the terms and conditions of this Agreement.

31. Severability. If any term, provision, condition or covenant of this Agreement or its application to any party or circumstances shall be held, to any extent, invalid or unenforceable, the remainder of this Agreement, or the application of the term, provision, condition or covenant to persons or circumstances other than those as to whom or which it is held invalid or unenforceable, shall not be affected, and shall be valid and enforceable to the fullest extent permitted by law. 





 
 





C.4.d
Packet Pg. 107 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 8 PSA_City Attorney Approved Version 040821

32. Signatures.

32.1 Counterparts. This Agreement may be executed in two or more counterparts, each of which together will be deemed an original, but all of which together will constitute the same instrument.

32.2 Digital/Electronic Signatures. Using a City-approved method, this Agreement may be executed through the use of digital or electronic signatures in accordance with Government Code Section

16.5. The presence of an electronic signature on this Agreement will be construed as the Parties’ consent to do business electronically.

CONSULTANT:
* By:

Printed Name: Cyrus Kianpour
Title: President
** By:

Printed Name: Nourdin Khayata
Title: Secretary
CITY:

By:

Tim Y. Ogden, City Manager
ATTEST:

By:

Margaret Wimberly, City Clerk
APPROVED AS TO FORM:

By:

Damien Brower, City Attorney
If required by City, proper notarial acknowledgment of execution by Consultant must be attached. If a Corporation, Agreement must be signed by one corporate officer from each of the following two groups. *Group A. **Group B.

Chairman, Secretary,
President, or Assistant Secretary,
Vice-President CFO or Assistant Treasurer
Otherwise, the corporation must attach a resolution certified by the secretary or assistant secretary under corporate seal empowering the officer(s) signing to bind the corporation.

If an LLC:
x The Agreement must be signed by a Managing Member or the LLC must attach a resolution empowering the signatory to bind the LLC.

If a partnership:
x The Agreement must be signed by the Managing Partner or the Partner authorized to execute agreements of this type. Additional documentation, such as the partnership agreement, confirming this signature authority may be required.

If a sole proprietorship:
x The Agreement must be signed by the owner.






 
 





C.4.d
Packet Pg. 108 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 9 PSA_City Attorney Approved Version 040821
EXHIBIT “A”

SCOPE OF SERVICES






 
 





C.4.d
Packet Pg. 109 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 3875 Hopyard Road, Suite 141
Pleasanton, CA 94588
925.931.0370 phone
925.931.0388 fax
www.csgengr.com

STATEMENT OF QUALIFICATIONS TO THE
City of Brentwood
Civil /Structural Design Services for Infrastructure ProjectsICES March 8, 2022






 
 





C.4.d
Packet Pg. 110 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

CSG STATEMENT OF QUALIFICATIONS TO THE CITY OF BRENTWOOD

CIVIL/STRUCTURAL DESIGN SERVICES FOR INFRASTRUCTURE PROJECTS Table of Contents
SECTION A Letter of Transmittal 2
SECTION B Submittal Approach 3
Firm Qualifications
Organizational Chart
Subconsultants
Project Team
Project Experience
Project Approach
Quality Work
3 3
4 5
6 9
12 SECTION C Agreement Provisions 15
SECTION D Conflict of Interest 15
SECTION E Claims or Litigations 15
SECTION F Attachments 15






 
 





C.4.d
Packet Pg. 111 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 550 Pilgrim Drive, Foster City, CA 94404
Phone (650) 522-2500 | Fax (650) 522-2599 | www.csgengr.com

CSG STATEMENT OF QUALIFICATIONS TO THE CITY OF BRENTWOOD

CIVIL/STRUCTURAL DESIGN SERVICES FOR INFRASTRUCTURE PROJECTS Letter of Transmittal
March 8, 2022
Renee Payette
City of Brentwood
150 City Park Way
Brentwood, CA 94513
RE: Civil/Structural Design Services for Infrastructure Projects (City or Developer Driven) Dear Renee,
CSG Consultants, Inc. is pleased to present its statement of qualifications to the City of Brentwood (City) for civil/structural design services. CSG has assembled a strong team to meet the City’s on-call needs. The team will be led by Hatem Ahmed, PE, PMP who will serve as the Principal-in-Charge and Quality Assurance / Quality Control Manager, providing CSG’s team with all the resources required by the City to complete any assigned tasks at a high level of quality, within time and budget.

Highlighting our strengths, reasons why the City should select CSG to provide civil and structural design services include:

Prior On-Call Contract Experience – CSG has extensive experience providing on-call civil engineering design, project management, and plan check services for agencies throughout the Bay Area. Over the past 30 years, CSG has provided consulting services to agencies throughout the Bay Area. We have hold similar on-call contracts with the Cities/Towns of Albany, Moraga, Orinda, Alameda, San Leandro, Burlingame, San Mateo, Foster City, Belmont, Santa Clara, and San Jose
Experienced Project Managers – CSG’s project managers have a proven track record of delivering Transportation, Water, Sewer, Storm-Drain, Traffic, Facilities, and Structural design projects on-time and within budget. Many of our staff bring direct public sector employment experience to their roles, providing the City with an in-house perspective toward approaching projects. Our managers have led the design of roadway improvements, bicycle lanes, pavement rehabilitation, drainage, wastewater, and pedestrian facilities.

Depth of Resources – CSG’s proposed project managers will be supported by a strong team of experienced engineers. Our firm includes over sixty PEs, six SEs, five certified QSD/P, three CFMs, five NASSCO, five CASp, one PMP, one TE, and a variety of other certified / licensed personnel. Our team includes specialty subconsultants to support our efforts and ensure the City receives the highest quality of services. Our team includes Advanced Mobility Group for traffic engineering, Gates + Associates for public outreach and landscape design, and WRA, Inc. for environmental permitting support.

Commitment to Quality Assurance / Quality Control (QA / QC) – CSG is dedicated in utilizing a peer review process with multi-level internal quality checking of the deliverables for each service line. The dedicated QA / QC personnel has over 30 years of civil engineering and municipal experience.

CSG acknowledges receipt of Clarification 1 and 2. We are excited about the opportunity to serve the City of Brentwood and would welcome the opportunity to talk with you further. If you have any questions or need additional information regarding this proposal, please contact Mr. Ahmed at (925) 931-0370 or [email protected].

Sincerely,
Cyrus Kianpour
President, CSG Consultants, Inc

A SECTION
ncerely,
i






 
 





C.4.d
Packet Pg. 112 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

CSG STATEMENT OF QUALIFICATIONS TO THE CITY OF BRENTWOOD

CIVIL/STRUCTURAL DESIGN SERVICES FOR INFRASTRUCTURE PROJECTS 3 Submittal Approach

FIRM QUALIFICATIONS
CSG Consultants, Inc. (CSG) is an employee-owned California company with its local office in Pleasanton and headquarters in Foster City, CA. Additional support is available from our other offices in San Jose, Sacramento, Newman, Fresno, and Orange. Founded in 1991, CSG performs work solely for public agencies, eliminating the potential for conflicts of interest between developers and agencies. In this way, we can focus exclusively on the specific needs of our municipal clients.

NAME OF FIRM: CSG Consultants, Inc.

POINT OF CONTACT Hatem Ahmed, PE, PMP | Vice President, Engineer (925) 931-0370 | [email protected]

HEADQUARTERS &
LOCAL OFFICE:
550 Pilgrim Drive, Foster City, CA 94404
(650) 522-2500 phone • (650) 522-2599 fax
www.csgengr.com • [email protected]
REGIONAL OFFICES: 3150 Almaden Expressway, #255, San Jose, CA 95118 1303 J Street, #270, Sacramento, CA 95814
3875 Hopyard Road, Suite 141, Pleasanton, CA 94588
930 Fresno Street, Newman, CA 95360
5151 N. Palm Avenue, Suite 530, Fresno, CA 93704
3707 W. Garden Grove Boulevard, Suite 100, Orange, CA 92868 YEARS IN BUSINESS: 30 • Founded in 1991
OWNERSHIP: Employee-Owned
EMPLOYEES: 300+ (Company Wide)
TYPE OF BUSINESS: California Corporation • Incorporated June 15, 2000 • Federal ID: 91-2053749 Services Composition

CIVIL & STRUCTURAL DESIGN
Capital Improvement Project Design:

Transportation/Roadway, Bridges, Water and
Sewer Utilities, Traffic Engineering

DEVELOPMENT & MAP REVIEW
Development Review, Plan Check, Surveying,
City Surveyor and Mapping, Storm Water
Program Compliance (NPDES, QSP/QSD)

CONSTRUCTION MANAGEMENT &

INSPECTION
Contract Administration, including:

Resident Engineer Oversight, Inspection
and Construction Management
Constructability/Bidability Reviews
Cost and Schedule Control
Claims Avoidance

PROGRAM & PROJECT MANAGEMENT
Capital Improvement Program Development
and Implementation
Federal and State Grant Administration
Rule 20A Undergrounding
Staff Augmentation Including: Design
Consultant Coordination, Project Scoping, RFP
Preparation

ORGANIZATIONAL CHART
Below is CSG’s proposed organizational structure for the City’s review. Based on the needs of the City, CSG will provide the appropriate personnel to ensure the request is met. Key personnel are identified with an (*).

Resumes for key staff members are provided later in this section. The key personnel are fully committed to performing work under this contract.

B SECTION






 
 





C.4.d
Packet Pg. 113 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

CSG STATEMENT OF QUALIFICATIONS TO THE CITY OF BRENTWOOD

CIVIL/STRUCTURAL DESIGN SERVICES FOR INFRASTRUCTURE PROJECTS 4 Subconsultants
Advanced Mobility Group (AMG) is a California Corporation and certified Small Business Enterprise (SBE), established in 2018 to provide specialized innovative transportation services to our clients. AMG assists with innovative technologies to empower the private and public sectors in the early adoption of proven advanced transportation solutions and intelligent infrastructure.

GATES + ASSOCIATES is a 35-person Landscape Architecture, Urban Design and Land Planning firm located in San Ramon. Their firm has extensive knowledge of stormwater management BMPs and the California Water Efficient Landscape Ordinance (AB 1881). Their team includes LEED Accredited Professionals, Bay-Friendly Qualified Landscape Professionals and Raters, Accredited Green Roof Professionals and an in-house Certified Irrigation Designer and Auditor.

Vizion Utility Partners is a PG& qualified engineering firm focused on design excellence and value engineering. They specialize in providing joint trench coordination and design services While Vizion is less than three years old, members of our team have significant years of experience, some having worked together in prior businesses, and collectively have designed over 3,500 projects covering a wide range of project types and scales.

WRA, Inc. (WRA) provides a range of environmental services including plant, wildlife, wetland, and aquatic ecology, regulatory strategy and compliance, environmental planning (CEQA/NEPA), mitigation solutions, restoration engineering and design, resiliency planning, GIS, and landscape restoration. Formed in 1981, WRA has nearly 100 employees in four offices in California.

Hatem Ahmed, PE, PMP

CONTRACT MANAGER

PROJECT MANAGERS
Lawrence Lau, PE, PLS, QSD/P*
Hal Williams, PE*
Sophie Truong, PE, PLS, QSD/P*
Michael Fisher, PE, QSD/P*
Tom Walker, PE*
Ed Slintak, PE*

ENGINEERING SUPPORT
Charles Lee, PE
David Seto, PE
Son Hoang, EIT, NASSCO
Husam Aburabi, EIT
Michael Loomis, SE
Stephen Tovmassian, PE
Allan Simeon, EIT
Heba Masri, EIT
Jay Gonzales, NASSCO
Phiroze Wadia, PE, SE

SUBCONSULTANTS
Advanced Mobility Group
Traffic Engineering
WRA
Environmental Support
Gates + Associates
Outreach and Landscape Design
Vizion
Utility Undergrounding
Mohinder Sharma, PE, TE

QA / QC REVIEW






 
 





C.4.d
Packet Pg. 114 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

CSG STATEMENT OF QUALIFICATIONS TO THE CITY OF BRENTWOOD

CIVIL/STRUCTURAL DESIGN SERVICES FOR INFRASTRUCTURE PROJECTS 5 PROJECT TEAM
Design Experience Matrix Michael Fisher, PE, QSD/P Ed Slintak, PE Sophie Truong, PE, PLS, QSD/P Lawrence Lau, PE, PLS, QSD/P Tom Walker. PE Hal Williams, PEHatem Ahmed, PE, PMP David Seto, PE Tom Walker Son Hoang, EIT Stephen Tovmassian, PE Sandra Meditch, PE Kareem Arabi Jeffrey Lee Allan Simeon, EIT Cesar Caronongan Husam Aburabi Phiroze Wadia, SE Pavement
Rehabilitation • • • • • • • • • • • • • •
Complete Streets • • • • • • • • • • • • • • •
Safe Route to Schools • • • • • • • • • • • • • •
Trail Facilities • • • • • • • • • • • •
Roadway
Improvement • • • • • • • • • • • • • • • • •
Public Outreach • • • • • • • • • • • • •
Project Management • • • • • • • • •
ADA Compliance • • • • • • • • • • • • • • • • •
Signal/Lighting
Design • • • • •
Water/Wastewater • • • • • • • • • • • • • •
Storm Drain • • • • • • • • • • • • • • • •
Green Infrastructure • • • • • • • • • • •
Parking Lot Design • • • • • • • • • •
Structures / Building • • • •
Traffic Signals/
Lighting • • •






 
 





C.4.d
Packet Pg. 115 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

CSG STATEMENT OF QUALIFICATIONS TO THE CITY OF BRENTWOOD

CIVIL/STRUCTURAL DESIGN SERVICES FOR INFRASTRUCTURE PROJECTS 6 PROJECT EXPERIENCE
For the past 30 years, CSG has been serving public agencies throughout the Bay Area, providing a range of civil engineering and structural design services. Provided on the following pages are example projects CSG has worked on.

WASHINGTON AVENUE RECONSTRUCTION PROJECT | CITY OF SAN LEANDRO, CA The project is located on Washington Avenue, between West Juana Avenue and Castro Street, San Leandro.

Washington Avenue is a high crowned street with parabolic cross-section, which makes crosswalks noncompliant with Americans with Disabilities Act (ADA). The goals of the project include, rehabilitating the pavement, making the crosswalks compliant with ADA by reducing the crowns, bringing the abutting curb ramps to compliance and redesigning the curb return radius at the corner of Williams Street and Castro Street for reduced turning speed. CSG conducted life cycle analysis to determine that mill and overlay is the most cost-effective rehabilitation treatment method with consideration of existing site constraints, characteristics of subsurface conditions and the City’s available construction budget. CSG performed design of non-ADA compliant curb ramp and crosswalk upgrades, prepared plans, estimates and specifications for pavement rehabilitation, and restriping and pavement markers in accordance to the latest MUTCD standards.

Project challenges and key takeaways: The existing pavement have been deteriorating due to relatively flat roadway profile with a combination of damaged curb and gutter, and undersized, shallow and damaged storm drain system. CSG evaluated the existing site conditions and recommended a number of pavement rehabilitation treatment alternatives including removing existing concrete slab underneath the asphalt pavement, full depth reclamation (FDR), cold in place recycling (CIR), and mill and overlay. CSG engaged with contractors who are specialized on each pavement rehabilitation operation at the early stage of the design phase to learn about the design approach on dealing with the existing site constraint, anticipated life span of pavement treatments, and potential impacts to the traffic and adjacent properties. Having the knowledge of the pros and cons of each pavement treatment alternative from the contractor’s perspective, CSG was able to help the City and CSG to make the most informed and cost-effective decisions.

Reference: Austin Osakwe, Senior Engineer
835 East 14th Street, San Leandro, CA 94577
(510) 577-3486, [email protected]
Date of Service: Sept 2019 to Present
AHWAHNEE DRIVE WATER, SEWER, AND COMPLETE STREET REPAIR PROJECT |

CITY OF MILLBRAE, CA
Ahwanhee Drive is an approximately 1,600-foot-long street segment located in a hillside residential neighborhood in the City of Millbrae. Due to the aging utility infrastructure and deteriorating roadway pavement, the City initiated a complete street repair project. Utility work as part of the complete street repair project included replacement of the existing sanitary sewer main, reconnection of sewer laterals, installation of new cleanouts and backflows, relocation of the existing water main, and replacement of water laterals up to the meter where necessary. The project also included rehabilitation of the existing pavement, installation of ADA compliant curb ramps, and spot repairs of concrete curb, gutter, and sidewalk where deficiencies were noted. Finally, the existing street lights along the corridor were upgraded with new street light poles and LED fixtures, new street light pull boxes were installed, and a new street light conduit was pulled into the roadway. Stephen Tovmassian is the Project Engineer and Matthew Pi serves as the waterline design lead for this project.

Reference: Bill Giang, Assistant Engineer
621 Magnolia Avenue, Millbrae, CA
(650) 259-2325, [email protected]
Date of Service: 2022 - Ongoing






 
 





C.4.d
Packet Pg. 116 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

CSG STATEMENT OF QUALIFICATIONS TO THE CITY OF BRENTWOOD

CIVIL/STRUCTURAL DESIGN SERVICES FOR INFRASTRUCTURE PROJECTS 7 MARIN AVENUE PAVEMENT AND CURB REHABILITATION PROJECT | CITY OF ALBANY, CA CSG was selected to perform the
review, evaluation, and
recommendation of pavement
rehabilitation treatment alternatives
along Marin Avenue and other
eleven collector and local roads for
the City. The project scope included
assessment of existing site
conditions, selection of pavement
treatment types, repair of base
failures, crack sealing, pavement patch and leveling, preservation of existing survey monuments, reconstruction of curb ramps to meet ADA requirements, repair of failed curb, gutter and sidewalk, reinstallation of new bike lanes and traffic signal detector loops, pavement markings and striping, and adjustment of existing utilities to pavement finished grade. CSG prepared a technical memo to summarize the existing pavement conditions, findings from the pavement cores, life cycle cost analysis results, and pavement rehabilitation treatments alternatives, including crack seal, slurry seal, mill and overlay, full depth reclamation/soil stabilization, subgrade enhancement, and full depth asphalt concrete replacement. CSG prepared utility letters and coordinated with various utility companies, including East Bay Municipal Utility District, PG&E, AT&T, and Comcast that had facilities within the project area to request mapping of their facilities in the area, minimize utility conflicts, notify utility companies of their facilities or covers which needed to be adjusted to grade because of the proposed improvements; and discuss the project and utility adjustment schedules throughout the design stage. CSG prepared conceptual layouts, plans, specifications, and cost estimates for the proposed improvements. CSG also attended a workshop to present the findings from the field investigations and establish guiding principles for curb ramp design, pavement treatments and modifications to existing striping and signage.

Project challenges and key takeaways: City’s elected officials are committed to providing bicycle friendly environment to the community. During the preliminary design phase, CSG generated a number of alternate concepts, which included installation of buffered Class II bike lanes, one or two-way Class IV bikeways with raised landscape/hardscape islands separating the vehicular and bicycle traffic, bike ramp connecting to existing multi-use trail, and bike box for left turn movements. CSG was able to include a number of innovative bicycle facility design approach which could be recommended for similar type of bike friendly projects in the future, and more importantly, able to help the City to achieve their goal of implementing safe and reliable bicycle facilities for the community.

Reference: Mark Hurley, PE, Public Works Director/City Engineer 1000 San Pablo Avenue, Albany, CA 94706
Office: (510) 559-7255
Cell: (415) 850-7058, [email protected]
Date of Service: Dec 2020 to Present

HILLCREST BOULEVARD STORM DRAIN
IMPROVEMENTS | CITY OF MILLBRAE, CA
During intense storm events the existing storm drain system in a portion of Hillcrest Boulevard would be overwhelmed, and the excess water would flow over the sidewalk and down a driveway causing flooding and damage. The City reached out to CSG to perform the design of a storm drain to help alleviate this issue. A parallel storm drain was installed to increase the system capacity.

The improvements included 925 linear feet of 24” diameter RCP storm drain, 32 linear feet of 18” diameter RCP storm drain, new manholes and a catch basin, and reconstruction of existing manhole and catch basin. 





 
 





C.4.d
Packet Pg. 117 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

CSG STATEMENT OF QUALIFICATIONS TO THE CITY OF BRENTWOOD

CIVIL/STRUCTURAL DESIGN SERVICES FOR INFRASTRUCTURE PROJECTS 8 In addition to preparing the contract documents, CSG provided construction support services.

Reference: Bill Giang, Assistant Engineer
621 Magnolia Avenue, Millbrae, CA
(650) 259-2325, [email protected]
Date of Service: 2017
BRIDGE PREVENTIVE MAINTENANCE INSPECTION AND PLANNING REPORT |

CITY OF SAN JOSE, CA
CSG performed inspections of San Jose’s Non-NBI
bridges and prepared a Bridge Preventive Maintenance
planning report that the City can use to plan for future bridge projects. The project included over 90 bridges
that are not listed in the National Bridge Inventory (NBI) or Caltrans Local Agency Bridge Inventory and are not
eligible for federal funding for maintenance repairs
under Caltrans Bridge Preventive Maintenance Plan
(BPMP). CSG identified bridge deficiencies and prepared a report that summarizes and prioritizes recommended
bridge repairs.

Reference: Derek Yee, Associate Engineer
1404 Mabury Road, San Jose, CA 95133
(408) 768-9993
Project Duration: 2018 - 2019






 
 





C.4.d
Packet Pg. 118 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

CSG STATEMENT OF QUALIFICATIONS TO THE CITY OF BRENTWOOD

CIVIL/STRUCTURAL DESIGN SERVICES FOR INFRASTRUCTURE PROJECTS 9 PROJECT APPROACH
CSG can assist the City in delivering their civil and structural engineering projects by providing on-call services. CSG will also work with all stakeholders, utility companies, and permitting agencies including Caltrans, and FHWA as needed. Below is CSG typical approach in managing projects once CSG are authorized to perform the requested on-call tasks:

Project Management Plan
CSG will implement a project management plan including all project elements establishing the project scope of work, budget, schedule, and design standards to allow for solid traceability and accountability for any changes or variances from the project baseline components. In addition, our team will identify any potential variances early in the project phase to allow for the development of an alternative approach to prevent potential schedule or cost slippages. We intend to do this by offering real-time data to the City through our daily contact with the City ‘s Project Manager and weekly project meetings.

Scope Management
Scope management occurs with the development of a well written scope of work as defined by the City. As changes are identified, a change request process will be followed encompassing the cost and schedule impact of each potential change, as well as the additional scope description. Potential changes will be included in a Monthly Report that will be discussed weekly with the City. As changes are approved or rejected, the appropriate revisions will be made to the Scope of Work and the schedule/cost baseline will be revised and resubmitted for approval by the City.

Schedule Management
A baseline schedule will be developed and submitted for approval by the City for the selected projects. CSG will use the built-in Microsoft
Project tools to ensure that only
contractually required dates are
constrained and out-of-sequence
activities are not present. Once
changes are approved, the schedule
will be updated and finalized.

Budget/Cost Management
As project estimates become
finalized, they will be included in the
project budget and loaded into the
project costs. Once a project change
is approved, it will be tied to a
change order and the schedule and budget will be revised accordingly. All baseline revisions and change orders will be tracked and documented.

Quality Management
A Project Quality Management Plan will be drafted and submitted as part of the QA/QC Implementation Plan that will include the review requirements for design work and the QA/QC process during construction. This will be inclusive of all process and testing requirements and the contractor’s ability to follow its process and ensure successful testing of installed work.

Subconsultant Management and Stakeholder Coordination
As a multi-disciplinary engineering project, we understand that solid team building and cooperation are required for the successful completion of this project. This project will require integration and coordination of various subconsultants into a larger construction contract. To ensure effective teamwork, our team will hold regular meetings with the City, utility companies, residents, and businesses to confirm project goals and objectives. A clear understanding of each person role in the project is essential and will be communicated to 





 
 





C.4.d
Packet Pg. 119 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

CSG STATEMENT OF QUALIFICATIONS TO THE CITY OF BRENTWOOD

CIVIL/STRUCTURAL DESIGN SERVICES FOR INFRASTRUCTURE PROJECTS 10 each team member. This approach allows each team member to properly allocate his / her resources and make the necessary commitments to the project.

Design Task List
At the kickoff meeting, CSG will meet with the City to discuss project’s goals, identify specific project scope and deliverables, determine overall project schedule and deadline of each submittal milestone, confirm design and construction budget, and discuss any potential project issues and approach to address these issues. CSG develop scope with deliverables identified based on project needs, anticipated tasks and assumptions to satisfy the needs, pre-determined scope identified by the City, and any other tasks that are required by the permitting agencies, and local, state and federal regulations. For illustrative purposes, CSG‘s general design approach on scoping task lists is shown below. We make sure to address all of these items with the agencies we work with to ensure a well-managed and designed project.  Design kick off meeting with the City, and record and distribute minutes  Identify permits required and prepare documentation
 Right of way research and mapping
 Coordination with affected property owners
 Utility and other stakeholder coordination, mailing letters of intent, conducting utility potholing, and determination and coordination of any required relocations or conflict resolutions  Base map development, using AutoCAD Civil 3D 2019
 Field assessments of existing features (with potential field meetings with the City) o Striping and pavement marking identification
o Geotechnical and pavement conditions
o Concrete curb ramp, curb and gutter, sidewalk, valley gutter, and driveway approach condition survey
o Hydrologic and hydraulic assessments of drainage improvements o Traffic signal detection locating and identification
o Pedestrian & Bicycle safety, ADA and MUTCD compliance needs o Stormwater management Provision C.3 compliance needs
o Identification of applicable City/County/Caltrans/Federal Standard Plan details or development of customized construction details
 Prepare reports and recommendations
 Environmental Clearance
 Lead and attend public outreach meetings
 Develop plans, specifications & estimates for construction o PS&E submittal review meetings with the City
o Finalize design concept
 Attend the City Design group to Construction group “Hand-off” meeting  Bid phase support
 Construction phase support
 Conduct a “Lessons Learned” meeting






 
 





C.4.d
Packet Pg. 120 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

CSG STATEMENT OF QUALIFICATIONS TO THE CITY OF BRENTWOOD

CIVIL/STRUCTURAL DESIGN SERVICES FOR INFRASTRUCTURE PROJECTS 11 ON-CALL PROJECT PRIORTIZATION, SCHEDULING, AND

BUDGETTING
CSG maintains an engineering design staff of over 60 professionals. CSG Project Managers hold a weekly inhouse PMs Meeting to review deadlines, analyze staff utilization, and prioritize various projects. Below is the five-step process for project prioritization.

1. Project assignment beings with identifying the technical expertise required for each task, while matching it with the appropriate staff needed for the assignment. This provides the client assurance that the work will be performed with at a high standard and with an “on time on budget” mentality right off the bat.

2. Once a project / task has been assigned and begins, deadlines are tracked on a “Project Summary Sheet” and reviewed at weekly design Project Manager meetings.

3. Required resources for each task are reflected in the staffing hours sheet and updated at weekly design Project Manager meetings.

4. As project / task scope of works change, per the clients requests, additional resources required are discussed internally to ensure the appropriate staff is assigned, based on the staffs expertise and availability.

5. CSG has longstanding relationships with several engineering consultants in numerous aspects of civil engineer. CSG frequently partners with these firms to help meet client and project needs.

DESIGN PROJECT SUMMARY

STAFFING HOURS






 
 





C.4.d
Packet Pg. 121 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

CSG STATEMENT OF QUALIFICATIONS TO THE CITY OF BRENTWOOD

CIVIL/STRUCTURAL DESIGN SERVICES FOR INFRASTRUCTURE PROJECTS 12 QUALITY OF WORK
Provided below and on the following pages is a sample work product for a CSG project, as well as a Sample QA/QC process, and Table Of Contents for the City’s review.

Quality Assurance / Quality Control Process (QA/QC)
CSG’s in-house QA / QC Implementation Plan utilizes a peer review process with multi-level internal project checking. As highlighted in the organizational chart for this contract, Mohinder Sharma, PE, TE will be dedicated to the QA / QC Implementation Plan and will be responsible for the following:
 Establishing guidelines & assigning accountable personnel and responsibilities for each task.  Assuring that all deliverables are reviewed, including products from subconsultants.  Monitoring the process to assure that the schedule and budget are followed.  Participating in the internal and external reviews.
 Reviewing and signing off on deliverables before submittal to the City.

All technical products, including technical engineering reports, studies, design notes, mapping, drawings, and engineering cost estimates are
subject to a multi-tiered
approach for review to ensure
that all products are checked
for accuracy, correctness,
completeness and conformity
with standards. The tiers will
include routine checking and
scheduled reviews by Project
Manager and QA / QC staff. The
QA / QC Manager will conduct
periodic audits of the QA / QC
review process to ensure that
reviews are being properly
conducted and documented by
all team members. Each task
we are selected for will receive formal QA / QC review at the various submittals, and reports will receive reviews at the draft and pre-final submittal stages.

Deliverables will be reviewed for:
 Conformance to approved formats, criteria, specifications, & professional standards of practice.  Adequacy, clarity, ease of interpretation
 Constructability
 Compatibility of design discipline interfaces
 Errors and discrepancies
 Coordination with related designs and project elements  Integration of design disciplines
 Incorporation of design changes
 Conformance to required environmental mitigation
Review comments made by QC reviewers will be in writing. Comments may also be placed in the documents being reviewed, but all comments for which a response is desired will be transcribed onto the comment forms. A log to record QC measures taken during the course of the project, including corrective actions taken, will be maintained by the Project Manager.






 
 





C.4.d
Packet Pg. 122 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

CSG STATEMENT OF QUALIFICATIONS TO THE CITY OF BRENTWOOD

CIVIL/STRUCTURAL DESIGN SERVICES FOR INFRASTRUCTURE PROJECTS 13 





 
 





C.4.d
Packet Pg. 123 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Submittal / Revision:
1 Designed By:Drawn By:Checked By:Date:

Sheet Number:

DS/HA/AADS/HA/AA
11/19/2021
LL
City of Albany
Maintenance Center
540 Cleveland Avenue
Albany, CA 94706
(510) 524-9543
234567
90% SUBMITTAL 11/30/2021

NOT FOR CONSTRUCTION
®
of 66
SS-1
14 





 
 





C
Packet Pg

CSG STATEMENT OF QUALIFICATIONS TO THE CITY OF BRENTWOOD

CIVIL/STRUCTURAL DESIGN SERVICES FOR INFRASTRUCTURE PROJECTS 15 Agreement Provisions
CSG agrees to enter into the Agreement with no exceptions to the form of the Agreement.

Conflict of Interest
CSG works exclusively with public agencies, avoiding any potential conflicts of interest that may be perceived.

Claims or Litigations
CSG has not had a contract terminated due to convenience, default, or other reasons or any litigations within the past five (5) years.

Attachments
Resumes of proposed key personnel are provided on the following pages for the City’s review. Additional resumes may be provided upon request.

D SECTION

C SECTION

F SECTION

E SECTION






 
 





C.4.d
Packet Pg. 125 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 16 Lawrence

LICENSES &

CERTIFICATIONS
Professional Civil Engineer
State of California | C57397
Professional Land Surveyor
State of California | L7934
Qualified Stormwater
Designer/Practitioner | 23449

EDUCATION
Bachelor of Science in Civil Engineering
California Polytechnic State University
| San Luis Obispo, CA

PROFESSIONAL

AFFILIATIONS
American Council of Engineering
Companies
East Bay Chapter
Past President (2013-2014)
American Public Works Association
American Society of Civil Engineers
Lau PE, PLS, QSD/P
Principal Engineer
Mr. Lau has over 27 years of civil engineering design and project management experience.

He possesses a strong technical background in the master planning, design, and construction of Caltrans and local roadways, complete streets, roundabouts, parking lots, drainage and utility improvements for public agencies. He is also experienced in site layout, grading, drainage, and backbone infrastructure improvements for low, medium, and high density residential and mixed-use developments.

RELEVANT EXPERIENCE
Addison Avenue Safe Routes To Schools And Green Street Improvements | City of East Palo Alto, CA
Mr. Lau served as the Project Manager for enhancements to pedestrian and bicyclist accessibility and safety within a residential area by installing new bicycle and pedestrian facilities and sustainable green street features. Mr. Lau led a community outreach meeting at the beginning of design stage to listen to the community and stakeholder’s concerns.

Mission Road Bicycle and Pedestrian Improvement Project | Town of Colma, CA Mr. Lau served as the Project Manager for the design of bicycle and pedestrian improvements in the Town of Colma. The project involved the planning, design and implementation of a number of safety related improvements for the pedestrians, bicyclists and vehicles along Mission Road between El Camino Real and Lawndale Boulevard. The anticipated improvements include addition of new sidewalk to provide continuous safe and accessible pedestrian route, extension of Class II bicycle lanes on northbound direction, construction of bulbouts and high visibility crosswalks with pedestrian flashing beacons, installation of energy efficient street lights, relocation and reconstruction of the existing curb, gutter, sidewalk and non-ADA compliant ramps and driveway approaches, and construction of landscape planters for drainage and stormwater treatment purposes.

Bernal Avenue & Nevada Street Intersection Project | City of Pleasanton, Ca Mr. Lau managed the design of a protected intersection, an innovative approach to expand both the northwest and southwest corners of the intersection of Bernal Avenue and Nevada Street with a 30 feet radius and ADA-compliant curb ramps. The design aspects of the project included ADA-compliant curb ramps, driveway approach, sidewalk, curb & gutter, a drainage inlet, adjustment to utility covers, roadway resurfacing, and modification to an existing drainage inlet.

Safe Routes To School Sidewalk Priority Safety Project | City Of Stockton, Ca Mr. Lau served as the project manager for safe routes to schools improvements which involved the installation of new bicycle facilities and traffic calming features at fourteen locations near six elementary schools. The project included relocation and upgrades of non-ADA compliant curb ramps at a roundabout intersection, addition of bike lanes and speed humps in front of two schools, construction of bulbouts with high visibility crosswalks at major and minor collectors, installation of rectangular rapid flashing beacon at arterials and raised median refugee island, modifications of signing, striping, and pavement markings in compliance with the latest CA MUTCD. A public outreach meeting was held to collect comments to the project from the councilmembers, school district, transit district, emergency responders and general public.






 
 





C.4.d
Packet Pg. 126 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 17 Michael

LICENSES &

CERTIFICATIONS
Professional Civil Engineer
State of California
| C56550
Qualified SWPPP Developer/Practitioner

EDUCATION
Bachelor of Science, Civil Engineering,
San Jose State University
|San Jose, CA

PROFESSIONAL

AFFILIATIONS
South Bay Transportation Offices
Association (SBTOA), Past President
Toastmasters International
Club: 04840677
Fisher PE, QSD/P
Principal Engineer
Mr. Fisher is a civil engineer with over 28 years of experience in civil/roadway design, drainage design, traffic engineering, specification writing, engineering report writing and project management. He has managed teams of engineers, working to deliver over a dozen projects ranging in size from $20,000 to $22,000,000 with project status ranging from project initiation/feasibility/study phase to approval/environmental phase to final design and construction.

Mr. Fisher has experience managing the design of pavement rehabilitation projects through various means, including alternative overlay to full depth structural sections. He is also experienced in providing value engineering to ensure the client’s pavement management budget has maximum impact.

RELEVANT EXPERIENCE
Burlingame Station Pedestrian Improvements | City Of Burlingame, CA Mr. Fisher served as the Design Project Manager for this project to improve pedestrian accessibility and connectivity, implement traffic calming features and implement community enhancements including green infrastructure and parking enhancements while preserving a large heritage Oaktree. He led the evaluation of field conditions, as well as previous neighborhood studies and community input to come up with a staff preferred alternative and present it to the community.

Britton School Sidewalk & Traffic Enhancements Project | City Of Morgan Hill, Ca Mr. Fisher served as the Project Manager for improvements around the Britton School in Morgan Hill. The project will improve the off-site frontage of the Britton School along Monterey Road and Central Avenue. This ultra-fast paced project schedule aimed to begin construction in Summer of 2020 – a four month design schedule from topo survey to bid documents. The project included replacing existing sidewalk with a wider pedestrian friendly ADA compliant sidewalk pathway including new ramps and driveways.

Citywide 2018-2019 & 2019-2020 Pavement Rehabilitation Projects | City Of Daly City, Ca Mr. Fisher managed the design of two projects simultaneously. Both projects involved pavement rehabilitation as well as traffic calming and pedestrian elements that include curb extensions, crosswalk and ADA improvements. In order to meet desired construction schedule, the City required an expedited design schedule for both projects. While the scope was extensive, exceeding $3M in construction, Michael managed the projects within a very compact 2-month site assessment/feasibility time period and a 2-month design schedule.

Neighborhood Street Enhancement | City Of Redwood City, Ca Mr. Fisher served as the Project Manager for improvements in three adjacent neighborhoods to the Stanford University Office Campus. The goals of the NSEP are to improve traffic safety, mobility, accessibility, and provide enhanced streetscapes. All improvements are located in the City, except 3 projects are located in unincorporated San Mateo County, and 5 are located in the County and the City. This required additional coordination with the two jurisdictions and inclusion of both jurisdiction’s standards in the documents.

Bicycle Lane Improvements on Pruneridge Avenue at Lawrence Expressway | City of Santa Clara, CA
Mr. Fisher served as the Project Manager for this bicycle lane gap closure crossing Lawrence Expressway. The scope of work included preparing various preliminary designs for staff evaluation, in the form of a Design evaluation memo. An optimal project was selected from this report. He assisted the City in preparing for community outreach and BPAC meetings for stakeholder feedback. He managed the completion of the PS&E package for the project, including construction support.






 
 





C.4.d
Packet Pg. 127 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 18 Hal

LICENSES &

CERTIFICATIONS
Professional Civil Engineer
State of California
C70058

EDUCATION
Bachelor of Science
Civil Engineering
North Carolina State University
Raleigh, NC
Williams PE
Principal Engineer
Mr. Williams is a civil engineer with over 20 years of experience in transportation design, complete street projects, and project management. He has managed and designed projects ranging in size from $50,000 to over $350 million. Mr. Williams has extensive experience in managing staff, both technical and administrative, as well as managing a project to its completion.

RELEVANT EXPERIENCE
Safe Routes for Seniors | City of Hayward, CA
Mr. Williams served as CSG Project Manager of the civil design of this Safe Routes for Seniors project which improved the senior pedestrian environment in Hayward Downtown Area. Scope of work involved the preparation of improvement plans for bulb outs, ADA compliant curb ramps and sidewalks, median modifications and associated modifications to existing utilities designed to focus on the specific needs of seniors, and to prepare cost estimates in accordance with federally funded guidelines. Mr. Williams managed the coordination with City staff, BART, AC Transit, and utility owners.

Santa Clara School Access Improvements | City of Santa Clara, CA Mr. Williams served as the project manager for this One Bay Area Grant Cycle 2 (OBAG 2) and Vehicle Emissions Reductions Based at Schools (VERBS) funded project. He led the design of improvements at multiple intersections to enhance connectivity for students walking, biking, and scootering to 4 elementary schools in Santa Clara. He managed the preparation of the crosswalk evaluation memo, and prepared the E-76 and PS&E packages.

Ralston Corridor Improvement Phase 3 And 4| City of Belmont, CA Mr. Williams served as the Project Manager for the design of OBAG 2 funded improvements along this heavily trafficked corridor. The design emphasized bicycle, pedestrian, and vehicular access. In addition to installing Class II bike lanes in gaps, improving sidewalk conditions, ADA curb ramp upgrades, and pedestrian facility upgrades. He also managed multiple stakeholder, agency, community outreach and public forums in order to complete its final design while managing the federal funding process.

San Francisco Oakland Bay Bridge West Span Bike Lane PSR-PDS | BATA/MTC, Oakland, CA Mr. Williams served as the Project Manager for the preparation of a PSR-PDS for adding bike/pedestrian paths on the west span of the Bay Bridge from Yerba Buena Island to San Francisco. The 18-month, $1.3 million study developed design alternatives and costs for adding bike and pedestrian paths on the suspension span. The project required knowledge of the Caltrans project development process, bike and pedestrian projects, and experience in developing consensus amongst multiple agencies on high profile projects. Mr. Williams was responsible for project scheduling, preliminary designs and PSR development.

I-880 to State Route 238 East-West Connector | Caltrans, Fremont and Union City, CA Mr. Williams was a Segment Lead / Civil Engineer for the preliminary and final engineering for East West Connector project. Responsible for project scheduling using SureTrack, oversight and development of preliminary and final geometric drawings, construction cost estimates, and coordination between roadway, rail, landscape architect, electrical and geotechnical disciplines. This project includes development of Plans Specifications and Estimates (PS&E) for an improved link between I-880 and State Route 238 in the cities of Fremont and Union City. This multi-faceted project included 3.5 miles of new roadway and widening of existing roadways, three railroad underpasses to grade separate BART and UPRR, three bridges over the Old Alameda Creek and the Alameda County Flood Control District channel, integrated drainage and habitat mitigation work, and traffic signal and lighting design. The project included coordination with and designs to Caltrans and Cities of Union City and Fremont standards. The project includes designs for ADA compliance. 





 
 





C.4.d
Packet Pg. 128 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 19 Ed

LICENSES &

CERTIFICATIONS
Professional Civil Engineer
State of California | 039925

EDUCATION
Bachelor of Science, Civil Engineering
California Polytechnic State
University
| San Luis Obispo, CA

PROFESSIONAL

AFFILIATIONS
American Society of Civil Engineers
(ASCE)
American Public Works Association
(APWA)
Slintak PE
Principal Engineer
Mr. Slintak has over 35 years of experience in all aspects of transportation and municipal engineering, including project management and design group management. His design experience encompasses a wide variety of projects, including highways and streets, traffic signals and signing, street lighting, sewers and utilities, information technology systems, bus and rail maintenance facilities, and water treatment facilities.

RELEVANT EXPERIENCE
Hillside/Adeline Area Sanitary Sewer Collection System Replacement Project | County Of San Mateo, CA
Ed managed the evaluation and design of rehabilitation/replacements of the identified sewer mains within the Project Area and prepare the project contract documents for bidding and construction. The Project consisted of the rehabilitation or replacement of multiple reaches of sanitary sewer pipe at various locations by pipe bursting, open trench, CIPP, or pipe reaming methods over a total of approximately 6,744 linear feet of existing 6-inch or 8-inch Vitrified Clay Pipes (VCP), with the intention of eliminating infiltration and inflow.

Ahwahnee Drive Water, Sewer, And Complete Street Repair Project | City Of Millbrae, Ca Ed served as thee project manager for this complete street repair project which included water and sewer upgrades. Utility work as part of the complete street repair project included replacement of the existing sanitary sewer main, reconnection of sewer laterals, installation of new cleanouts and backflows, relocation of the existing water main, and replacement of water laterals up to the meter where necessary. The project also included rehabilitation of the existing pavement, installation of ADA compliant curb ramps, and spot repairs of concrete curb, gutter, and sidewalk where deficiencies were noted. Finally, the existing street lights along the corridor were upgraded with new street light poles and LED fixtures, new street light pull boxes were installed, and a new street light conduit was pulled into the roadway.

Hillcrest Boulevard Storm Drain Improvements | City of Millbrae, CA Mr. Slintak served as the Project Manager for the design of storm drain improvements to alleviate the existing storm drain system. The improvements included 925 linear feet of 24” diameter RCP storm drain, 32 linear feet of 18” diameter RCP storm drain, new manholes and a catch basin, and reconstruction of existing manhole and catch basin.

Howard Street Sanitary Sewer Line Rehabilitation | City Stockton, CA Mr. Slintak served as the project manager for the replacement of 6-inch vitrified clay pipe (VCP). The project scope included review of existing sewer pipe and manhole conditions, preparation of a design report with recommendation and selection of sewer replacement measures and alternative, sewer bypassing methods, and preliminary and final design services leading to the completion of plans, specifications and engineer estimate for construction, public outreach, support during bidding and construction.

Pilgrim – Union Streets Easement Sanitary Sewer Line| City Stockton, CA Mr. Slintak serves as the project manager for determining the rehabilitation measures and alternatives to evaluate and address capacity deficiencies, pipe deterioration and structural failures of an existing 6-inch diameter vitrified clay pipe (VCP) sanitary sewer line. The total length of the sewer line within the project area is approximately 384 feet.

The project scope includes review of the existing sewer pipe and manhole conditions, preparation of a design report with recommendation and selection of sewer rehabilitation treatment types and sewer bypassing methods, and preliminary and final design services leading to the completion of plans, specifications and engineer’s estimate for construction, public outreach and support during bidding and construction. 





 
 





C.4.d
Packet Pg. 129 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 20 Tom

LICENSES &

CERTIFICATIONS
Professional Civil Engineer
State of California
| C56247
California Office of Emergency
Services,
Safety Assessment Volunteer
Certified Confined Space Authorized
Entrant, Attendant, Supervisor/CalOSHA

EDUCATION
Bachelor of Science, Civil Engineering,
San Jose State University
| San Jose, CA

PROFESSIONAL

AFFILIATIONS
APWA Silicon Valley Chapter:

Member and Board Director (2014-
2017)
ACEC/DES Structures Liaison
Committee: District 4 Regular
Member (2010-2014) and
Committee Co-chair (2011)
Structural Engineers Association of
Northern California (SEAONC)
American Society of Civil Engineers
(ASCE)
Walker PE
Principal Engineer
Mr. Walker has a 27-year career dedicated to the development and delivery of transportationrelated structure projects. Over the course of his career, he has specialized in the project management, planning and design of major transportation structures in the San Francisco Bay Area and throughout California. His projects encompass urban and interstate highways as well as local bridge projects, including Corridor Mobility Improvement Account (CMIA)-funded and Federally-funded Highway Bridge Program (HBP) projects.

His management and planning expertise includes preparing bridge advance planning studies, bridge type selection reports, bridge seismic evaluations, bridge design or check calculations, and preparation of full PS&E and construction support services for new bridges, bridge replacement and retrofit projects. Proven management skills include leading bridge and roadway design team efforts; client communications; coordination with agencies, Caltrans and subconsultants; and management of project schedules and budgets.

Mr. Walker has been a regular member and former chair of the ACEC/Caltrans DES Structures Liaison Committee, which is comprised of top consultant and Caltrans leaders who work together to improve design, process and construction of bridge projects in the State of California.

RELEVANT EXPERIENCE
Sacramento Street Bridge Replacement | City of Vallejo, CA (HBP Funded) Project Manager representing the City during construction of a $9M federally funded bridge replacement project. The new bridge will replace the existing structurally deficient bridge and be built in stages with traffic detours and maintenance of pedestrian routes. Tom’s responsibilities include administration, preparation of Caltrans Local Assistance forms, coordination with all stakeholders such as City departments, Caltrans, regulatory agencies, utility companies, transit districts, residents, oversight of contractor and construction manager, coordination and review of RFI’s and project submittals.

Bridge Preventive Maintenance Planning Report | City of San Jose, CA Project manager for the review of over 80 bridge inspection reports for the City’s bridge structures that are eligible for bridge repair funding under the BPMP program. All structures were screened for eligibility. Other tasks included preparation of a summary report and BPMP funding application in Caltrans format for the City’s eligible bridge repair projects and identification of projects that are eligible for Bridge Investment Credit (BIC) to secure the funding and potential funding reimbursement.

Highway Bridge Funding Application | City of Oakley, CA Project Manager responsible for leading the inspections and preparing the PSR and HBP funding applications for two structures resulting in the City successfully receiving $2.5M in federal funding.

Development of the proposed bridge and roadway improvements included coordination with Caltrans District 4 structures local assistance throughout the process to ensure eligibility of the required replacement and rehabilitation scope.

Bridge Replacement Projects | Town of San Anselmo, CA
Project Manager responsible for continuing the preliminary design/environmental phase for three existing bridge replacement projects. Work included coordinating with bridge and roadway engineers and preparing exhibits for and participating in a “pop-up” community meeting for residents adjacent to the project.






 
 





C.4.d
Packet Pg. 130 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 21 Sophie

LICENSES &

CERTIFICATIONS
Professional Civil Engineer, State of
California
| 68110
Professional Land Surveyor, State of
California
| 8998
Qualified SWPPP
Developer/Practitioner
|QSD/QSP
NASSCO PACP/MACP/LACP Certified
| #U-1020-703010434

EDUCATION
Bachelor of Science, Civil Engineering
University of California Berkeley
| Berkeley, CA

TRAINING
California Subdivision Map Act
Seminar
Bay Area Hydrology Model (BAHM)
Municipal Regional NPDES Permit
Provision C.3 & C.6
Truong PE, PLS, QSD/P
Principal Engineer
Ms. Truong has 20 years of practice achieving a high level of client satisfaction in the design and project management of Capital Improvement Projects (CIP). Ms. Truong’s recent projects have included complete streets/multi-modal projects with green infrastructure improvements; underground wet and dry utility installations and rehabilitations. Ms. Truong has successfully coordinated several projects with Caltrans Local Assistance for the design of federally-funded projects.

Her duties as Project Manager include project scoping, preparation of design schedules, client coordination and meetings, management of large design teams consisting of staff engineers and subconsultants, coordination of work with utility companies, preparation of feasibility studies and hydrology/hydraulics reports, preparation of bid documents and engineer’s estimates, preparation of addenda, bidding and construction support, submittals review, inspections, construction management, and oversight of field inspection personnel when required. Sophie also regularly provides internal quality assurance/quality control for in-house projects.

Ms. Truong’s strengths lie in her ability to effectively manage teams and sub-consultants, provide superior service, and deliver a thorough product on-time and on-budget. Sophie takes pride in the on-going mentoring of staff and maintains a high-level of productivity among her team members.

RELEVANT EXPERIENCE
Safe Routes to School Project | City of San Mateo, CA
Ms. Truong served as the project manager for this federally-funded project, which involves curb extensions, curb ramps, and rectangular rapid flashing beacons. In addition to preparing the PS&Es for work adjacent to three school sites, she managed to coordinate the work of four design consultants and assemble a single bid schedule and set of technical specifications in anticipation of the Caltrans E76 Request to Proceed with Construction on behalf of the City. 2017 Street Resurfacing Project | Town of Hillsborough, CA The $2.7 million project consisted of the analysis and design for roughly 30 miles of pavement maintenance and rehabilitation for residential, collector, and arterial streets in the hillsides of Hillsborough, CA. Ms. Truong acted as project manager and handled all aspects of the project, including coordination with Town staff, management of subconsultants, pavement analysis and recommendations, recommendations for additional bicycle safety signage and striping, and preparation of PS&E for the 30 miles of street rehabilitation, a new 10,000 SF parking lot, a raised intersection, and resurfacing, striping and signage for Town Hall parking lot, and two Fire Station parking lots.

Sewage Basin C – Sewer Repair Project| City of San Mateo, CA Ms. Truong served as the Project Manager for this sewer evaluation and improvement design project.

As part of the initial Basin C Study, CSG evaluated closed circuit television (CCTV) inspection data for over 39 miles of piping network (approximately 1,000 active segments, manhole to manhole, located in both easements and City rights-of-way), and assessed and prioritized defects based on the urgency of repair and available funding. CSG used spreadsheet data analysis tools and Geographic Information System (GIS) mapping to facilitate the evaluation. Defect coding prepared by CCTV contractors were reviewed by NASSCO PACP (National Association of Sewer Service Companies Pipeline Assessment Certification Program) certified CSG staff. The results of CSG’s analysis was used to determine which sanitary sewer segments should be prioritized for repair, which type of rehabilitation would be most appropriate to each segment. As part of the design PS&E package preparation, CSG prepared a bid package that consisted of GIS-based plans, color photographs and written descriptions of repairs in easement (backyard) areas, and thorough specifications, thereby avoiding the need for costly topographic surveying efforts.






 
 





C.4.d
Packet Pg. 131 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 22 Phiroze

LICENSES &

CERTIFICATIONS
Professional Structural Engineer
State of California | 2020
Professional Civil Engineer
State of California | 20042
Professional General Building Contractor
State of California | 5021918
LEED Accredited Professional

EDUCATION
M.S.C.E, Structures and Soil Mechanics
University of Illinois | Urbana, Il
M.B.A, Management
Golden Gate University |
San Francisco, CA

PROFESSIONAL

AFFILIATIONS
American Society of Civil Engineers
Structural Engineers Association
of California
Earthquake Engineering
Research Institute
Applied Technology Committee
International Code Council
Wadia PE, SE, LEED AP
Principal Structural Engineer
Mr. Wadia is a plan review engineer for CSG. He has over 40 years of experience in plan review, design and construction of residential, commercial, industrial and civil engineering projects. Mr. Wadia has expertise in the delivery of a wide range of municipal services, including:
x Plan review
x Encroachment permit application review including grading, structural, drainage and erosion control permits
x Code enforcement
x Enhancing and developing new and existing City ordinances x Supervising renovation, rehabilitation and restoration of bridges x Inspecting buildings and structures for structural integrity and condition x Investigating structural failures and inspecting repairs

RELEVANT EXPERIENCE
Mr. Wadia’s range of expertise has evolved as a result of the successful completion of a variety of projects including:
x 24 commercial buildings
x 60 residential wood frame buildings
x 32 seismic inspections, evaluations &
retrofits
x 3 bridge and over-crossings projects
x 8 post-earthquake damage assessments
x 9 offshore, modular & Arctic projects
x 4 space & defense projects
x 3 war damaged re-construction
projects
x 8 petrochemical plants
x 10 nuclear/power plants
x 8 research projects
x 5 transportation projects
x 2 telecommunications projects
Plan Review Engineer | Consultant to City of Larkspur, City of Sausalito, Town of Ross, Town of San Anselmo, CA
As Consultant to the abovementioned agencies in Marin County, Mr. Wadia performed a variety of services including plan and encroachment permit application review, inspection, code enforcement, and enhancing and developing existing and new city ordinances.

Associate | Skidmore, Owings & Merrill, San Francisco, CA As an Associate at a San Francisco architectural and engineering firm, Mr. Wadia worked closely with multidisciplinary teams on building designs from concept through construction.

He led structural engineering projects including high-rise office buildings, schools and colleges, hotels, sports stadiums, theaters, retirement communities, and shopping centers. Mr. Wadia also performed seismic inspections, evaluations, and retrofits of existing facilities.

Chief Engineer | Bechtel, San Francisco, CA
As Chief Engineer of Bechtel, Mr. Wadia was responsible for leading a group of over 200 technical personnel including architects, structural engineers, civil engineers and designers.

His work included establishing standards, reviewing technical quality, recruiting, and establishing training programs. His projects included bridges and industrial and mining facilities such refineries, oil fields, LNG plants, chemical waste treatment plants, offshore construction, modularized construction, arctic and extreme hot weather construction, space launch facilities, solar and geothermal power plants, and nuclear facilities. 





 
 





C.4.d
Packet Pg. 132 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 23 Mohinder

LICENSES &

CERTIFICATIONS
Professional Civil Engineer
State of California
| 25039
Licensed Traffic Engineer
State of California
|1166

EDUCATION
Master of Science, Civil Engineering
Punjab University
| India
Sharma PE, TE
Principal Engineer
Mr. Sharma has extensive experience and knowledge of municipal engineering practices gained over thirty years of service with various Bay Area cities, including as the City Engineer for the cities of Daly City and Martinez. Over his 8 years with CSG, Mr. Sharma has served as Project Manager in Campbell and Albany, Development Review Manager in Hayward, CIP Manager in Woodside, and City Engineer in Half Moon Bay and Monte Sereno. He has a broad understanding of Caltrans RWQCB and other regulatory agencies’ processes and standards. His wealth of municipal engineering experience includes:
x CIP development and management for on-time/within-budget project delivery x Design and Construction Oversight of all public infrastructure improvements x Public Infra-structure improvement Masterplans
x Development project reviews, map approvals, permits, and impact fee studies x Grant fund applications and management

RELEVANT EXPERIENCE
Mr. Sharma has developed impressive project management and construction management skills while working in the Cities of Martinez, South San Francisco, Daly City, Half Moon Bay, Monte Sereno, Hayward, Albany, and Campbell as a public employee and later through CSG Consultants.

CIP Development and Management
Mr. Sharma has managed various public infrastructure improvement projects from conception to completion. This includes conceptual plan and work scope development through effective public participation, public meeting presentations, studies, designs, environmental reviews, construction bid invitations, contract awards, construction oversight and contract administration. He has managed local and grant funded projects for: street rehabilitation, overhead utility undergrounding and streetscape enhancements; bike and pedestrian pathways; traffic flow improvements; signal installation and coordination; water, sewer, and drainage system improvements; parks, public grounds, buildings and other municipal infrastructure improvements.

Construction Management and Contract Administration
Mr. Sharma has provided contract administration and construction management for various types of public infra-structure improvement projects. He oversees development and implementation of preconstruction measures to minimize public inconvenience and safety issues. This includes periodic informational written notifications before and during construction. Mr. Sharma is thoroughly familiar with construction practices, worker safety laws, storm water pollution prevention and other requirements to assure high quality, maximum safety and minimum public inconvenience while maintaining good working relations with construction contractors and minimizing potential claims.

Mr. Sharma has experience in all aspects of construction contract administration, including resolution of bid protests, contract change requests, tort and sub-contract claims. He reviews bid documents before construction to minimize the potential for field changes during construction. He has served as the Resident Engineer on several state/federal grant-funded projects.

Development Plan Review and Map Approval
Mr. Sharma has assisted the City’s Planning staff, committees and commissions in assessing the proposed development impacts on public infrastructure, recommended conditions of approval, and development plan reviews for compliance with the approval conditions. As the City Engineer, he has reviewed and approved several maps, including land subdivision maps, lot-line adjustment documents, record of survey maps and easement grant deeds. He assisted with preparation of development agreements, permits, and construction oversight. 





 
 





C.4.d
Packet Pg. 133 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Advanced Mobility Group | [email protected] | P: 415.688.0024

EDUCATION
M.S. Transportation
Engineering/Operations
Research, University of
Delaware, Newark, Delaware,
2001
M.Eng Transportation
Engineering, University of Tokyo,
Tokyo, Tokyo, 1995
B.Tech (hons) Civil, Indian
Institute of Technology,
Kharagpur, West Bengal, 1992

CA REGISTRATIONS
Professional Engineer #68928,
California Board for Professional
Engineers, Land Surveyors, and
Geologists
Professional Engineer #1103,
Professional Traffic Operations
Engineer

INTELLIGENT

TRANSPORTATION

SYSTEMS
9 ITS System Review & Needs
Assessment
9 Traffic Management Centers
9 Traffic Operations
9 Knowledge of Existing &
Emerging Transportation
Technologies
9 Innovative Congestion
Management Strategies
9 Stakeholder Coordination
Joy Bhattacharya P.E., PTOE
Vice President, Innovative Transportation Solutions
Joy is AMG’s Vice President of Innovative Transportation Solutions. He has indepth experience in the development, design and implementation of various engineering strategies in major metropolitan areas, including Adaptive/Responsive Traffic Signal Systems and Transit Priority Systems; Incident Management Plans; design of automated Electronic Toll Collection systems; preparation of PS&E for field implementation of CCTV, Changeable Message Signs, Highway Advisory Radio, Ramp Metering and ATMS systems; and freeway and arterial operations using micro-simulation. Local projects to his credit include the Mountain House ATMS, City of Hayward Adaptive Signal Systems, Webster Street SMART Corridor System, I-80 Integrated Corridor Management, and the Santa Clara VTA Capitol Corridor Transportation Study.

Project Experience
Harding Way Traffic Signal Modification, Stockton, California (Project Manager). This project involved improvements to the intersections of Harding Way/Center Street and Harding Way/El Dorado Street, and to the sections of Harding Way separating and approaching these intersections from the east and west. The proposed project involved roadway improvements, traffic signal modifications, signing and striping modifications, safety lighting, installation of video monitoring system, drainage adjustments, and wheelchair ramp construction at intersections on Harding Way. The signal designs and signing and striping details conformed to the City standards, California MUTCD guidelines, and Caltrans standard plans, specifications and design requirements. Joy led the design effort actively communicating with subconsultants and City staff to provide the final PS&E. Joy provided the construction support for implementation of the design.

Webster Street SMART Corridor Project, Alameda County, Ca. (Project Manager). Joy was as the Project Manager for the Webster Street SMART Corridor Project. The project the developed a TSP system to reduce travel time along five AC Transit lines; designed traffic signal coordination systems along Webster Street and Constitution Way/Lincoln Avenue; designed a new traffic signal at Webster/Pacific Avenues and signal modifications at five intersections; designed and implemented an Advance(VDS); designed and implemented a CCTV system; and implemented an ATIS.

Design for Route 238 Improvements, Hayward, CA (Project Manager). Joy managed the evaluation and design of an Advanced Traffic Management System with adaptive coordination capabilities. The design plans were completed on a fast-track schedule, and the roadway improvements and signal modifications are now under construction.






 
 





C.4.d
Packet Pg. 134 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements)

CHARLES GARDELLA, RLA
WZ/E/W>ͳ/Eͳ,Z'


AREAS OF EXPERTISE
ͻ ZĞƋƵŝƌĞŵĞŶƚƐ
ͻ ĞƐŝŐŶ
ͻ ŽŶƐƚƌƵĐƟŽŶŽĐƵŵĞŶƚƐ
ͻ ŽŶƐƚƌƵĐƟŽŶZĞǀŝĞǁƐ
ͻ ĂLJͲ&ƌŝĞŶĚůLJ>ĂŶĚƐĐĂƉĞƐ
ͻ dĞĐŚŶŝĐĂůZĞǀŝĞǁ
ͻ >

ĞƌƟĮĐĂƟŽŶ
ͻ 'ƌĞĞŶͬ^ƵƐƚĂŝŶĂďůĞĞƐŝŐŶƐ
ͻ 'ƌĞĞŶZŽŽĨĞƐŝŐŶ
ͻ WůĂLJŐƌŽƵŶĚ^ƚƌƵĐƚƵƌĞƐ
ͻ WůĂLJŐƌŽƵŶĚ^ĂĨĞƚLJ
ͻ ZŽŽĨĚĞĐŬĞƐŝŐŶ
ͻ ^LJŶƚŚĞƟĐdƵƌĨͬ^ƉŽƌƚƐ&ŝĞůĚƐ
Z
'/^dZd/KE^
>ĂŶĚƐĐĂƉĞƌĐŚŝƚĞĐƚ͕ηϰϳϮϭ͕
ĂůŝĨŽƌŶŝĂ͕
džƉŝƌĂƚŝŽŶ͗^ĞƉƚĞŵďĞƌϮϬϮϯ

hd/KE
͘^͘>ĂŶĚƐĐĂƉĞƌĐŚŝƚĞĐƚƵƌĞ͕h͘͘ĂǀŝƐ͕
ϭϵϵϴ
WZK&
^^/KE>
yW
Z/
E

'ĂƚĞƐΘƐƐŽĐŝĂƚĞƐ͕ϭϵϵϴͲWƌĞƐĞŶƚ
>Z
'ƌĂĚŝŶŐ/ŶƐƚƌƵĐƚŽƌ͕^>͕ϮϬϬϮ
^ƵƐƚĂŝŶĂďůĞŽŵŵƵŶŝƚŝĞƐŽŶƐŽƌƚŝƵŵ͕
ϭϵϵϳͲϭϵϵϴ
WZK&
^^/KE>&&/>/d/KE^
ĂůŝĨŽƌŶŝĂWĂƌŬƐĂŶĚZĞĐƌĞĂƚŝŽŶ^ŽĐŝĞƚLJ
CHARLES GARDELLA ŚĂƐ ǁŽƌŬĞĚ ŽŶ Ă ǁŝĚĞ ƌĂŶŐĞ ŽĨ ƉƵďůŝĐ ĂŶĚ ƉƌŝǀĂƚĞ ƉƌŽũĞĐƚƐǁŝƚŚĂĨŽĐƵƐŽŶĐŽŶƐƚƌƵĐƚŝŽŶĚŽĐƵŵĞŶƚĂƚŝŽŶĂŶĚĂĚŵŝŶŝƐƚƌĂƚŝŽŶ͘ƐĂŶ ĂĐĐŽŵƉůŝƐŚĞĚůĂŶĚƐĐĂƉĞĂƌĐŚŝƚĞĐƚǁŝƚŚϮϯнLJĞĂƌƐŽĨĞdžƉĞƌŝĞŶĐĞ͕ŚĞŚĂƐĚĞǀĞůŽƉĞĚ Ă ƐƚƌŽŶŐ ƚĞĐŚŶŝĐĂůĞdžƉĞƌƚŝƐĞ ƚŚĂƚŵĂŬĞƐ ŚŝŵĂŶĞdžĐĞƉƚŝŽŶĂů WƌŽũĞĐƚDĂŶĂŐĞƌ͘ ,ĂǀŝŶŐŵĂŶĂŐĞĚŶƵŵĞƌŽƵƐƉƵďůŝĐƉƌŽũĞĐƚƐ͕ŚĂƌůĞƐďƌŝŶŐƐƐĞĂƐŽŶĞĚĨĂŵŝůŝĂƌŝƚLJ ǁŝƚŚƚŚĞŝƌƵŶŝƋƵĞŝƐƐƵĞƐ͘ŚĂƌůĞƐŝƐǁĞůůͲǀĞƌƐĞĚŽŶƚŚĞĚĞƐŝŐŶŽĨ>

͕,W^͕ĂŶĚ
ĂLJͲ&ƌŝĞŶĚůLJƉƌŽũĞĐƚƐ͕ĂŶĚŝƐĂĚĞƉƚĂƚĐŽŽƌĚŝŶĂƚŝŶŐǁŝƚŚŵƵůƚŝĚŝƐĐŝƉůŝŶĂƌLJƚĞĂŵƐ ƚŽƐƵĐĐĞƐƐĨƵůůLJĚĞůŝǀĞƌĐŽŵƉůĞdžƉƌŽũĞĐƚƐŽŶƚŝŵĞĂŶĚǁŝƚŚŝŶďƵĚŐĞƚ͘

RELEVANT PROJECT EXPERIENCE
ͻ ĂůĨŽƵƌZŽĂĚ/ŶƚĞƌĐŚĂŶŐĞ͕ƌĞŶƚǁŽŽĚ͕
ͻ ^ĂŶĚƌĞĞŬ
džƚĞŶƐŝŽŶ͕ƌĞŶƚǁŽŽĚ͕
ͻ ϲϴϬ^ŽƵŶĚǁĂůů͕^ĂŶ:ŽƐĞ͕
ͻ ŚĂƌĐŽƚǀĞŶƵĞ
džƚĞŶƐŝŽŶŽǀĞƌ/ͲϴϴϬ͕^ĂŶ:ŽƐĞ͕
ͻ ŽƵŐŚĞƌƚLJZŽĂĚ/ŵƉƌŽǀĞŵĞŶƚƐ͕ƵďůŝŶ͕
ͻ ƵďůŝŶŽƵůĞǀĂƌĚ͕ƵďůŝŶ͕
ͻ
ůĂŵŝŶŽZĞĂůͬ^ĞƌƌĂŵŽŶƚĞůǀĚ͘/ŶƚĞƌƐĞĐƟŽŶ͕ŽůŵĂ͕
ͻ
ůŚĂƌƌŽZŽĂĚͬ&ƌŝĞƐŵĂŶZŽĂĚWĂƌĐĞůƐ͕>ŝǀĞƌŵŽƌĞ͕
ͻ ,ĞĂůĚƐďƵƌŐϱtĂLJ/ŶƚĞƌƐĞĐƟŽŶZŽƵŶĚĂďŽƵƚ͕,ĞĂůĚƐďƵƌŐ͕ ͻ ,ŝŐŚǁĂLJϭϬϭĂƚŝƌƉŽƌƚŽƵůĞǀĂƌĚ͕^ŽŶŽŵĂŽƵŶƚLJ͕
ͻ /ͲϱϴϬͬ
ůŚĂƌƌŽ^
Y/ŵƉƌŽǀĞŵĞŶƚƐ͕>ŝǀĞƌŵŽƌĞ͕
ͻ /ͲϱϴϬͬ
ůŚĂƌƌŽ^tY/ŵƉƌŽǀĞŵĞŶƚƐ͕>ŝǀĞƌŵŽƌĞ͕
ͻ /ͲϲϴϬͬĞƌŶĂů/ŵƉƌŽǀĞŵĞŶƚƐ͕WůĞĂƐĂŶƚŽŶ͕
ͻ :ĂĐŬ>ŽŶĚŽŶŽƵůĞǀĂƌĚ
džƚĞŶƐŝŽŶ͕>ŝǀĞƌŵŽƌĞ͕
ͻ DĂƌŝŶĂĂLJ'ƌĂĚĞ^ĞƉĂƌĂƟŽŶ͕ZŝĐŚŵŽŶĚ͕
ͻ DĂƚŚŝůĚĂǀĞŶƵĞ>ĂŶĚƐĐĂƉĞWƌŽũĞĐƚ͕^ƵŶŶLJǀĂůĞ͕
ͻ DŝƐƐŝŽŶŽƵůĞǀĂƌĚŽƌƌŝĚŽƌ/ŵƉƌŽǀĞŵĞŶƚƐWŚ͘//͕,ĂLJǁĂƌĚ͕ ͻ D^EϮ͕WĞƚĂůƵŵĂ͕
ͻ D^EDŝƟŐĂƟŽŶΘKƌĂŶŐĞǀĞ^ŽƵŶĚtĂůů͖EŽǀĂƚŽΘhŶŝŶĐŽƌƉŽƌĂƚĞĚŽƵŶƚLJ ŽĨDĂƌŝŶ͕
ͻ WůLJŵŽƵƚŚΘ^ƉĂĐĞZĞĂůŝŐŶŵĞŶƚ͕DŽƵŶƚĂŝŶsŝĞǁ͕
ͻ WƌĞŵŝƵŵKƵƚůĞƚƐƌŝǀĞ͕>ŝǀĞƌŵŽƌĞ͕
ͻ ^ĂŶŶƚŽŶŝŽĞŶƚĞƌƵŝůĚŝŶŐ^Ͳϭ͕DŽƵŶƚĂŝŶsŝĞǁ͕
ͻ ^ƚŽŶĞƌŝĚŐĞƌŝǀĞ
džƚĞŶƐŝŽŶ͕WůĞĂƐĂŶƚŽŶ͕
ͻ dƌĞĂƚŽƵůĞǀĂƌĚ
džƚĞŶƐŝŽŶ͕ŽŶĐŽƌĚ͕
ͻ sdzŽƌŬ^ƚƌĞĞƚ/ŵƉƌŽǀĞŵĞŶƚƐ͕sĂůůĞũŽ͕
ͻ tĞƐƚdƵƐDĂŝŶƚĞŶĂŶĐĞ&ĂĐŝůŝƚLJ͕WŝŶŽůĞ͕






 
 





C.4.d
Packet Pg. 135 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Leslie Allen
Senior Regulatory Permitting Specialist
Leslie Allen is a Principal with WRA, Inc. specializing in managing multidisciplinary teams to support clients through complex environmental permitting, mitigation, and monitoring efforts in the greater San Francisco Bay Area. The technical skills that Leslie developed earlier in her career as a field biologist, wetland delineator, and construction monitor inform her approach to navigating environmental compliance and the relationships among regulators, project proponents, construction contractors, and other stakeholders. Leslie is experienced with managing projects from conception to completion. She also is adept at picking up projects where others have left off and getting them to construction.

Relevant Project Experience
Transportation
2019 Storm Damage Repair/Fort Ross Road Culvert Replacement, Sonoma County Department of Transportation & Public Works, Sonoma County, California
Project Manager/Regulatory Specialist
A major storm event in 2019 caused severe flooding in Sonoma County’s Russian River watershed, resulting in the failure of culverts and bridges at numerous locations. The County received Federal Emergency Management Administration (FEMA) funding for design and implementation of repairs along the damaged transportation routes. WRA provided environmental review and permitting services for road rehabilitation and two major culvert replacements where Fort Ross Road crosses a tributary of the Gualala River. Leslie managed a team of CEQA experts, biologists, and cultural resources specialists to obtain environmental clearance for implementing road rehabilitation and two culvert replacements in rural Sonoma County. Leslie’s team worked with the engineers to ensure that the project design aligned with environmental measures imposed by various federal and state agencies, to prepare permit applications, and develop a riparian mitigation approach that was feasible for the County to implement. Permits were issued in 2021 and the project will be constructed in 2022.

Dumbarton Rail Corridor, Cross Bay Transit Partners, San Mateo and Alameda Counties, California
Project Manager
San Mateo County Transit District partnered with Cross Bay Transit Partners to advance the exploration of feasible, modern transit options along the Dumbarton Rail Corridor, which includes a railroad crossing over San Francisco Bay that is more than 100 years old and passes through a National Wildlife Refuge. WRA’s early deliverables included a Preliminary Environmental Constraints Analysis which identified where the most sensitive and constraining biological resources occur and which is being utilized by project engineers to develop concept alternatives. From 2018 to 2020, Leslie managed all biological technical studies and environmental permitting tasks pertaining to the future project, which included habitat mapping and a wetland delineation along an approximately 12-mile linear project between Redwood City and Newark Junction.

Years of Experience
27 Education
M.S., Biology – Marine &
Estuarine Science Program,
Western Washington University
B.A., Biology, University of
California Santa Cruz
Professional Affiliations
Association of Environmental
Professionals (AEP)
San Francisco Bay Area Planning
and Urban Research Association
(SPUR)
WTS International (Women’s
Transportation Seminar), Pacific
West Region
Specialized Training
Federal Environmental
Requirements for Local Agency
Transportation Projects Off the
State Highway System, Caltrans
Local Technical Assistance Program
(LTAP), 2019
Environmental Negotiation, San
Francisco Bay Coastal Training
Program, 2016
Construction Site Compliance for
Water Quality Protection, San
Francisco Bay Water Board, 2011






 
 





C.4.d
Packet Pg. 136 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Experience and skills
Selected projects
Downtown San Mateo Opportunity Sites, MidPen Housing Corp, 480 E 4th Ave & 400 E 5th Ave, San Mateo:

Project Description Residential: Provide design service to 7-story residential complex of 225 units, including photovoltaic calculations for solar. Relocation of existing PMI pad mounted equipment and electrical box within private property outside of proposed residential building footing. One streetlighting package (includes photometrics) in East 4th St, East 5th St, and South Claremont including intersection of S. Claremont and East 4th. Provide 1000A Temporary Power (assuming 277/480V)
Project Description Garage: Service to 5-story above grade garage, 696 stalls, 106 EV ready. Provide 400A Temporary Power design
Booked April, 2021
Middlefield Road Improvement, Redwood City
Provide design and coordinate utility relocation and undergrounding in the public right-of-way along Middlefield Road from MacArthur Avenue to Fifth Avenue (approximately 0.5 miles) Booked in 2016
Sunnyvale Apartments - ATRIA, St. Anton Capital, 1008 E. El Camino Real, Sunnyvale Provide dry utility design and coordination for service to 5-story, 99 unit multifamily residential complex with underground parking and service to 3- story building consisting of 9 units; Booked August 25, 2017 Oakland 29 Apartments, Anton Devco Inc, 295 29th Street, Oakland:

Provide dry utility design for new electric, gas, AT&T, Comcast and conduit for future fiber for the following buildings:

Service to 7-story multifamily residential complex, consisting of 91 units and service for new streetlight on 29th Street
Coordinate all phases of schematic, design development and construction documents to obtain building permit approval for new dry utilities and services between civil, landscape, architect, structural engineers, city officials and PG&E.

Booked January 9, 2018
Tim Nguyen
Project Manager
Firm
Vizion Utility Partners
Personal summary
Education:

Civil Engineer, B.S.

Registrations:

Years of experience:
10 Years with current firm:
4 Key skills:

Managing multiple
complex utility design
projects, understanding
public utility standards,
public & private
development codes,
project scheduling, cost
controls, communication
written & verbal
Availability:

Currently available






 
 





C.4.d
Packet Pg. 137 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 2022 Engineering Division Hourly Rates
CSG services are billed on a time-and-materials basis according to our Standard Rates, shown below.

Professional Engineering Services 2022
Hourly Rate
Engineering Trainee $70
Administrative Assistant $80
Analyst $135
Engineering Designer/CASp Inspection & Consultation $145 Construction Inspector $150
Senior Analyst $160
Assistant Resident Engineer $175
Assistant Engineer $150
Associate Engineer $180
Senior Construction Inspector $165
Senior Engineer $205
Senior Land Surveyor $205
Resident Engineer $210
Structure Representative $210
Senior Structural Engineer $225
Senior Project Manager $225
Principal Engineer $240
Senior Principal Engineer $260
Two-Person Survey Crew $340
Sustainability Program Management Services Hourly Rate
Sustainability Program Analyst $140
Sustainability Program Senior Analyst $165
Sustainability Program Manager $195
All hourly rates include overhead costs including, but not limited to, salaries, benefits, Workers Compensation Insurance, travel and office expenses. CSG will coordinate the pickup and return of plans to and from CSG offices.

Overtime work will be billed at 1.5x the hourly rates indicated in the table above. On each anniversary of the contract start date, CSG will initiate a rate increase based on change in CPI-U for the applicable region. CSG will mail/email an invoice every month for services rendered during the previous month. 





 
 





C.4.d
Packet Pg. 138 Attachment: CSG Consultants, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) PSA_City Attorney Approved Version 040821

AGREEMENT FOR ON-CALL CIVIL/STRUCTURAL DESIGN SERVICES
Wood Rodgers, Inc.

THIS AGREEMENT is made and entered into as of the _____ day of __________________, 2022 by and between the City of Brentwood, a municipal corporation of the State of California ("City"), and Wood Rodgers, Inc., an S Corporation ("Consultant") (each a “Party” and collectively, the “Parties”).

RECITALS
A. City requires the professional services of a consultant specifically trained and experienced in civil/structural design services, which are professional services outside of services offered by City.

B. Consultant has the professional skills and experience necessary to perform the services described in this Agreement.

C. Consultant customarily engages in these services as part of its independently established trade, occupation, and/or business, separately from its work for City.

D. City desires to engage Consultant to provide these services by reason of its qualifications and experience in performing such services
E. Consultant has submitted a proposal to City and has affirmed its willingness and ability to perform such work on the terms and manner set forth in this Agreement.

NOW, THEREFORE, in consideration of these recitals and the mutual covenants contained herein, the Parties agree as follows:

1. Scope of Work.

1.1 City retains Consultant, as an independent contractor, to perform, and Consultant agrees to render, those services (the "Services") that are described in the attached Exhibit "A," which is incorporated by this reference, pursuant to this Agreement’s terms and conditions.

1.2 Consultant will control the manner and the means of the work to be performed, and be responsible for the professional quality, technical accuracy and coordination of the Services. Consultant will, without additional compensation, correct or revise any errors or deficiencies in the Services.

1.3. Consultant will keep City informed on a regular basis that the Services are being performed in accordance with the requirement and intentions of this Agreement.

1.4 If applicable, Consultant has designated those persons listed in Exhibit “A” to provide the Services to the City. Consultant will not change or reassign those persons described in Exhibit “A” without prior written notice to City, and will not replace those individuals with individuals to whom City has a reasonable objection.

2. Standard of Performance. Consultant acknowledges that in entering into this Agreement the City is relying on Consultant's special skills and experience to do and perform the Services. While performing the Services, Consultant will exercise the reasonable professional care and skill customarily exercised by reputable members of Consultant's profession practicing in the Northern California area. The acceptance of the Services by City does not release Consultant from these obligations.

Consultant will be responsible for employing or engaging all persons necessary to perform the Services.

Consultant will control the manner and means of the services to be performed by its employees and subconsultants. All of Consultant's staff will be qualified by training and experience to perform their assigned tasks. Consultant will give its personal attention to the fulfillment of the provisions of this Agreement by all of its employees and subcontractors, if any, and will keep the Services under its control. 








 




C.4.e
Packet Pg. 139 Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 2 PSA_City Attorney Approved Version 040821
On demand of City, if any employee or subcontractor of Consultant fails or refuses to carry out the provisions of this Agreement or appears to be incompetent or to act in a disorderly or improper manner, he or she will be discharged immediately from the Services.

3. Term. Unless earlier terminated, the term of this Agreement will be effective for a period of one year from the date first above written. The City Manager may amend the Agreement to extend it for two additional one-year periods or parts thereof in an amount not to exceed one hundred thousand dollars ($100,000) per Agreement year. Extensions will be based upon a satisfactory review of Consultant's performance, City needs, and appropriation of funds by the City Council. The parties will prepare a written amendment indicating the effective date and length of the extended Agreement.

4. Schedule. Consultant will generally adhere to the schedule set forth in Exhibit “A” provided, that City will grant reasonable extensions of time for the performance of the Services occasioned by unusually lengthy governmental reviews of Consultant’s work product or other unavoidable delays occasioned by unforeseen circumstances; provided, further, that such unavoidable delay will not include strikes, lockouts, work stoppages, or other labor disturbances conducted by, or on behalf of, Consultant’s officers or employees.

Consultant acknowledges the importance to City of City’s project schedule and agrees to put forth its best professional efforts to perform the Services in a manner consistent with that schedule. City understands, however, that Consultant’s performance must be governed by sound practices. Consultant will work such overtime or engage such personnel and equipment as necessary to maintain the schedule, without additional compensation.

5. Compensation.

5.1 The total fee payable for the Services to be performed during the term of this Agreement will be a not to exceed amount of one hundred thousand dollars ($100,000) as may be further specified in the attached Exhibit “A.” No other compensation for the Services will be allowed except for items covered by subsequent amendments to this Agreement. The City reserves the right to withhold a ten percent (10%) retention until City has accepted the Services.

5.2 Payment will occur only after receipt by City of invoices sufficiently detailed to include hours performed, hourly rates, and related activities and costs for approval by City.

5.3 Within thirty (30) days after receipt of any applicable progress payment request, City will verify the accuracy of the request, correct the charges where appropriate, and make payment to Consultant in an amount equal to the amount of such application, as verified or corrected by City. No payment made prior to completion and acceptance of the Services will constitute acceptance of any part of the Services.

City reserves the right to withhold payment from Consultant on account of Services not performed satisfactorily, delays in Consultant's performance of Services, or other defaults hereunder.

6. Status of Consultant. Consultant will perform the Services as an independent contractor, free from the control and direction of City, in pursuit of Consultant’s independent calling, and not as an employee of City. The persons used by Consultant to provide the Services under this Agreement will not be considered employees of City for any purposes whatsoever and City will not pay any tax, workers’ compensation insurance, retirement contributions or unemployment contributions on behalf of Consultant or its employees or subcontractors. Consultant agrees to indemnify and pay City within thirty (30) days for any tax, retirement contribution, social security, overtime payment, unemployment payment or workers’ compensation payment, including, but not limited to, those based on any provision of the Federal Affordable Care Act, which City may be required to make on behalf of Consultant or any agent, employee, or contractor of Consultant for work done under this Agreement. The payment made to Consultant pursuant to the Agreement will be the full and complete compensation to which Consultant is entitled. City will not make any federal or state tax withholdings on behalf of Consultant or its agents, employees or subcontractors.

At the City’s election, City may deduct the amounts paid pursuant to this Section, from any balance owing to Consultant.









 




C.4.e
Packet Pg. 140 Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 3 PSA_City Attorney Approved Version 040821

7. Subcontracting. Consultant's services are being requested by City because they are unique and personal. Except as may be specified in Exhibit “A”, Consultant will not subcontract any portion of the Services without prior written approval of City Manager or his/her designee. If Consultant subcontracts any of the Services, Consultant will be fully responsible to City for the acts, errors and omissions of Consultant's subcontractor and of the persons either directly or indirectly employed by the subcontractor, as Consultant is for the acts and omissions of persons directly employed by Consultant. Nothing contained in this Agreement will create any contractual relationship between any subcontractor of Consultant and City.

Consultant will be responsible for payment of subcontractors. Consultant will bind every subcontractor and every subcontractor of a subcontractor by the terms of this Agreement applicable to Consultant's work unless specifically noted to the contrary in the subcontract and approved in writing by City.

8. Other Consultants. The City reserves the right to employ other consultants in connection with the Services.

9. Indemnification. Consultant agrees to indemnify, including the cost to defend, City, its officers, agents, volunteers and employees from any and all claims, demands, costs or liability that arise out of, or pertain to, or relate to the negligence, recklessness, or willful misconduct of Consultant and its agents in the performance of services under this Agreement, but this indemnity does not apply to liability for damages for death or bodily injury to persons, injury to property, or other loss, arising from the sole negligence, willful misconduct or defects in design by City or the agents, servants, or independent contractors who are directly responsible to City, or arising from the active negligence of City.

10. Insurance. Consultant will obtain and maintain, at its cost and expense, for the duration of the Agreement and any and all amendments, insurance against claims for injuries to persons or damage to property which may arise out of or in connection with performance of the Services by Consultant or Consultant’s agents, representatives, employees or subcontractors. The insurance will be obtained from an insurance carrier admitted and authorized to do business in the State of California. The insurance carrier is required to have a current Best's Key Rating of not less than "A:VII."

10.1 Coverages and Limits. Consultant will maintain the types of coverages and minimum limits indicated below, unless Risk Manager or City Manager, in consultation with the City Attorney approves a lower amount. These minimum amounts of coverage will not constitute any limitations or cap on Consultant's indemnification obligations under this Agreement. City, its officers, agents, volunteers and employees make no representation that the limits of the insurance specified to be carried by Consultant pursuant to this Agreement are adequate to protect Consultant. The coverage will contain no special limitations on the scope of its protection to the above-designated insureds except for Workers Compensation and errors and omissions insurance. Consultant will obtain occurrence coverage, excluding Professional Liability, which will be written as claims-made coverage. If Consultant believes that any required insurance coverage is inadequate, Consultant will obtain such additional insurance coverage, as Consultant deems adequate, at Consultant's sole expense.

10.1.1 Commercial General Liability Insurance. $2,000,000 combined single-limit per occurrence for bodily injury, personal injury and property damage. If the submitted policies contain aggregate limits, general aggregate limits will apply separately to the work under this Agreement or the general aggregate will be twice the required per occurrence limit.

10.1.2 Automobile Liability. $1,000,000 combined single-limit per accident for bodily injury and property damage.

10.1.3 Workers' Compensation and Employer's Liability. Workers' Compensation limits as required by the California Labor Code and Employer's Liability limits of $1,000,000 per accident for bodily injury. Workers' Compensation and Employer's Liability insurance will not be required if Consultant has no employees and provides, to City's satisfaction, a declaration stating this. 








 




C.4.e
Packet Pg. 141 Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 4 PSA_City Attorney Approved Version 040821

10.1.4 Professional Liability. Errors and omissions liability appropriate to Consultant’s profession with limits of not less than $1,000,000 per claim.

10.2 Endorsements. For Commercial General Liability Insurance, Consultant will ensure that the policies are endorsed to name the City, its officers, agents, volunteers and employees as additional insureds. Prior to City's execution of this Agreement, Consultant will furnish, to the satisfaction of the City, certificates of insurance and endorsements.

10.3 Cancellation. Insurance will be in force during the life of the Agreement and any extensions of it and will not be canceled without thirty (30) days prior written notice to City sent pursuant to the notice provisions of this Agreement.

10.4 Failure to Maintain Coverage. If Consultant fails to maintain any of these insurance coverages, then City will have the option to declare Consultant in breach of this Agreement, or may purchase replacement insurance or pay the premiums that are due on existing policies in order to maintain the required coverages. Consultant is responsible for any payments made by City to obtain or maintain insurance and City may collect these payments from Consultant or deduct the amount paid from any sums due Consultant under this Agreement.

10.5 Submission of Insurance Policies. City reserves the right to require, at any time, complete and certified copies of any or all required insurance policies and endorsements.

10.6 Primary Coverage. For any claims related to the Services and this Agreement, the Consultant’s insurance coverage will be primary insurance with respect to City, its officers, agents, volunteers and employees. Any insurance or self-insurance maintained by City for itself, its officers, agents, volunteers and employees, will be in excess of Consultant’s insurance and not contributory with it.

10.7 Reduction in Coverage/Material Changes. Consultant will notify City in writing pursuant to the notice provisions of this Agreement thirty (30) days prior to any reduction in any of the insurance coverage required pursuant to this Agreement or any material changes to the respective insurance policies.

10.8 Waiver of Subrogation. The policies shall contain a waiver of subrogation for the benefit of City.

11. Business License. Consultant will obtain and maintain a City of Brentwood Business License for the term of the Agreement, as it may be amended from time-to-time.

12. Maintenance of Records. Consultant will maintain complete and accurate records with respect to costs incurred under this Agreement. All records will be clearly identifiable. Consultant will allow a representative of City during normal business hours to examine, audit, and make transcripts or copies of records and any other documents created pursuant to this Agreement. Consultant will allow inspection of all work, data, documents, proceedings, and activities related to the Agreement for a period of three (3) years from the date of final payment under this Agreement.

13. Ownership of Documents.

13.1 All product produced by Consultant or its agents, employees, and subcontractors pursuant to this Agreement (the “Work Product”) is the property of City. In the event this Agreement is terminated, all Work Product produced by Consultant or its agents, employees and subcontractors pursuant to this Agreement will be delivered to City pursuant to the termination clause of this Agreement. Consultant will have the right to make one (1) copy of the Work Product for Consultant’s records.

13.2 The Work Product may be used by City and its agents, employees, representatives, and assigns, in whole or in part, or in modified form, for all purposes City may deem advisable, without further employment of or payment of any compensation to Consultant; provided, however, that if this Agreement is terminated for any reason prior to completion of the Project and if under such circumstances City uses, 








 




C.4.e
Packet Pg. 142 Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 5 PSA_City Attorney Approved Version 040821
or engages the services of and directs another consultant to use, the Work Product, City agrees to hold Consultant harmless from any and all liability, costs, and expenses relative to claims arising out of matters and/or events which occur subsequent to the termination of this Agreement as a result of causes other than the fault or negligence of Consultant, or anyone for whose acts it is responsible, in preparation of the Work Product. Consultant will not be responsible for deficiencies solely attributable to modifications of the Work Product performed by others, or that arise from use of the Documents in connection with a project or site other than that shown in the Work Product.

14. Copyrights. Consultant agrees that all copyrights that arise from the Services will be vested in City and Consultant relinquishes all claims to the copyrights in favor of City.

15. Confidentiality. All documents, reports, information, data, and exhibits prepared or assembled by Consultant in connection with the performance of the Services pursuant to the Agreement are confidential until released by the City to the public, and the Consultant will not make any of these documents or information available to any individual or organization not employed by the Consultant or the City without the written consent of the City before any such release.

16. Notices. Any notices relating to this Agreement shall be given in writing and shall be deemed sufficiently given and served for all purposes when delivered personally, by facsimile or by generally recognized overnight courier service, or five (5) days after deposit in the United States mail, certified or registered, return receipt requested, with postage prepaid, addressed as follows:

For City:

City of Brentwood
150 City Park Way
Brentwood, CA 94513
Phone No. (925) 516-5307
Attn: Jigar Shah
For Consultant:

Name: Wood Rodgers, Inc.

Title: President
Address: 3301 C Street, Building 100B
Sacramento, CA 95816
Phone: (916) 341-7760
Attn: Mark Rayback
Either Party may change its address for purposes of this section by giving the other Party written notice of the new address in the manner set forth above.

17. Conflicts of Interest.

17.1 City will evaluate Consultant’s duties pursuant to this Agreement to determine whether disclosure under the Political Reform Act and City’s Conflict of Interest Code is required of Consultant or any of Consultant’s employees, agents, or subcontractors. Should it be determined that disclosure is required, Consultant or Consultant’s affected employees, agents, or subcontractors will complete and file with the City Clerk those schedules specified by City and contained in the Statement of Economic Interests Form 700.

17.2 Consultant understands that its professional responsibility is solely to City. Consultant warrants that it presently has no interest, present or contemplated, and will not acquire any direct or indirect interest, that would conflict with its performance of this Agreement. Consultant further warrants that neither Consultant, nor Consultant’s agents, employees, subcontractors and consultants have any ancillary real property, business interests or income that will be affected by this Agreement or, alternatively, that Consultant will file with the City an affidavit disclosing this interest. Consultant will not knowingly, and will take reasonable steps to ensure that it does not, employ a person having such an interest in the performance of this Agreement. If after employment of a person, Consultant discovers that it has employed a person with a direct or indirect interest that would conflict with its performance of this Agreement, Consultant will promptly disclose the relationship to the City and take such action as the City may direct to remedy the conflict.









 




C.4.e
Packet Pg. 143 Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 6 PSA_City Attorney Approved Version 040821

18. General Compliance with Laws. Consultant will keep fully informed of federal, state and local laws and ordinances and regulations which in any manner affect those employed by Consultant, or in any way affect the performance of the Services by Consultant. Consultant will at all times observe and comply with these laws, ordinances, and regulations and will be responsible for the compliance of the Services with all applicable laws, ordinances and regulations.

19. Pandemic Health Laws. Consultant’s duty to comply with Laws includes compliance by Consultant with all local, state, or federal Laws that have been or may be enacted in response to the COVID-19 pandemic (collectively, “Health Laws”), which include all of the County of Contra Costa Health Orders. Failure to fully comply with the Health Laws constitutes a material default, subject to all available remedies including suspension or termination.

20. Discrimination and Harassment Prohibited. Consultant will comply with all applicable local, state and federal laws and regulations prohibiting discrimination and harassment.

21. Termination. In the event of the Consultant's failure to prosecute, deliver, or perform the Services, City may terminate this Agreement for nonperformance by notifying Consultant in writing pursuant to the notice provisions of this Agreement. Consultant has five (5) business days to deliver any documents owned by City and all work in progress to City address contained in this Agreement. City will make a determination of fact based upon the work product delivered to City and of the percentage of work that Consultant has performed which is usable and of worth to City in having the Agreement completed. Based upon that finding City will determine the final payment of the Agreement. In the event City elects to terminate, City will have the right to immediate possession of all Work Product and work in progress prepared by Consultant, whether located at the project site, at Consultant's place of business, or at the offices of a subconsultant.

Either Party, upon tendering thirty (30) calendar days written notice to the other Party, may terminate this Agreement for convenience. In this event and upon request of City, Consultant will assemble the work product without charge and put it in order for proper filing and closing and deliver it to City. Consultant will be paid for work performed to the termination date; however, the total will not exceed the lump sum fee payable under this Agreement. City will make the final determination as to the portions of tasks completed and the compensation to be made.

22. Covenants Against Contingent Fees. Consultant warrants that Consultant has not employed or retained any company or person, other than a bona fide employee working for Consultant, to solicit or secure this Agreement, and that Consultant has not paid or agreed to pay any company or person, other than a bona fide employee, any fee, commission, percentage, brokerage fee, gift, or any other consideration contingent upon, or resulting from, the award or making of this Agreement. For breach or violation of this warranty, City will have the right to terminate this Agreement for nonperformance, or, in its discretion, to deduct from the Agreement price or consideration, or otherwise recover, the full amount of the fee, commission, percentage, brokerage fees, gift, or contingent fee.

23. Claims And Lawsuits. By signing this Agreement, Consultant agrees that any Agreement claim submitted to City must be asserted as part of the Agreement process as set forth in this Agreement and not in anticipation of litigation or in conjunction with litigation. Consultant acknowledges that if a false claim is submitted to City by Consultant, it may be considered fraud and Consultant may be subject to criminal prosecution. Consultant acknowledges that California Government Code sections 12650 et seq., the False Claims Act, applies to this Agreement and, provides for civil penalties where a person knowingly submits a false claim to a public entity. These provisions include false claims made with deliberate ignorance of the false information or in reckless disregard of the truth or falsity of information. If City seeks to recover penalties pursuant to the False Claims Act, it is entitled to recover its litigation costs, including attorney's fees. Consultant acknowledges that the filing of a false claim may subject Consultant to an administrative debarment proceeding as the result of which Consultant may be prevented to act as a Consultant on any public work or improvement for a period of up to five (5) years. Consultant acknowledges debarment by another jurisdiction is grounds for City to terminate this Agreement. 








 




C.4.e
Packet Pg. 144 Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 7 PSA_City Attorney Approved Version 040821

24. Jurisdiction, Venue and Governing Law. Any action at law or in equity brought by either of the Parties for the purpose of enforcing a right or rights provided for by this Agreement will be tried in a court of competent jurisdiction in the County of Contra Costa, State of California, and the Parties waive all provisions of law providing for a change of venue in these proceedings to any other county. This agreement will be governed by the laws of the State of California.

25. Testimony. Consultant will testify at City's request if litigation is brought against City in connection with Consultant's services under this agreement. Unless the action is brought by Consultant, or is based upon Consultant's actual or alleged negligence or other wrongdoing, City, upon prior written agreement with Consultant will compensate Consultant for time spent in preparation for testimony, testimony, and travel at Consultant's standard hourly rates at the time of actual testimony.

26. Successors and Assigns. It is mutually understood and agreed that this Agreement will be binding upon the Parties and their respective successors. Neither this Agreement nor any part of it nor any monies due or to become due under it may be assigned by Consultant without the prior written consent of City, which will not be unreasonably withheld.

27. Section Headings. Section headings as used in this Agreement are for convenience only and will not be deemed to be a part of such sections and will not be construed to change the meaning of the section.

28. Waivers. The waiver by either Party of any breach or violation of any term, covenant, or condition of this Agreement or of any applicable law will not be deemed to be a waiver of such term, covenant, condition or law or of any subsequent breach or violation of same or of any other term, covenant, condition or law. The acceptance by either Party of any fee or other payment which may become due under this Agreement will not be deemed to be a waiver of any preceding breach or violation by the other Party of any term, covenant, or condition of this Agreement or any applicable law.

29. Entire Agreement. This Agreement, together with any other written document referred to or contemplated by it embody the entire Agreement and understanding between the parties relating to the subject matter of it. The City Manager is authorized, in consultation with the City Attorney, to agree to nonmaterial amendments to this Agreement. Neither this Agreement nor any of its provisions may be amended, modified, waived or discharged except in a writing signed by both parties.

30. Authority. The individuals executing this Agreement and the instruments referenced in it on behalf of Consultant each represent and warrant that they have the legal power, right and actual authority to bind Consultant to the terms and conditions of this Agreement.

31. Severability. If any term, provision, condition or covenant of this Agreement or its application to any party or circumstances shall be held, to any extent, invalid or unenforceable, the remainder of this Agreement, or the application of the term, provision, condition or covenant to persons or circumstances other than those as to whom or which it is held invalid or unenforceable, shall not be affected, and shall be valid and enforceable to the fullest extent permitted by law. 








 




C.4.e
Packet Pg. 145 Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 8 PSA_City Attorney Approved Version 040821

32. Signatures.

32.1 Counterparts. This Agreement may be executed in two or more counterparts, each of which together will be deemed an original, but all of which together will constitute the same instrument.

32.2 Digital/Electronic Signatures. Using a City-approved method, this Agreement may be executed through the use of digital or electronic signatures in accordance with Government Code Section

16.5. The presence of an electronic signature on this Agreement will be construed as the Parties’ consent to do business electronically.

CONSULTANT:
* By:

Printed Name: Mark Rayback
Title: President
** By:

Printed Name: Andrew Durling
Title: Secretary
CITY:

By:

Tim Y. Ogden, City Manager
ATTEST:

By:

Margaret Wimberly, City Clerk
APPROVED AS TO FORM:

By:

Damien Brower, City Attorney
If required by City, proper notarial acknowledgment of execution by Consultant must be attached. If a Corporation, Agreement must be signed by one corporate officer from each of the following two groups. *Group A. **Group B.

Chairman, Secretary,
President, or Assistant Secretary,
Vice-President CFO or Assistant Treasurer
Otherwise, the corporation must attach a resolution certified by the secretary or assistant secretary under corporate seal empowering the officer(s) signing to bind the corporation.

If an LLC:
x The Agreement must be signed by a Managing Member or the LLC must attach a resolution empowering the signatory to bind the LLC.

If a partnership:
x The Agreement must be signed by the Managing Partner or the Partner authorized to execute agreements of this type. Additional documentation, such as the partnership agreement, confirming this signature authority may be required.

If a sole proprietorship:
x The Agreement must be signed by the owner.









 




C.4.e
Packet Pg. 146 Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 9 PSA_City Attorney Approved Version 040821
EXHIBIT “A”

SCOPE OF SERVICES









 




C.4.e
Packet Pg. 147 Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) City of Brentwood | Statement of Qualifi cations for
Civil/Structural Design Services for
Infrastructure Projects (City of Developer Driven)
March 8, 2022









 




C.4.e
Packet Pg. 148 Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Corporate Office: 3301 C Street, Bldg. 100-B • Sacramento, CA 95816 • 916.341.7760 • Fax 916.341.7767 Pleasanton Office: 4670Willow Road, Suite 125 • Pleasanton, CA 94588 • 925.847.1556 • Fax: 925.847.1557 www.woodrodgers.com
March 8, 2022
Ms. Renee Payette
City of Brentwood
Public Works Department
150 City Park Way
Brentwood, California 94513
RE: Statement of Qualifications for Civil/Structural Design Services for Infrastructure Projects Dear Ms. Payette:

Wood Rodgers, Inc. recognizes that it takes more than just a “traditional” consultant team to meet the needs of the City of Brentwood (City) provided in the Request for Qualifications. We believe it takes a multi-talented team with diverse skills, knowledge, resources, and proven experience completing projects in complex and challenging environments to fulfill your expected consulting needs. We have been delivering a wide range of engineering services under on-call contracts for public, state, and federal agencies, including many throughout the Bay Area and Central Valley of California for over 20 years.

Mr. Brian Krcelic, PE, is based out of Wood Rodgers’ Pleasanton office and will serve as our Project Manager and Primary Point of Contact for this contract. Brian has over 40 years of experience managing transportation improvement projects throughout the Bay Area including on-call contracts for both local and federally funded projects. Additional support is provided by our pool of subconsultants, many of which are certified DBEs with Caltrans and have experience meeting goal requirements on federal/state funded contracts. Wood Rodgers has an excellent relationship and past working experience with all the potential subconsultants listed which ensures a cohesive team that operates seamlessly on any assigned projects or task orders.

Matthew Salveson, PhD, PE, will serve as the Principal-in-Charge for this project. As a Principal with the firm he can allocate any additional staff resources as needed to ensure this project’s success.

With the depth and diversity of qualifications we bring with this team, you will note that no size project is too big or too small for our consultant team. We do not believe in the “one size fits all” approach when it comes to creation of a project staffing plan.

We will assemble a customized staffing plan for every Task Order in order to best meet the needs and issues specific to the project’s goals.

Should you have any questions about this proposal, or require any additional information, please feel free to contact:

Brian Krcelic, PE at:

Wood Rodgers, Inc.
4670 Willow Road, #125
Pleasanton, CA 94588
Direct: (925) 398-7915 or Mobile: (925) 207-5835
Email: [email protected].

Sincerely,
Matt Salveson, PhD, PE Brian Krcelic, PE
Principal-in-Charge Project Manager,
Why Select the Wood Rodgers Team
• On-Call Contract Experience
• Staffing Capacity
• Deep Pool of DBE Subconsultants
• Strong Project Management
• Dedication to Quality









 




C.4.e
Packet Pg. 149 Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Statement of Qualifications for
Civil-Structural Design Services for Infrastructure Projects Wood Rodgers, Inc. – 22-0040 SUBMITTAL APPROACH | Firm Qualifications – Page 1 of 2.5 COVER LETTER (1 PAGE)
Insert









 




C.4.e
Packet Pg. 150 Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Statement of Qualifications for
Civil-Structural Design Services for Infrastructure Projects Wood Rodgers, Inc. – 22-0040 SUBMITTAL APPROACH | Firm Qualifications – Page 1 of 2.5

SUBMITTAL APPROACH
Firm Qualifications
Founded in 1997, Wood Rodgers, Inc.’s (Wood Rodgers) mission is to provide our clients with exceptional service, provide our employees with a great work environment, and provide lasting value to society as a whole in the work we do.

Wood Rodgers began with two engineers who were determined to create an energetic and innovative engineering firm that focused on the needs of their clients and a dynamic workplace where staff were encouraged to grow. As a result, the firm has grown into a unique company incorporating innovation and quality to each project, while adhering to schedules, budgets, and environmental constraints.

Wood Rodgers provides a flat organizational layering unlike other firms. We have adopted a network-modeled structure that places overall responsibility on the project managers and senior level engineers.

Wood Rodgers has successfully managed and completed numerous award-winning projects from inception to completion throughout the region, including those that require local, state, and federal agency approvals. We take pride in the fact that our principals and management staff are closely involved with the work product and are responsive to clients' needs. Our existing relationships with federal, state, and local agencies help to ensure the successful completion of our projects. We believe that our clients' success is our success.

Project Team Organization
The following organizational chart outlines our proposed team members and their role on this project. Full resumes for all staff shown are included as an appendix to this proposal. All staff shown are committed to the project will not be substituted without first consulting with the City and receiving specific approval in writing.

PRIMARY POINT-OF-CONTACT
Brian Krcelic, PE
4670 Willow Road, Suite 125
Pleasanton, CA 94588
Phone: (925) 398-7515
Email: [email protected]









 




C.4.e
Packet Pg. 151 Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Statement of Qualifications for
Civil-Structural Design Services for Infrastructure Projects Wood Rodgers, Inc. – 22-0040 SUBMITTAL APPROACH | Firm Qualifications – Page 2 of 2.5 Upon receiving a project specific RFP or task order assignment, our Contract/Project Manager Brian Krcelic, PE, will review the requested scope of work and assign the appropriate Task Order Manager based on their relevant qualifications and experience in relation to the project type and requested services; as well as their availability to commit to the duration of the project.

Staff Availability
The project team members identified in the organizational chart have been selected based on their relevant experience as well as their availability to commit to the duration of the project. It is noted that many of the individuals proposed are also partially committed to other projects. Quality engineering firms typically do not have idle staff standing by waiting for work.

The balancing of the work, adjustment of technical support staff, and scheduling of work tasks all are critical to ensure the most experienced and capable individuals are assigned to the work. The individuals noted herein are available to the capacity required and as outlined in the level of effort provided in our separate cost proposal. Adjustments to the work staff will not be made without prior consultation and approval of the City.

Subconsultants
The following is a listing of potential subconsulant team members, their contact information, and role description. It is noted that many of these subconsultants are DBE certified firms who can meet and/or exceed any DBE goal requirements for federally funded projects. Wood Rodgers has a working relationship with all the firms shown, many of which are team members on existing on-call contracts for federal funded projects. We understand that all subconsultant team members must be preapproved by the City before performing any work, and that no substitution of subconsultants will be allowed without the expressed written permission from the City. 








 




C.4.e
Packet Pg. 152 Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Statement of Qualifications for
Civil-Structural Design Services for Infrastructure Projects Wood Rodgers, Inc. – 22-0040 SUBMITTAL APPROACH | Firm Qualifications – Page Ϯ͘ϱ of 2.5 DBE TEANMING PARTNERS „ Cadre Design Group (DBE #42626) | CADD Support
Albert Sanchez | 7543 Old Pear Hill Lane | Penryn, CA | 95663 | (916) 663-2300 | [email protected]
„ David J. Powers & Associates (DBE #38205) |
Environmental
Will Burns | 1871 The Alameda, Suite 200 | San Jose, CA | 95126 | (510) 902-5851 | [email protected]
„ Diablo Engineering Group (DBE #42626) | QA/QC &
Estimates
Jennifer Harmon | 1300 Clay Street, #600 | Oakland, CA
| 94612 | (510) 550-8959 |
[email protected]
„ EXARO Technologies (DBE #35751) | Utility
Research/Potholing
Jose Dominguez | 1831 Old Bayshore Highway | Burlingame, CA | 94010 | (415) 756-5538 | [email protected]
„ PGA Design (DBE #41426) | Landscape Architecture
Christopher Kent | 444 17th Street | Oakland, CA |
94612 | (510) 550-8851 | [email protected]
„ TJKM (DBE #40772) | Traffic Calming/Signals/Striping
Atul Patel | 4305 Hacienda Dr. Suite 550 | Pleasanton, CA | 94588 | (925) 264-5003 | [email protected]

ADDITIONAL TEAMING

PARTNERS
„ Associated Right of Way Services, Inc. | Right-ofway Acquisition, Appraisal, & Cost Estimates Steve Castellano | 2300 Contra Costa Blvd., #525 |
Pleasant Hill, CA | 94523 | (925) 691-8500 |
[email protected]
„ Cal Engineering & Geology | Geotechnical, Utility
Potholing, & Specifications
Chris Hockett | 785 Ygnacio Valley Road | Walnut Creek, CA | 94596 | (925) 433-5015 | [email protected]
„ Giacalone Design Services, Inc. | Utility
Undergrounding/Joint Trench
Paul Giacalone | 8080 Santa Teresa Blvd., #240 | Gilroy, CA | 95020 | (925) 467-1740 |
[email protected]
„ Orion Engineers & Associates | Transportation Design
Shannon Holman | 1003 Bishop Street, #2020 | Honolulu, HI | 96813 | (808) 282-7986 |
[email protected]









 




C.4.e
Packet Pg. 153 Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Statement of Qualifications for
Civil-Structural Design Services for Infrastructure Projects Wood Rodgers, Inc. – 22-0040 SUBMITTAL APPROACH | Project Team – Page 1 of 1 Project Team
„ Matt Salveson, PhD, PE, | Principal-in-Charge | 35% Availability Education:

PhD, Civil Engineering, University of California, Davis MS, Civil Engineering, University of California, Davis
BS, Civil Engineering, University of California, Davis
Registration(s): Registered Professional Engineer, California No. 56351 Dr. Salveson has over 31 years of experience. He has delivered hundreds road, bridge, interchange, and freeway projects in California as project engineer, project manager, or resident engineer. He currently serves as a Principal Engineer where he is responsible for the delivery of transportation projects. Dr. Salveson is an active member of the American Public Works Association (APWA). „ Brian Krcelic, PE | Project/Contract Manager | 35% Availability Education: BS, Civil Engineering, California State Polytechnic University Pomona Certificate Management, University of California Irvine Registration(s): Registered Professional Engineer, California No. 33203 Mr. Krcelic has over 40 years of experience in the planning, design, and construction of major transportation improvement projects across California. He has been responsible for the design of Expressway and Conventional Highway improvements, Freeway Interchanges, HOV and Auxiliary Lanes, Sound Barriers, drainage improvements, and various types of structures. Brian is well-versed in Caltrans project development procedures including Project Study Reports, Project Reports, and PS&E. He has also managed numerous transportation projects for local agencies including street extensions; street widening; grade separations; pedestrian bridges; complete streets and traffic calming improvements; and corridor safety studies. Brian has also managed pedestrian improvements that include Safe Routes to School and ADA improvement projects. His street rehabilitation projects, include full reconstruction; and various types of pavement overlays and treatments. „ Kevin Gustorf, PE, QSD | Water & Sewer | 35% Availability Education: BS, Civil Engineering, Loyola Marymount University Registration(s): Registered Professional Engineer, California No. 64755 Qualified SWPPP Developer (QSD)
Mr. Gustorf has over 22 years of leadership and expertise in the water resources field. His experience includes the planning, design, construction and management of a wide variety of projects for local municipal public works agencies, special districts and private sector clients throughout California. His diverse experience includes water and wastewater master planning, hydraulic modeling, and hydraulic analysis and studies. Mr. Gustorf has managed projects ranging from small task orders, to large multi-discipline, complex projects with multi-million-dollar design fees. „ Chris Hodge, PE | Structures | 35% Availability
Education: MS, Structural Engineering, University of California, San Diego BS, Structural Engineering, University of California, San Diego Registration(s): Registered Professional Engineer, California No. 59925 Mr. Hodge has nearly 30 years of structural engineering experience and has been involved in the planning and design of new bridges and roads; concrete, steel, wood, and reinforced earth retaining structures; rehabilitation projects; emergency repairs; and seismic retrofits. He is experienced in all phases of project development and PS&E deliverables. Mr. Hodge is also experienced in working with local agencies and Caltrans Local Assistance; in the application of Caltrans design criteria for highway bridges, including the latest LRFD and seismic design requirements; in leading turn-key service teams; in providing on-call and emergency response services; and in the project development procedure related to environmental CEQA/NEPA compliance, PS&E deliverables, and federal funding timelines and programming forms. Mr. Hodge has proven performance managing project schedules and budgets, and is well versed in navigating within the constraints of the HBP and Caltrans programming having successfully gained approval on multiple challenging long approach roadway bridge projects. 








 




C.4.e
Packet Pg. 154 Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Statement of Qualifications for
Civil-Structural Design Services for Infrastructure Projects Wood Rodgers, Inc. – 22-0040 SUBMITTAL APPROACH | Project Experience – Page 1 of 3 Project Experience
Alameda County On-Call Civil Engineering Services for Federally-Funded Projects | Alameda County | CA Project Reference:

Palomares & Fairmont: Bond Ng | Alameda County Public Works Agency | 399 Elmhurst Street | Hayward, CA 94544 | (510) 670-5785 | [email protected]
Arroyo & Meekland: Steven Hunte | Alameda County Public Works Agency | 399 Elmhurst Street, Hayward, CA 94544 | (510) 670-5257 | [email protected]
Project Team:

Brian Krcelic (Contract/Project Manager) | Chris Hodge (Bridge Project Manager) | Matt Salveson (QA/QC) | Dean Zurcher (Roadway Engineering) | Stacey Randall (Structural Engineering) | Ryan Sexton & Jesus Dorado-Ureno (Surveying) | John Nicolaus (Landscape) | David J. Powers & Assoc. (Environmental)
Design Cost: Various (see below) Construction Cost: Various (see below) Wood Rodgers was one of three firms selected for an on-call contract with Alameda County Public Works Agency to provide various engineering and related services for federally funded projects. These cover a wide range of various services including roadway improvement and bridge replacement projects. The team includes multiple DBE certified subconsultant firms to meet DBE participation requirements. We have completed or are currently working on the following projects under this contract:
• Palomares Road & Redwood Road Law Enforcement Pull-Out Areas (Budget $134,500) | Provided the design and construction of asphalt concrete areas adjacent to the existing roadway to allow law enforcement vehicles to safely park and observe traffic and provide areas for law enforcement to pull over and cite vehicles. This project also contained storm drain and grading design elements.
• Arroyo Road Bridge over Dry Creek (Budget $255,000) | Providing PA&ED and PS&E to replace the existing bridge using primarily HBP (federal aid) funded. In addition, the City of Livermore and LARPD have requested to upgrade the bridge to provide a Class 1 bicycle trail. Turn-key project delivery services. Coordination with Caltrans District 4 Local Assistance.
• Fairmont Median Improvement Project (Budget $6,500) | Provided engineering and construction support for landscape tree plantings in the medians. Improvement plans were reviewed to ascertain new tree locations as well as reviewing Caltrans installation and maintenance specifications.
• Meekland Ave Bridge & Roadway Improvement (Budget $1,667,052) | Providing PA&ED and PS&E for replacement of existing bridge and provide multimodal improvements to 3,700 feet of the roadway corridor which includes pavement rehabilitation, sidewalks, Class II bike facilities, utility relocations, landscaping, ADA curb returns and street lighting.

City of Oakland On-Call Contracts (Transportation, Hydrology + Stormwater, & Surveying) | Oakland | CA Project Reference:

Transportation: Ade Oluwasogo | City of Oakland | 250 Frank Ogawa Plaza, Suite 4344 | Oakland, CA 94612 | (510) 238-6103 | [email protected]
Hydrology + Stormwater: Jeff Roubos | City of Oakland | 250 Frank Ogawa Plaza, Suite 4344 | Oakland, CA 94612 | (510) 238-2193 | [email protected] Project Team:

Dan Matthies (Principal-in-Charge) | Brian Krcelic, Matt Salveson (Transportation Project Managers) | Cheng Soo (Hydrology + Stormwater Project Manager) | Anthony Johnson (Hydraulic Structures) | | Dean Zurcher (Roadway Engineering) | Satish Kumar & Jeremiah McMahon (Project Engineers) | (Ryan Sexton & Jesus Dorado-Ureno (Surveying) | Chris Hodge (Structures) Design Cost: Various (see below) Construction Cost: Various (see below) Wood Rodgers has enjoyed a long working relationship with the City of Oakland providing a wide-range of engineering and surveying services. Currently Wood Rodgers has on-going on-call contract for Transportation/Traffic Engineering; Hydrology and Stormwater Engineering; and Surveying and Mapping services. Transportation projects have included roadway safety, access, intersection, and signal improvements; as well as multi-modal trail and streetscape improvements. Hydrology and Stormwater projects have included hydraulic analysis and modeling; drainage infrastructure inspections, assessments, and design; and stormwater facilities design and operations manuals just to name a few. Several relevant projects include:
• 42nd Avenue & High Street Access Improvements (Design Cost: $415,500; Construction Cost: $6.5 million) | Preparation of the final construction drawings for mobility improvements at the I-880 and High Street Interchange including modifications to 5 signalized intersections, retaining walls, landscaping, staged construction/traffic handling plans, right of way acquisition coordination, and several utility relocations. 








 




C.4.e
Packet Pg. 155 Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Statement of Qualifications for
Civil-Structural Design Services for Infrastructure Projects Wood Rodgers, Inc. – 22-0040 SUBMITTAL APPROACH | Project Experience – Page 2 of 3 • Oakland 19th Street BART to Lake Merritt Urban Greenway (Design Cost: $151,106; Construction Cost: $5.6 million) | Major streetscape project which included raised and parking protected bike lanes, sidewalk widening, pedestrian refuges, ADA curb ramps, street lights, signal modifications, utility relocations and pavement rehabilitation. • Oakland Trash Capture Analysis + Design (Analysis + Design Cost: $190,615; Construction Cost: $1 million) | Analyzed five trash capture facilities for constructability, constraints and optimal performance based on site inspections, utility research, hydraulic analysis, conceptual design and engineering cost estimates. • Richmond Boulevard Culvert Inspection & Condition Assessment (Contract Cost: $10,290; Construction Cost: N/A) | Performed condition assessment of concrete box culverts under residential properties and a roadway. • Tide Gate Operations Manual for 7th St. Flood Control Station (Contract Cost: $28,740; Construction Cost: N/A) | Analyzed and documented control structure (gates and a pump station) for maintenance, and water quality.

Alameda County Flood Control & Water Conservation District On-Call Engineering Services | Alameda | CA Project Reference: Moses Tsang | Alameda County Flood Control & Water Conservation District | 399 Elmhurst Street | Hayward | CA 94544 | (510) 670-6549 | [email protected] Project Team: Dan Matthies (Principal-in-Charge) | Cheng Soo (Project Manager) | Satish Kumar (Project Engineer)
Design Cost: Various (see below) Construction Cost: Various (see below) Wood Rodgers was selected by the Alameda County Flood Control & Water Conservation District (District) for this on-call contract to provide engineering services for various flood control projects including review, modeling and civil engineering for storm drain improvements. Currently we have completed or are currently working on the following relevant task orders:
• Zone 2 Line A Levee Diversion Structure (Design Cost: $70,000; Construction Cost: N/A) | Performed hydraulic modeling, alternative analysis, design and engineering cost estimates for concrete diversion structure, levee grading, channel embankment riprap protection and tide gate structures. • Zone 6 King and Lyons Levee Certification (Design Cost: $20,000; Construction Cost: $1.5 million) | Performed freeboard analysis, embankment protection design, floodwall rehabilitation design, interior drainage analysis, geotechnical investigation, and documentation for FEMA certification. • Estudillo Canal Tide Gate Structure Rehabilitation Project (Design Cost: $36,000; Construction Cost: $7 million) | Provided hydraulic analysis, structural and civil design to rehabilitate a tide gage structure. The design included the new abutments, pile/caps, wall/gates, precast slabs, channel riprap protection and utility relocation. • Meekland and Coelho Trash Rack Improvements (Design Cost: $20,000; Construction Cost: $2.6 million) | Performed hydraulic modeling, alternative analysis, conceptual design for two District trash capture projects. The type of capture devices at both locations were selected based on hydraulic constraints identified in the hydrology/hydraulics model.

Emeryville Sewer and Storm Drain On-Call | Emeryville | CA Project Reference: Mohamed Alaoui | City of Emeryville | 1333 Park Avenue | Emeryville | CA 94608 | (510) 596-4330 | [email protected]
Project Team: Dan Matthies (Contract Manager) | Kevin Gustorf & Cheng Soo (Project Managers) Design Cost: $657,958 Construction Cost: Various (see below) Wood Rodgers is currently providing on-call services to the City of Emeryville for Sanitary Sewer and Storm Drain design, capacity analysis, regulatory compliance (including EBMUD Consent Decree regarding sewer maintenance and operation), sanitary sewer and storm drain master plan development/implementation, and plan review for sanitary sewer and storm drain impacts relating to private development. Coordination and support are also being provided for Federal/State/Local funding, Local Assistance Program Guidelines and policies, and regulatory and environmental permitting relating to public infrastructure improvements within the BCDC jurisdiction. Components and tasks associated with this contract include:
• System-wide Cleaning and CCTV Program (Construction Cost: TBD) | Overseeing the sewer system cleaning and CCTV activities to meet the Consent Decree compliance; provide data review and project recommendations; and implement repairs for the sewer hot spot locations.
• Powell Street Sewer Improvements (Construction Cost: TBD) | Providing engineering analysis and design for improvements of 7,000 LF of sewer pipeline along Powell Steet to the EBMUD North Interceptor. 








 




C.4.e
Packet Pg. 156 Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Statement of Qualifications for
Civil-Structural Design Services for Infrastructure Projects Wood Rodgers, Inc. – 22-0040 SUBMITTAL APPROACH | Project Experience – Page 3 of 3 • Storm Drainage Conditions Assessment (Construction Cost: TBD) | Inspection and survey for 35 manholes, junction boxes, transition structures, and storm drains.
• Sewer Hot Spot Repairs (Construction Cost: TBD) | Analysis of 27 sewer hot spot (defect) locations, determination of the preferred repair solution for each alternative, preparation of PS&E for all locations. • GIS Updates for Storm Drainage (Construction Cost: TBD) | GIS geodatabase update, condition assessment, trouble spot investigation and mitigation, storm drain master plan update and grant funding. • City of Powell and City of Vallejo Storm Drainage Trouble Spots (Construction Cost: TBD) | Conceptual analysis, design, and costs for improvements at existing storm drainage trouble spots identified by the City. The findings will be used to determine the necessity of a detailed analysis and to base the funding for improvements.

San Ramon On-Call Civil/Structural Engineering & Surveying Services | San Ramon | CA Project Reference: Theresa Peterson | City of San Ramon Public Works Department | 2401 Crow Canyon Road | San Ramon, CA 94583 | (925) 973-2685 | [email protected] Project Team: Brian Krcelic (Contract/Project Manager) | Design Cost: Various (see below) Construction Cost: Various (see below) On-call contract with the City of San Ramon to perform a wide variety of civil engineering, structural, and surveying services on short notice. Task orders ranged from structural condition evaluations to pavement rehabilitation. Projects included:
• San Ramon Olympic Pool Slide Stair (Design Cost: $4,740; Construction Cost: N/A) | Performed structural survey of the existing conditions and prepared a report summarizing the necessary repair details and maintenance recommendations. • Forest Home Farm Building Evaluation & ADA Path (Design Cost: $31,320; Construction Cost: N/A) | Prepared structural building conditions evaluation for this historic property which also included improving existing ADA path. • Mudds Building Assessment (Design Cost: $32,500; Construction Cost: N/A) | Prepared a building and site assessment of the existing building and site improvements and developed construction cost estimates to bring into compliance with current building and ADA codes and regulations.
• San Ramon Police Department Floor Repair (Design Cost: $7,720; Construction Cost: N/A) | Assessed facility to determine the extent of structural distress that revealed floor settlements throughout the building and prepared plans to remove and replace the affected area with a new five-inch-thick concrete slab-on-grade. • Albion Road Pavement Rehabilitation (Design Cost: $27,660; Construction Cost: $225,000) | Performed field survey to determine the extent and severity of the pavement distress and investigated rehabilitation options. Prepared plans to reconstruct pavement and overlays, and replace damaged curb, gutter, and ADA ramps. • Bollinger Canyon Road (Design Cost: $5,200; Construction Cost: N/A) | Conducted field survey to locate existing wood fence and brick columns and also located street monuments to plot the record boundary/right-of-way along the southwest line of Bollinger Canyon Road to repair approximately 1,600 linear feet of fence.

Happy Valley Road Embankment Repair | Contra Costa County | CA Project Reference: Xiuwei Tang | Contra Costa County | 255 Glacier Drive| Martinez, CA | 94553 | (925) 313-2105 | [email protected]
Project Team: Chris Hodge (Project Manager) | Stacey Randall (Lead Structures) | Evan Weston (Structures) Design Cost: $206,243 Construction Cost: $508,000
Under an on-call contract with Contra Costa County, Wood Rodgers was tasked to provide inspection and wall feasibility assessment memo under an expedited schedule for a segment of Happy Valley Road which heavy winter storm activity resulted in a portion of the roadway embankment failing. Services included notification, coordination, and mobilization for site review in less than 2 business day; engineering assessment conclusions were provided within 5 days; draft final feasibility memo was provided within 7 days; and final memo addressing all comments was provided within 3 weeks after inspection. An engineering evaluation was completed to validate the structural feasibility of a cantilever wall system and a tie-back wall system, to determine an effective cost per square foot price for each wall type, and to provide input on related downslope access and impacts for construction. PS&E was completed under contract amendment for the construction documents, while coordinating with a geotechnical engineer from a separate on-call contract and the County’s environmental department.









 




C.4.e
Packet Pg. 157 Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Statement of Qualifications for
Civil-Structural Design Services for Infrastructure Projects Wood Rodgers, Inc. – 22-0040 SUBMITTAL APPROACH | Project Approach – Page 1 of 3 Project Approach
Overall Project Approach
Our approach to completing task
assignments under our on call
contracts is to work as an
extension of City staff. What
does that mean? Our team will:
• Take Ownership of the
Project
• Keep the County PM up do date
on our progress
• Identify Issues, Analyze Options, Recommend Solutions Having successfully managed public agency on-call contracts for 25 years, we understand the key issues:

Responding in a Timely Matter
The ability to provide services in a timely manner is dependent on carefully selecting the right team for each Task Order.

Staffing for specific projects will be determined on a Task Order by Task Order basis. Upon receiving a project specific RFP or task order assignment, our Project Manager, Brian Krcelic, PE, will review the project scope of work and required deliverables, and then assign the appropriate select staff member with the necessary relevant background, experience, and availability to serve as the project’s Task Order Manager.

On-Call Project Management Approach
Wood Rodger’s Project Manager, Brian Krcelic, PE, specializes in providing services for on-call contracts. Brian has managed on-call contracts for a variety of public agencies including Alameda County Department of Public Works, and the Cities of Oakland, San Ramon, and Sunnyvale. Some of these contracts have been federally funded and are subject to mandatory DBE goals and require Caltrans oversight under the Local Assistance Procedures Manual.

Wood Rodgers project manager’s approach to successful project and task management is by identifying client’s needs, establishing project/ task goals, setting expectations and defining risk at the beginning of a project/task. Our project manager has access to in-house resources in civil, transportation, traffic, structural, mechanical, and geotechnical; licensed hydrogeologists; professional land surveyors; and certified floodplain managers whose experience and knowledge can be leveraged for this on-call contract. Our project management activities include:









 




C.4.e
Packet Pg. 158 Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Statement of Qualifications for
Civil-Structural Design Services for Infrastructure Projects Wood Rodgers, Inc. – 22-0040 SUBMITTAL APPROACH | Project Approach – Page 2 of 3 Scope — Wood Rodgers’ project manager will direct and monitor all tasks in the Scope of Work that will be attached to the Agreement for Professional Services—making sure that the project team members assigned to the tasks provide quality deliverables, keep within budget, and stay on schedule. Out-of-scope work identified during the course of the project will be brought to the attention of the City so that they can be discussed and agreed upon before the work is performed.

Schedule — Wood Rodgers’ project manager will prepare and maintain a critical path method (CPM) schedule, presented in a Gantt chart format, using Microsoft Project software. Each task and project milestone in the Scope of Work will be included in the schedule, so that the progress of each task milestone can be monitored.

Budget — All efforts to the project will be
monitored and controlled to assure that
costs are kept within budget limitations.

Wood Rodgers’ BST10 enterprise
accounting system will be utilized to
monitor and control budgets on a task-bytask basis. Monthly invoices and progress reports will be prepared and submitted to
the City. Progress reports will cover work
and tasks performed during the pay
period, work forecast for the pay period to come, overall project progress, and identification of issues needing resolution.

Quality — Wood Rodgers will perform Quality Assurance/Quality Control (QA/QC) on every project. A Wood Rodgers senior-level experienced engineer will review and approve all deliverables before they are submitted to the City. Wood Rodgers takes great pride in knowing that our reports and studies are of the highest quality, and our plans are biddable, buildable, and administrable. Quality products reduce the time it takes for approving agencies to conduct required reviews and decreases costly changes order during construction.

Scope of Work
As this contract covers a wide-range of services and possible project types, each specific project assignment or task order will have it’s own custom tailored scope of work developed. However generally most typical projects will include the following tasks:

Initial Investigations
Our initial project activities include:
• Contact the utility owners with facilities within the project limits to obtain information on their existing facilities and determine if they have any repairs or upgrades planned in the near future. • Perform a visual field review to document the existing condition. • Prepare topographic mapping and field surveys, and prepare a Geotechnical Design Report, Foundation Report, and Pavement Analysis as needed.
• Obtain Record right of way maps to determine the city right-of-way and adjacent boundary lines.

Preliminary (35%) Design
Once the mapping is completed and the other project information has been gathered, we will begin preparation of preliminary plans for the project improvements. The preliminary plans for a roadway improvement project would include typical sections, signing and striping, signal improvement or modification plans, street light layouts, and storm drain, water, 








 




C.4.e
Packet Pg. 159 Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Statement of Qualifications for
Civil-Structural Design Services for Infrastructure Projects Wood Rodgers, Inc. – 22-0040 SUBMITTAL APPROACH | Project Approach – Page 3 of 3 and sewer line improvements. The preliminary plans would also indicate the location and approximate layout of potential green infrastructure features. Once the preliminary plans are complete a preliminary cost estimate will be prepared.

A Preliminary Design Workshop then be held with City staff to review the project alternatives and the preliminary construction cost estimates. The design team will address concerns or issues that City staff may have. Following the workshop, a Preliminary Design Report will be prepared documenting the work to date and the agreed upon scope of project improvements.

During the preliminary design phase, we will identify potential utility conflicts We would then begin potholing of existing water, gas, communication, and fiber optic lines as appropriate to determine their actual location and depth. Once the pothole information is obtained, we will review the data and prepare utility conflict maps for those underground utilities that need to be relocated and will work with the utility owners and City staff to coordinate these relocations.

Prepare 65% PS&E
Once the preliminary design phase is completed we will begin preparation of the 65% PS&E. A typical project could include the following plan sheets:

1. Title Sheet

2. Key Map

3. General and Construction
Notes

4. Typical Sections

5. Layout Plan and Profile

6. Storm Drain Plan and Profile

7. Sewer Line Plan and Profile

8. Water Line Plan and Profile

9. Construction Details

10. Structural Details

11. Green Infrastructure Details

12. Striping and Signing Plan

13. Signal Modification Plans

14. Traffic Control Plans

15. Staging Plans
We will prepare a Stormwater Control Plan that documents and confirms the sizing of any green infrastructure facilities that are incorporated into the design. The Contra Costa Clean Water Program’s IMP Sizing Calculator will be utilized to assist with preparing calculations for the Stormwater Control Plan
We will prepare technical specifications and update the construction cost estimate as part of the 65% submittal.

Prepare Final PS&E
We will meet with the City to review the 65% PS&E submittal and answer staff questions. Once the City has completed their review we will respond to the comments and proceed with the 90%, and Final PS&E preparation.

Bidding and Construction Support
The Wood Rodgers team will be available to assist the City during the Bidding and Construction Phase of the project. We anticipate that these services would include attendance at the prebid and preconstruction meetings, responding to RFI’s, reviewing contractor submittals, and preparing record drawings.

Environmental and Permitting
Wood Rodgers anticipates that most projects would likely qualify for a CEQA Categorical Exemption under 15301 Existing Facilities, as described in the CEQA guidelines. The exemption is for projects involving repair, maintenance, or minor alteration of existing public facilities involving negligible expansion of the existing use. The Categorical Exemption process is straightforward and can be completed in just a few days. Wood Rodgers’ in-house environmental team is available to assist the City in preparation and filing of the Notice of Exemption. Wood Rodgers can also provide additional environmental asneeded services including preparation of higher level CEQA documents, environmental studies, and environmental permit applications. In order to streamline the environmental review and approval process Wood Rodgers will work with the City to avoid environmental impacts that would preclude use of a Categorical Exemption. Our team will also prepare technical memorandums documenting the CEQA and C.3 Permit exemptions and the Storm Water Project Risk Level for City records.

QUALITY OF WORK
The following pages contain three examples of work products performed by the Wood Rodgers team which includes an 11x17 drawing of a street improvement plan sheet for the City of West Sacramento, and both a layout sheet and ADA ramp detail for a pavement rehabilitation project for the City of Sunnyvale. Complete sample plan sets or technical specification packages can provided upon request.









 




C.4.e
Packet Pg. 160 Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) &6W%OGJ% 7HO

)D[
 6DFUDPHQWR&$










 




C.4.e
Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) 








 




C
Packet Pg









 




C
Packet Pg
Statement of Qualifications for
Civil-Structural Design Services for Infrastructure Projects Wood Rodgers, Inc. – 22-0040 AGREEMENT PROVISIONS, CONFLICTS, & LITIGATION – Page 0.5 of 0.5

AGREEMENT PROVISIONS
Wood Rodgers’ Risk Management Group has reviewed the City’s Sample Professional Services Agreement and have no exceptions to the form of the agreement. We are confident if selected, we can quickly execute and negotiate a contract with the City to begin working on the project upon official notice-to-proceed.

CONFLICT OF INTEREST
Wood Rodgers has determined that no actual, apparent, or potential conflicts of interests exist with this project. In addition, Wood Rodgers has an adopted written conflict of interest policy to which all employees must adhere. This policy is more restrictive and comprehensive than is stated above. Copies of our complete conflict of interest policy are available upon request.
3-YEAR LITIGATION HISTORY
Description Insurer Claim # Case Name Results
COWEN V. LENNAR RENO-CASA BELLA
Notice 12/22/2016
Insured received notice regarding Constructional Defects to the Casa Bella Community, Reno, Nv. This is a project that the insured is still working on at this time. The claim is that the adverse soil conditions at this location are inadequately installed and/or designed slab foundation is resulting in cracking and splitting of walls and foundation. 3/29/20 Matter resolved without contribution from
insured
1/28/21 File re opened as an additional
Homeowner is now making a claim. no reserves set and
no payments issued.

XLDP
Insurance #3819703
Cowen V. Lennar Reno-Casa Bella
Matter was settled within the insured
deductible until additional claim presented a
new claim 11/20, file reopened









 




C.4.e
Packet Pg. 164 Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Appendix - Resumes









 




C.4.e
Packet Pg. 165 Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) www. woodrodgers .com
ROLE
Principal-in-Charge
TITLE
Principal Engineer II

EDUCATION
Ph.D. Civil Engineering,
University of California,
Davis, 2007
MS Civil Engineering,
University of California,
Davis, 1992
BS Civil Engineering
(Highest Honors),
University of California,
Davis, 1991

REGISTRATIONS/

CERTIFICATIONS
Registered Professional
Engineer, California No.
56351

WOOD RODGERS,
INC. START DATE
April 22, 2019

MATTHEW SALVESON, PHD, PE
Dr. Salveson has over 30 years of experience. He has delivered hundreds road, bridge, interchange, and freeway projects in California as project engineer, project manager, or resident engineer. He currently serves as a Principal Engineer where he is responsible for the delivery of transportation projects. Dr. Salveson is an active member of the American Public Works Association (APWA).

EXPERIENCE
19th Street BART to Lake Merritt Urban Greenway Project – Oakland, California. Project manager for a major streetscape / greenway project in downtown Oakland. The project will receive complete street improvements including raised and parking protected bike lanes, sidewalk widening, pedestrian refuges, ADA curb ramps, street lights, signal modifications, utility relocations, and pavement rehabilitations. The project includes coordination with BART to incorporate the design of foundations for improvements adjacent to and over buried BART facilities.

Caltrans District 1, 5th Street Safety Improvements – Eureka, California. Project manager for design services for this safety project. This safety improvement project is located within the city of Eureka on Highway 101. The facility is a two-way, four-lane highway referred to as Broadway Street between the Eureka city limits and the beginning of the NB) / SB couplet. After the split, the NB section of US 101 becomes a three lane, one-way facility and is locally known as 5th Street. This section of NB US 101 also serves as a main street for the City of Eureka and lies within the “Downtown Eureka” area.

Bodega Avenue Corridor Reconstruction – Sebastopol, CA. Project manager for this reconstruction project. Bodega Avenue is a major east-west route that services much regional traffic in addition to local city vehicles. The project includes infrastructure improvements along Bodega Avenue including roadway stabilization, repaving, adding sidewalks to eliminate gaps, and bicycle lane striping. Wood Rodgers provided environmental planning, preliminary engineering, utility and ROW coordination, and final PS&E.

Paradise FHWA “On System” Road Rehabilitation Project – Paradise, California. Contract manager for the road and pavement rehabilitation of the approximately 1/3 of the major Town roads. Work includes: Extensive pavement investigations, right of way and utility coordination, public outreach, signal improvements, and ADA ramp improvements. The work is being performed under challenging schedule constraints and is coordinated with four other consultant teams. The total project cost is approximately $20M.

Paradise Highway Safety Improvement Project (HSIP) – Paradise, California. Contract manager for safety improvements at 6 intersections in Paradise.

Paradise Storm Drain Master Plan – Paradise California. Contract manager for the development of a comprehensive storm drain master plan. The plan will update an outdated master plan and will provide direction for the reconstruction of the storm drain infrastructure after the camp fire.

Alameda Street Underpass Replacement – Los Angeles County, California. Design Engineer responsible for the design of a permanent soldier pile tieback retaining wall. Coordinated approval between client, City of Los Angeles, Caltrans and Railroad. Work was ValueEngineering redesign for prime contractor.

Caltrans District 3 TO 2, SR 51 Capital City Freeway Improvements – Sacramento, California.

Project Manager for this Caltrans District 3 task order to provide PA&ED services for this project along State Route 51 in Sacramento County from J Street to Arden Way. Improvements include roadway widening/rehabilitation, bus/carpool lanes, auxiliary lanes, Intelligent Transportation System (ITS) elements, bridge widening, replacing three railroad underpass structures, and upgrading an existing flood gate. Agency coordination includes UPRR, Caltrans and the Capital Corridor Joint Powers Authority (CCJPA) for the railroad portion of the project.

Caltrans District 3 TO 6, State Route 84 – Yolo County, California. Dr. Salveson served as the 








 




C.4.e
Packet Pg. 166 Attachment: Wood Rodgers, Inc. Civil-Structural Agreement (2677 : Approval of On-Call Civil/Structural, Geotechnical & Survey Agreements) Salveson, Matt