Agenda packet — Rancho Cordova City Council, June 15, 2026 (part 5 of 6)

CONTRACT NO.: 2026-95

Professional Services Agreement between June 15, 2026
City of Rancho Cordova and Dewberry Engineers Inc.--Exhibit A

Page 10 of 11 ends

2. All records, maps, and plans maintained by the Consultant during construction.

3. All approved shop drawings, submittals and manufacturers' literature maintained by the Consultant during the construction project.

4. One complete set of annotated project progress photographs bound chronologically and video recordings taken before and during construction.

5. One set of record drawings of as-built changes in neat red pencil.

6. Project Closeout file from Consultant Software.

1.16. WARRANTY INSPECTION
The Consultant shall provide a warranty inspection prior to the warranty expiration date. The Consultant will submit a copy of the warranty report to the City.

1.17. LOCAL AGENCY OBLIGATIONS
All plans, specifications and data applicable to the projects and in possession of the City of Rancho Cordova are to be made available to the Consultant. The City will assign a City Project Manager for all projects associated with this RFQ to assist/direct the Consultant.

1.18. PROJECT RECORD KEEPING - ELECTRONIC PROJECT/CONSTRUCTION MANAGEMENT

SOFTWARE
Consultant shall provide a software program for electronic project record keeping. The program shall be able to record daily progress, problems, transmittals, submittals, requests for information, project documents, inspection logs, change orders and all general correspondences. The program shall be accessed in the field through a computer, cell phone and tablets and the inspector shall have cell or internet coverage at the project site. The Consultant shall provide information on the proposed software program as part of the RFQ response.

1.19. DEPARTMENT OF INDUSTRIAL RELATIONS – SB 854 COMPLIANCE Consultant shall comply with the Public Works Contractor Registration Law – SB 854 as required by the Department of Industrial Relations.

1.20. FINAL COMPLETION & ACCEPTANCE
After the project is substantially complete, the Consultant shall schedule a walk through with the City, request input from all other City Departments needed to prepare a "punch list" of incomplete or unsatisfactory items and submit the list to the Contractor. Once all work is satisfactorily complete, the Consultant shall deliver a statement to the City indicating that to the best of the Consultant’s knowledge ITEM 9.12.

ATTACHMENT 2

Page 480 of 654 ends

CONTRACT NO.: 2026-95

Professional Services Agreement between June 15, 2026
City of Rancho Cordova and Dewberry Engineers Inc.--Exhibit A

Page 11 of 11 ends

and belief, after diligent investigation including satisfaction of its other obligations under the agreement, the project has been completed in accordance with the Project Plans and Specifications and the Consultant recommends acceptance of the project by the City. The Consultant shall submit the Final Progress Pay Estimate signed by the Contractor.

Deliverables:
• Copies of the Project punchlist
• Copies of the Final Progress Pay Estimate

ITEM 9.12.

ATTACHMENT 2

Page 481 of 654 ends

CONTRACT NO.: 2026-95

Professional Services Agreement between June 15, 2026
City of Rancho Cordova and Dewberry Engineers Inc.--Exhibit B

Page 1 of 1 ends

EXHIBIT B

COMPENSATION SCHEDULE

[See attached Consultant Compensation Schedule]

ITEM 9.12.

ATTACHMENT 2

Page 482 of 654 ends

Local Assistance Procedures Manual
Note: Mark-ups are Not Allowed
Consultant Prime Consultant Subconsultant 2nd Tier Subconsultant Project No. Contract No. Participation Amount $ Date 4/17/2026 =
=
= 162.73%
= 139.26%
FEE % = 12%
Straight OT(1.5x) OT(2x) From To $361.76 $361.76 $361.76 7/1/2025 6/30/2026 $135.00 0.00% NA NA NA NA $379.85 $379.85 $379.85 7/1/2026 6/30/2027 $141.75 5.00% NA NA NA NA $398.84 $398.84 $398.84 7/1/2027 6/30/2028 $148.84 5.00% NA NA NA NA $418.78 $418.78 $418.78 7/1/2028 6/30/2029 $156.28 5.00% NA NA NA NA $439.72 $439.72 $439.72 7/2/2029 6/30/2030 $164.09 5.00% NA NA NA NA $257.33 $257.33 $257.33 7/1/2025 6/30/2026 $96.03 0.00% NA NA NA NA $270.20 $270.20 $270.20 7/1/2026 6/30/2027 $100.83 5.00% NA NA NA NA $283.71 $283.71 $283.71 7/1/2027 6/30/2028 $105.87 5.00% NA NA NA NA $297.89 $297.89 $297.89 7/1/2028 6/30/2029 $111.17 5.00% NA NA NA NA $312.79 $312.79 $312.79 7/2/2029 6/30/2030 $116.73 5.00% NA NA NA NA $250.53 7/1/2025 6/30/2026 $93.49 0.00% NA NA NA NA
$263.05 7/1/2026 6/30/2027 $98.16 5.00% NA NA NA NA
$276.20 7/1/2027 6/30/2028 $103.07 5.00% NA NA NA NA
$290.01 7/1/2028 6/30/2029 $108.23 5.00% NA NA NA NA
$304.52 7/2/2029 6/30/2030 $113.64 5.00% NA NA NA NA
$297.27 $297.27 $297.27 7/1/2025 6/30/2026 $110.93 0.00% NA NA NA NA $312.13 $312.13 $312.13 7/1/2026 6/30/2027 $116.48 5.00% NA NA NA NA $327.74 $327.74 $327.74 7/1/2027 6/30/2028 $122.30 5.00% NA NA NA NA $344.13 $344.13 $344.13 7/1/2028 6/30/2029 $128.42 5.00% NA NA NA NA $361.33 $361.33 $361.33 7/2/2029 6/30/2030 $134.84 5.00% NA NA NA NA Cost Proposal 2
COST PROPOSAL 2 Form 1 of 3

SPECIFIC RATE OF COMPENSATION (USE FOR ON-CALL OR AS-NEEDED CONTRACTS) For Combined Rate
Fringe Benefit % + General & Administrative% + Overhead Combined ICR % OR
For Home Office
Fringe Benefit % + General & Administrative% + Overhead Home Office ICR % (CONSTRUCTION ENGINEERING AND INSPECTION CONTRACTS)
Dewberry Engineers Inc.

Pre-Qualified List of
ConsultantsFederal Construction Management Services
Facilites Capital Cost of Money Combined ICR %
Howard Zabell*

PRINCIPAL
For Field Office
Fringe Benefit % + General & Administrative% + Overhead Field Office ICR %

BILLING INFORMATION CALCULATION INFORMATION
Name/Job Title/Classification1 Hourly Billing Rates2 Effective date of hourly rate % or $ increase
Actual or Avg.

Hourly Rate 4
Hourly Range- for
Classification Only
Billing Rate Range for
Classification Only
Resident Engineer/Structures Rep
Said Najafi (Straight)***
INSPECTOR VI **
Project Manager
Kyle Cameron*

CONSTRUCTION PROFESSIONAL V
Construction Inspector
***Rates to be charged in accordance with
Prevailing Wage Rates at time of work***
Construction Inspector
***Rates to be charged in accordance with
Prevailing Wage Rates at time of work***
Said Najafi (1.5 OT)***
INSPECTOR VI **
Xx
January 2020

Page 1 of 12 ends

ITEM 9.12.

ATTACHMENT 2

Page 483 of 654 ends

SPECIFIC RATE OF COMPENSATION (USE FOR ON-CALL OR AS-NEEDED CONTRACTS) (CONSTRUCTION ENGINEERING AND INSPECTION CONTRACTS)
Dewberry Engineers Inc.

Pre-Qualified List of
ConsultantsFederal Construction Management Services
Xx
$344.02 $344.02 $344.02 7/1/2025 6/30/2026 $128.38 0.00% NA NA NA NA $361.22 $361.22 $361.22 7/1/2026 6/30/2027 $134.80 5.00% NA NA NA NA $379.28 $379.28 $379.28 7/1/2027 6/30/2028 $141.54 5.00% NA NA NA NA $398.24 $398.24 $398.24 7/1/2028 6/30/2029 $148.61 5.00% NA NA NA NA $418.15 $418.15 $418.15 7/2/2029 6/30/2030 $156.04 5.00% NA NA NA NA $254.22 $254.22 $254.22 7/1/2025 6/30/2026 $94.87 0.00% NA NA NA NA $266.93 $266.93 $266.93 7/1/2026 6/30/2027 $99.61 5.00% NA NA NA NA $280.28 $280.28 $280.28 7/1/2027 6/30/2028 $104.59 5.00% NA NA NA NA $294.30 $294.30 $294.30 7/1/2028 6/30/2029 $109.82 5.00% NA NA NA NA $309.01 $309.01 $309.01 7/2/2029 6/30/2030 $115.32 5.00% NA NA NA NA $301.66 $301.66 $301.66 7/1/2025 6/30/2026 $112.57 0.00% NA NA NA NA $316.74 $316.74 $316.74 7/1/2026 6/30/2027 $118.20 5.00% NA NA NA NA $332.58 $332.58 $332.58 7/1/2027 6/30/2028 $124.11 5.00% NA NA NA NA $349.21 $349.21 $349.21 7/1/2028 6/30/2029 $130.32 5.00% NA NA NA NA $366.67 $366.67 $366.67 7/2/2029 6/30/2030 $136.83 5.00% NA NA NA NA $349.09 $349.09 $349.09 7/1/2025 6/30/2026 $130.27 0.00% NA NA NA NA $366.55 $366.55 $366.55 7/1/2026 6/30/2027 $136.79 5.00% NA NA NA NA $384.88 $384.88 $384.88 7/1/2027 6/30/2028 $143.63 5.00% NA NA NA NA $404.12 $404.12 $404.12 7/1/2028 6/30/2029 $150.81 5.00% NA NA NA NA $424.33 $424.33 $424.33 7/2/2029 6/30/2030 $158.35 5.00% NA NA NA NA $397.24 $397.24 $397.24 7/1/2025 6/30/2026 $135.00 0.00% $135.00 $135.00 $397.24 $397.24 $417.11 $417.11 $417.11 7/1/2026 6/30/2027 $141.75 5.00% $141.75 $141.75 $417.11 $417.11 $437.96 $437.96 $437.96 7/1/2027 6/30/2028 $148.84 5.00% $148.84 $148.84 $437.96 $437.96 $459.86 $459.86 $459.86 7/1/2028 6/30/2029 $156.28 5.00% $156.28 $156.28 $459.86 $459.86 $482.85 $482.85 $482.85 7/2/2029 6/30/2030 $164.09 5.00% $164.09 $164.09 $482.85 $482.85 $366.81 $366.81 $366.81 7/1/2025 6/30/2026 $124.66 0.00% $115.56 $133.75 $340.04 $393.58 $385.15 $385.15 $385.15 7/1/2026 6/30/2027 $130.89 5.00% $121.34 $140.44 $357.04 $413.26 $404.40 $404.40 $404.40 7/1/2027 6/30/2028 $137.43 5.00% $127.40 $147.46 $374.89 $433.92 $424.62 $424.62 $424.62 7/1/2028 6/30/2029 $144.30 5.00% $133.77 $154.84 $393.63 $455.61 $445.86 $445.86 $445.86 7/2/2029 6/30/2030 $151.52 5.00% $140.46 $162.58 $413.32 $478.39 $316.59 $316.59 $316.59 7/1/2025 6/30/2026 $107.59 0.00% $100.69 $114.49 $296.29 $336.89 $332.42 $332.42 $332.42 7/1/2026 6/30/2027 $112.97 5.00% $105.73 $120.21 $311.10 $353.73 $349.04 $349.04 $349.04 7/1/2027 6/30/2028 $118.62 5.00% $111.01 $126.22 $326.66 $371.42 $366.49 $366.49 $366.49 7/1/2028 6/30/2029 $124.55 5.00% $116.56 $132.53 $342.99 $389.99 $384.81 $384.81 $384.81 7/2/2029 6/30/2030 $130.78 5.00% $122.39 $139.16 $360.14 $409.49 Said Najafi (2.0 OT)***
INSPECTOR VI **
Construction Inspector
***Rates to be charged in accordance with
Prevailing Wage Rates at time of work***
Raymond Tunkel (1.5 OT)***
INSPECTOR VI **
Construction Inspector
***Rates to be charged in accordance with
Prevailing Wage Rates at time of work***
Raymond Tunkel (Straight)***
INSPECTOR VI **
Construction Inspector
***Rates to be charged in accordance with
Prevailing Wage Rates at time of work***
Construction Inspector
***Rates to be charged in accordance with
Prevailing Wage Rates at time of work***
Raymond Tunkel (2.0 OT)***
INSPECTOR VI **
To Be Determined

PRINCIPAL
Exempt/Hourly
To Be Determined

ENGINEER VIII
Exempt/Hourly
To Be Determined

ENGINEER IX
Exempt/Hourly
January 2020

Page 2 of 12 ends

ITEM 9.12.

ATTACHMENT 2

Page 484 of 654 ends

SPECIFIC RATE OF COMPENSATION (USE FOR ON-CALL OR AS-NEEDED CONTRACTS) (CONSTRUCTION ENGINEERING AND INSPECTION CONTRACTS)
Dewberry Engineers Inc.

Pre-Qualified List of
ConsultantsFederal Construction Management Services
Xx
$282.93 $282.93 $282.93 7/1/2025 6/30/2026 $96.15 0.00% $87.06 $105.24 $256.17 $309.68 $297.07 $297.07 $297.07 7/1/2026 6/30/2027 $100.96 5.00% $91.41 $110.51 $268.98 $325.17 $311.93 $311.93 $311.93 7/1/2027 6/30/2028 $106.01 5.00% $95.98 $116.03 $282.43 $341.43 $327.53 $327.53 $327.53 7/1/2028 6/30/2029 $111.31 5.00% $100.78 $121.83 $296.55 $358.50 $343.90 $343.90 $343.90 7/2/2029 6/30/2030 $116.87 5.00% $105.82 $127.92 $311.38 $376.42 $246.22 $246.22 $246.22 7/1/2025 6/30/2026 $83.67 0.00% $77.29 $90.06 $227.44 $265.00 $258.53 $258.53 $258.53 7/1/2026 6/30/2027 $87.86 5.00% $81.16 $94.56 $238.81 $278.25 $271.45 $271.45 $271.45 7/1/2027 6/30/2028 $92.25 5.00% $85.21 $99.29 $250.75 $292.16 $285.03 $285.03 $285.03 7/1/2028 6/30/2029 $96.86 5.00% $89.48 $104.25 $263.29 $306.77 $299.28 $299.28 $299.28 7/2/2029 6/30/2030 $101.71 5.00% $93.95 $109.46 $276.45 $322.10 $208.98 $208.98 $208.98 7/1/2025 6/30/2026 $71.02 0.00% $64.22 $77.82 $188.97 $228.99 $219.43 $219.43 $219.43 7/1/2026 6/30/2027 $74.57 5.00% $67.43 $81.71 $198.42 $240.44 $230.40 $230.40 $230.40 7/1/2027 6/30/2028 $78.30 5.00% $70.80 $85.80 $208.34 $252.46 $241.92 $241.92 $241.92 7/1/2028 6/30/2029 $82.21 5.00% $74.34 $90.09 $218.76 $265.08 $254.02 $254.02 $254.02 7/2/2029 6/30/2030 $86.32 5.00% $78.06 $94.59 $229.70 $278.34 $196.12 $196.12 $196.12 7/1/2025 6/30/2026 $66.65 0.00% $61.39 $71.91 $180.64 $211.60 $205.92 $205.92 $205.92 7/1/2026 6/30/2027 $69.98 5.00% $64.46 $75.50 $189.67 $222.18 $216.22 $216.22 $216.22 7/1/2027 6/30/2028 $73.48 5.00% $67.68 $79.28 $199.16 $233.28 $227.03 $227.03 $227.03 7/1/2028 6/30/2029 $77.15 5.00% $71.07 $83.24 $209.11 $244.95 $238.38 $238.38 $238.38 7/2/2029 6/30/2030 $81.01 5.00% $74.62 $87.41 $219.57 $257.20 $158.50 $158.50 $158.50 7/1/2025 6/30/2026 $53.87 0.00% $47.71 $60.02 $140.39 $176.62 $166.43 $166.43 $166.43 7/1/2026 6/30/2027 $56.56 5.00% $50.09 $63.02 $147.41 $185.45 $174.75 $174.75 $174.75 7/1/2027 6/30/2028 $59.39 5.00% $52.60 $66.18 $154.78 $194.73 $183.49 $183.49 $183.49 7/1/2028 6/30/2029 $62.36 5.00% $55.23 $69.48 $162.51 $204.46 $192.66 $192.66 $192.66 7/2/2029 6/30/2030 $65.47 5.00% $57.99 $72.96 $170.64 $214.69 $138.55 $138.55 $138.55 7/1/2025 6/30/2026 $47.08 0.00% $41.61 $52.56 $122.44 $154.65 $145.47 $145.47 $145.47 7/1/2026 6/30/2027 $49.44 5.00% $43.69 $55.19 $128.56 $162.39 $152.75 $152.75 $152.75 7/1/2027 6/30/2028 $51.91 5.00% $45.88 $57.94 $134.99 $170.51 $160.39 $160.39 $160.39 7/1/2028 6/30/2029 $54.51 5.00% $48.17 $60.84 $141.74 $179.03 $168.40 $168.40 $168.40 7/2/2029 6/30/2030 $57.23 5.00% $50.58 $63.88 $148.83 $187.98 $122.39 $122.39 $122.39 7/1/2025 6/30/2026 $41.59 0.00% $36.01 $47.17 $105.97 $138.80 $128.51 $128.51 $128.51 7/1/2026 6/30/2027 $43.67 5.00% $37.82 $49.53 $111.27 $145.74 $134.93 $134.93 $134.93 7/1/2027 6/30/2028 $45.85 5.00% $39.71 $52.00 $116.84 $153.02 $141.68 $141.68 $141.68 7/1/2028 6/30/2029 $48.15 5.00% $41.69 $54.60 $122.68 $160.67 $148.76 $148.76 $148.76 7/2/2029 6/30/2030 $50.55 5.00% $43.78 $57.33 $128.81 $168.71 To Be Determined

ENGINEER VII
Exempt/Hourly
Exempt/Hourly
To Be Determined

ENGINEER I
Exempt/Hourly
To Be Determined

ENGINEER II
To Be Determined

ENGINEER VI
Exempt/Hourly

ENGINEER IV
Exempt/Hourly
To Be Determined

ENGINEER III
To Be Determined

ENGINEER V
Exempt/Hourly
To Be Determined
Exempt/Hourly
January 2020

Page 3 of 12 ends

ITEM 9.12.

ATTACHMENT 2

Page 485 of 654 ends

SPECIFIC RATE OF COMPENSATION (USE FOR ON-CALL OR AS-NEEDED CONTRACTS) (CONSTRUCTION ENGINEERING AND INSPECTION CONTRACTS)
Dewberry Engineers Inc.

Pre-Qualified List of
ConsultantsFederal Construction Management Services
Xx
$210.88 $210.88 $210.88 7/1/2025 6/30/2026 $71.66 0.00% $60.26 $83.07 $177.32 $244.44 $221.42 $221.42 $221.42 7/1/2026 6/30/2027 $75.25 5.00% $63.27 $87.22 $186.18 $256.66 $232.49 $232.49 $232.49 7/1/2027 6/30/2028 $79.01 5.00% $66.44 $91.58 $195.49 $269.49 $244.12 $244.12 $244.12 7/1/2028 6/30/2029 $82.96 5.00% $69.76 $96.16 $205.27 $282.97 $256.32 $256.32 $256.32 7/2/2029 6/30/2030 $87.11 5.00% $73.25 $100.97 $215.53 $297.12 $178.86 $178.86 $178.86 7/1/2025 6/30/2026 $60.78 0.00% $53.41 $68.16 $157.15 $200.56 $187.80 $187.80 $187.80 7/1/2026 6/30/2027 $63.82 5.00% $56.08 $71.57 $165.01 $210.59 $197.19 $197.19 $197.19 7/1/2027 6/30/2028 $67.01 5.00% $58.88 $75.15 $173.26 $221.12 $207.05 $207.05 $207.05 7/1/2028 6/30/2029 $70.36 5.00% $61.82 $78.90 $181.92 $232.18 $217.40 $217.40 $217.40 7/2/2029 6/30/2030 $73.88 5.00% $64.92 $82.85 $191.02 $243.79 $162.85 $162.85 $162.85 7/1/2025 6/30/2026 $55.34 0.00% $49.98 $60.71 $147.07 $178.63 $170.99 $170.99 $170.99 7/1/2026 6/30/2027 $58.11 5.00% $52.48 $63.74 $154.42 $187.56 $179.54 $179.54 $179.54 7/1/2027 6/30/2028 $61.01 5.00% $55.10 $66.93 $162.14 $196.94 $188.52 $188.52 $188.52 7/1/2028 6/30/2029 $64.07 5.00% $57.86 $70.27 $170.25 $206.78 $197.94 $197.94 $197.94 7/2/2029 6/30/2030 $67.27 5.00% $60.75 $73.79 $178.76 $217.12 $152.79 $152.79 $152.79 7/1/2025 6/30/2026 $51.93 0.00% $44.21 $59.64 $130.09 $175.49 $160.43 $160.43 $160.43 7/1/2026 6/30/2027 $54.52 5.00% $46.42 $62.62 $136.60 $184.27 $168.45 $168.45 $168.45 7/1/2027 6/30/2028 $57.25 5.00% $48.74 $65.75 $143.43 $193.48 $176.88 $176.88 $176.88 7/1/2028 6/30/2029 $60.11 5.00% $51.18 $69.04 $150.60 $203.16 $185.72 $185.72 $185.72 7/2/2029 6/30/2030 $63.12 5.00% $53.74 $72.49 $158.13 $213.31 $121.45 $121.45 $121.45 7/1/2025 6/30/2026 $41.27 0.00% $33.56 $48.99 $98.74 $144.16 $127.52 $127.52 $127.52 7/1/2026 6/30/2027 $43.34 5.00% $35.23 $51.44 $103.68 $151.36 $133.90 $133.90 $133.90 7/1/2027 6/30/2028 $45.50 5.00% $37.00 $54.01 $108.86 $158.93 $140.59 $140.59 $140.59 7/1/2028 6/30/2029 $47.78 5.00% $38.85 $56.71 $114.31 $166.88 $147.62 $147.62 $147.62 7/2/2029 6/30/2030 $50.17 5.00% $40.79 $59.55 $120.02 $175.22 $64.95 $64.95 $64.95 7/1/2025 6/30/2026 $22.07 0.00% $18.05 $26.09 $53.11 $76.78 $68.19 $68.19 $68.19 7/1/2026 6/30/2027 $23.17 5.00% $18.95 $27.40 $55.77 $80.62 $71.60 $71.60 $71.60 7/1/2027 6/30/2028 $24.33 5.00% $19.90 $28.77 $58.56 $84.65 $75.18 $75.18 $75.18 7/1/2028 6/30/2029 $25.55 5.00% $20.90 $30.21 $61.49 $88.88 $78.94 $78.94 $78.94 7/2/2029 6/30/2030 $26.83 5.00% $21.94 $31.72 $64.56 $93.32 $339.13 $339.13 $339.13 7/1/2025 6/30/2026 $115.25 0.00% $86.73 $143.78 $255.20 $423.07 $356.09 $356.09 $356.09 7/1/2026 6/30/2027 $121.01 5.00% $91.06 $150.96 $267.96 $444.22 $373.89 $373.89 $373.89 7/1/2027 6/30/2028 $127.06 5.00% $95.62 $158.51 $281.35 $466.43 $392.59 $392.59 $392.59 7/1/2028 6/30/2029 $133.42 5.00% $100.40 $166.44 $295.42 $489.75 $412.22 $412.22 $412.22 7/2/2029 6/30/2030 $140.09 5.00% $105.42 $174.76 $310.19 $514.24 To Be Determined

TECHNICAL V
Exempt/Hourly
To Be Determined
To Be Determined

TECHNICAL VI
Exempt/Hourly
Exempt/Hourly
To Be Determined

TECHNICAL II

TECHNICAL IV
Non-Exempt/Hourly
To Be Determined

TECHNICAL III
Non-Exempt/Hourly
Non-Exempt/Hourly
To Be Determined

TECHNICAL I
To Be Determined

PROFESSIONAL IX
Exempt/Hourly
January 2020

Page 4 of 12 ends

ITEM 9.12.

ATTACHMENT 2

Page 486 of 654 ends

SPECIFIC RATE OF COMPENSATION (USE FOR ON-CALL OR AS-NEEDED CONTRACTS) (CONSTRUCTION ENGINEERING AND INSPECTION CONTRACTS)
Dewberry Engineers Inc.

Pre-Qualified List of
ConsultantsFederal Construction Management Services
Xx
$299.46 $299.46 $299.46 7/1/2025 6/30/2026 $101.77 0.00% $91.71 $111.83 $269.87 $329.05 $314.43 $314.43 $314.43 7/1/2026 6/30/2027 $106.86 5.00% $96.30 $117.42 $283.36 $345.50 $330.16 $330.16 $330.16 7/1/2027 6/30/2028 $112.20 5.00% $101.11 $123.29 $297.53 $362.78 $346.66 $346.66 $346.66 7/1/2028 6/30/2029 $117.81 5.00% $106.17 $129.45 $312.41 $380.92 $364.00 $364.00 $364.00 7/2/2029 6/30/2030 $123.70 5.00% $111.48 $135.92 $328.03 $399.96 $254.44 $254.44 $254.44 7/1/2025 6/30/2026 $86.47 0.00% $80.64 $92.30 $237.28 $271.61 $267.16 $267.16 $267.16 7/1/2026 6/30/2027 $90.79 5.00% $84.67 $96.92 $249.14 $285.19 $280.52 $280.52 $280.52 7/1/2027 6/30/2028 $95.33 5.00% $88.90 $101.76 $261.60 $299.45 $294.55 $294.55 $294.55 7/1/2028 6/30/2029 $100.10 5.00% $93.35 $106.85 $274.68 $314.42 $309.28 $309.28 $309.28 7/2/2029 6/30/2030 $105.10 5.00% $98.01 $112.20 $288.41 $330.14 $242.05 $242.05 $242.05 7/1/2025 6/30/2026 $82.26 0.00% $71.86 $92.66 $211.46 $272.64 $254.16 $254.16 $254.16 7/1/2026 6/30/2027 $86.37 5.00% $75.46 $97.29 $222.04 $286.27 $266.86 $266.86 $266.86 7/1/2027 6/30/2028 $90.69 5.00% $79.23 $102.15 $233.14 $300.59 $280.21 $280.21 $280.21 7/1/2028 6/30/2029 $95.23 5.00% $83.19 $107.26 $244.80 $315.62 $294.22 $294.22 $294.22 7/2/2029 6/30/2030 $99.99 5.00% $87.35 $112.62 $257.04 $331.40 $220.93 $220.93 $220.93 7/1/2025 6/30/2026 $75.08 0.00% $66.03 $84.14 $194.29 $247.57 $231.98 $231.98 $231.98 7/1/2026 6/30/2027 $78.84 5.00% $69.33 $88.34 $204.01 $259.95 $243.58 $243.58 $243.58 7/1/2027 6/30/2028 $82.78 5.00% $72.80 $92.76 $214.21 $272.95 $255.76 $255.76 $255.76 7/1/2028 6/30/2029 $86.92 5.00% $76.44 $97.40 $224.92 $286.60 $268.54 $268.54 $268.54 7/2/2029 6/30/2030 $91.26 5.00% $80.26 $102.27 $236.16 $300.93 $180.83 $180.83 $180.83 7/1/2025 6/30/2026 $61.45 0.00% $55.02 $67.88 $161.91 $199.75 $189.87 $189.87 $189.87 7/1/2026 6/30/2027 $64.53 5.00% $57.78 $71.28 $170.01 $209.74 $199.37 $199.37 $199.37 7/1/2027 6/30/2028 $67.75 5.00% $60.66 $74.84 $178.51 $220.22 $209.33 $209.33 $209.33 7/1/2028 6/30/2029 $71.14 5.00% $63.70 $78.58 $187.43 $231.24 $219.80 $219.80 $219.80 7/2/2029 6/30/2030 $74.70 5.00% $66.88 $82.51 $196.80 $242.80 $160.05 $160.05 $160.05 7/1/2025 6/30/2026 $54.39 0.00% $47.50 $61.28 $139.77 $180.32 $168.05 $168.05 $168.05 7/1/2026 6/30/2027 $57.11 5.00% $49.88 $64.34 $146.76 $189.34 $176.45 $176.45 $176.45 7/1/2027 6/30/2028 $59.97 5.00% $52.37 $67.56 $154.10 $198.80 $185.27 $185.27 $185.27 7/1/2028 6/30/2029 $62.96 5.00% $54.99 $70.94 $161.80 $208.74 $194.54 $194.54 $194.54 7/2/2029 6/30/2030 $66.11 5.00% $57.74 $74.49 $169.89 $219.18 $147.68 $147.68 $147.68 7/1/2025 6/30/2026 $50.19 0.00% $41.80 $58.58 $123.00 $172.36 $155.07 $155.07 $155.07 7/1/2026 6/30/2027 $52.70 5.00% $43.89 $61.50 $129.15 $180.98 $162.82 $162.82 $162.82 7/1/2027 6/30/2028 $55.33 5.00% $46.09 $64.58 $135.61 $190.03 $170.96 $170.96 $170.96 7/1/2028 6/30/2029 $58.10 5.00% $48.39 $67.81 $142.39 $199.53 $179.51 $179.51 $179.51 7/2/2029 6/30/2030 $61.00 5.00% $50.81 $71.20 $149.51 $209.50 Exempt/Hourly
To Be Determined

PROFESSIONAL VII
Exempt/Hourly
To Be Determined

PROFESSIONAL VIII

PROFESSIONAL V
Exempt/Hourly
To Be Determined

PROFESSIONAL IV
To Be Determined

PROFESSIONAL VI
Exempt/Hourly
To Be Determined
Exempt/Hourly
To Be Determined

PROFESSIONAL II
Exempt/Hourly
To Be Determined

PROFESSIONAL III
Exempt/Hourly
January 2020

Page 5 of 12 ends

ITEM 9.12.

ATTACHMENT 2

Page 487 of 654 ends

SPECIFIC RATE OF COMPENSATION (USE FOR ON-CALL OR AS-NEEDED CONTRACTS) (CONSTRUCTION ENGINEERING AND INSPECTION CONTRACTS)
Dewberry Engineers Inc.

Pre-Qualified List of
ConsultantsFederal Construction Management Services
Xx
$105.10 $105.10 $105.10 7/1/2025 6/30/2026 $35.72 0.00% $30.40 $41.03 $89.45 $120.75 $110.35 $110.35 $110.35 7/1/2026 6/30/2027 $37.50 5.00% $31.92 $43.09 $93.93 $126.78 $115.87 $115.87 $115.87 7/1/2027 6/30/2028 $39.38 5.00% $33.52 $45.24 $98.62 $133.12 $121.67 $121.67 $121.67 7/1/2028 6/30/2029 $41.35 5.00% $35.19 $47.50 $103.55 $139.78 $127.75 $127.75 $127.75 7/2/2029 6/30/2030 $43.41 5.00% $36.95 $49.88 $108.73 $146.77 $367.40 $367.40 $367.40 7/1/2025 6/30/2026 $137.10 0.00% $129.21 $145.00 $346.24 $388.56 $385.77 $385.77 $385.77 7/1/2026 6/30/2027 $143.96 5.00% $135.67 $152.25 $363.55 $407.99 $405.06 $405.06 $405.06 7/1/2027 6/30/2028 $151.16 5.00% $142.45 $159.86 $381.73 $428.38 $425.31 $425.31 $425.31 7/1/2028 6/30/2029 $158.71 5.00% $149.57 $167.86 $400.81 $449.80 $446.57 $446.57 $446.57 7/2/2029 6/30/2030 $166.65 5.00% $157.05 $176.25 $420.85 $472.29 $330.66 $330.66 $330.66 7/1/2025 6/30/2026 $123.39 0.00% $111.79 $135.00 $299.55 $361.76 $347.19 $347.19 $347.19 7/1/2026 6/30/2027 $129.56 5.00% $117.38 $141.75 $314.53 $379.85 $364.55 $364.55 $364.55 7/1/2027 6/30/2028 $136.04 5.00% $123.24 $148.84 $330.26 $398.84 $382.78 $382.78 $382.78 7/1/2028 6/30/2029 $142.84 5.00% $129.41 $156.28 $346.77 $418.78 $401.92 $401.92 $401.92 7/2/2029 6/30/2030 $149.99 5.00% $135.88 $164.09 $364.11 $439.72 $278.17 $278.17 $278.17 7/1/2025 6/30/2026 $103.81 0.00% $97.61 $110.00 $261.58 $294.77 $292.08 $292.08 $292.08 7/1/2026 6/30/2027 $109.00 5.00% $102.49 $115.50 $274.66 $309.51 $306.68 $306.68 $306.68 7/1/2027 6/30/2028 $114.45 5.00% $107.62 $121.28 $288.39 $324.98 $322.02 $322.02 $322.02 7/1/2028 6/30/2029 $120.17 5.00% $113.00 $127.34 $302.81 $341.23 $338.12 $338.12 $338.12 7/2/2029 6/30/2030 $126.18 5.00% $118.65 $133.71 $317.95 $358.29 $246.68 $246.68 $246.68 7/1/2025 6/30/2026 $92.06 0.00% $86.11 $98.00 $230.75 $262.61 $259.01 $259.01 $259.01 7/1/2026 6/30/2027 $96.66 5.00% $90.42 $102.90 $242.29 $275.74 $271.97 $271.97 $271.97 7/1/2027 6/30/2028 $101.49 5.00% $94.94 $108.05 $254.40 $289.53 $285.56 $285.56 $285.56 7/1/2028 6/30/2029 $106.57 5.00% $99.68 $113.45 $267.12 $304.01 $299.84 $299.84 $299.84 7/2/2029 6/30/2030 $111.89 5.00% $104.67 $119.12 $280.48 $319.21 $215.19 $215.19 $215.19 7/1/2025 6/30/2026 $80.30 0.00% $73.61 $87.00 $197.25 $233.13 $225.95 $225.95 $225.95 7/1/2026 6/30/2027 $84.32 5.00% $77.29 $91.35 $207.11 $244.79 $237.25 $237.25 $237.25 7/1/2027 6/30/2028 $88.53 5.00% $81.15 $95.92 $217.46 $257.03 $249.11 $249.11 $249.11 7/1/2028 6/30/2029 $92.96 5.00% $85.21 $100.71 $228.34 $269.88 $261.56 $261.56 $261.56 7/2/2029 6/30/2030 $97.61 5.00% $89.47 $105.75 $239.75 $283.38 $178.45 $178.45 $178.45 7/1/2025 6/30/2026 $66.59 0.00% $59.19 $74.00 $158.60 $198.30 $187.37 $187.37 $187.37 7/1/2026 6/30/2027 $69.92 5.00% $62.15 $77.70 $166.53 $208.21 $196.74 $196.74 $196.74 7/1/2027 6/30/2028 $73.42 5.00% $65.25 $81.59 $174.86 $218.62 $206.58 $206.58 $206.58 7/1/2028 6/30/2029 $77.09 5.00% $68.52 $85.66 $183.60 $229.56 $216.91 $216.91 $216.91 7/2/2029 6/30/2030 $80.94 5.00% $71.94 $89.95 $192.78 $241.03 (Field Rate)
Exempt/Hourly
To Be Determined

CONSTRUCTION PROFESSIONAL VII
(Field Rate)
Exempt/Hourly
To Be Determined
To Be Determined

PROFESSIONAL I
Non-Exempt/Hourly
(Field Rate)
Exempt/Hourly

CONSTRUCTION PROFESSIONAL VI
(Field Rate)
Exempt/Hourly
To Be Determined

CONSTRUCTION PROFESSIONAL V
To Be Determined

CONSTRUCTION PROFESSIONAL IV
(Field Rate)
Exempt/Hourly
To Be Determined

CONSTRUCTION PROFESSIONAL III
(Field Rate)
Exempt/Hourly
To Be Determined

CONSTRUCTION PROFESSIONAL II
January 2020

Page 6 of 12 ends

ITEM 9.12.

ATTACHMENT 2

Page 488 of 654 ends

SPECIFIC RATE OF COMPENSATION (USE FOR ON-CALL OR AS-NEEDED CONTRACTS) (CONSTRUCTION ENGINEERING AND INSPECTION CONTRACTS)
Dewberry Engineers Inc.

Pre-Qualified List of
ConsultantsFederal Construction Management Services
Xx
$146.96 $146.96 $146.96 7/1/2025 6/30/2026 $54.84 0.00% $49.68 $60.00 $133.14 $160.78 $154.31 $154.31 $154.31 7/1/2026 6/30/2027 $57.58 5.00% $52.17 $63.00 $139.79 $168.82 $162.02 $162.02 $162.02 7/1/2027 6/30/2028 $60.46 5.00% $54.78 $66.15 $146.78 $177.26 $170.12 $170.12 $170.12 7/1/2028 6/30/2029 $63.49 5.00% $57.51 $69.46 $154.12 $186.13 $178.63 $178.63 $178.63 7/2/2029 6/30/2030 $66.66 5.00% $60.39 $72.93 $161.83 $195.43 $278.17 $336.30 $394.44 7/1/2025 6/30/2026 $103.81 0.00% $97.61 $110.00 $261.58 $294.77 $292.08 $353.12 $414.16 7/1/2026 6/30/2027 $109.00 5.00% $102.49 $115.50 $274.66 $309.51 $306.68 $370.78 $434.87 7/1/2027 6/30/2028 $114.45 5.00% $107.62 $121.28 $288.39 $324.98 $322.02 $389.31 $456.61 7/1/2028 6/30/2029 $120.17 5.00% $113.00 $127.34 $302.81 $341.23 $338.12 $408.78 $479.44 7/2/2029 6/30/2030 $126.18 5.00% $118.65 $133.71 $317.95 $358.29 $236.18 $285.54 $334.90 7/1/2025 6/30/2026 $88.14 0.00% $79.28 $97.00 $212.44 $259.93 $247.99 $299.82 $351.64 7/1/2026 6/30/2027 $92.54 5.00% $83.24 $101.85 $223.06 $272.93 $260.39 $314.81 $369.23 7/1/2027 6/30/2028 $97.17 5.00% $87.40 $106.94 $234.21 $286.57 $273.41 $330.55 $387.69 7/1/2028 6/30/2029 $102.03 5.00% $91.77 $112.29 $245.92 $300.90 $287.08 $347.08 $407.07 7/2/2029 6/30/2030 $107.13 5.00% $96.36 $117.90 $258.22 $315.95 $209.94 $253.81 $297.69 7/1/2025 6/30/2026 $78.34 0.00% $74.69 $82.00 $200.15 $219.74 $220.44 $266.51 $312.57 7/1/2026 6/30/2027 $82.26 5.00% $78.42 $86.10 $210.15 $230.72 $231.46 $279.83 $328.20 7/1/2027 6/30/2028 $86.38 5.00% $82.35 $90.41 $220.66 $242.26 $243.03 $293.82 $344.61 7/1/2028 6/30/2029 $90.69 5.00% $86.46 $94.93 $231.69 $254.37 $255.18 $308.51 $361.84 7/2/2029 6/30/2030 $95.23 5.00% $90.79 $99.67 $243.28 $267.09 $183.70 $222.09 $260.48 7/1/2025 6/30/2026 $68.55 0.00% $63.10 $74.00 $169.10 $198.30 $192.88 $233.19 $273.50 7/1/2026 6/30/2027 $71.98 5.00% $66.26 $77.70 $177.55 $208.21 $202.53 $244.85 $287.18 7/1/2027 6/30/2028 $75.58 5.00% $69.57 $81.59 $186.43 $218.62 $212.65 $257.09 $301.53 7/1/2028 6/30/2029 $79.36 5.00% $73.05 $85.66 $195.75 $229.56 $223.29 $269.95 $316.61 7/2/2029 6/30/2030 $83.33 5.00% $76.70 $89.95 $205.54 $241.03 $162.70 $196.71 $230.71 7/1/2025 6/30/2026 $60.72 0.00% $56.43 $65.00 $151.23 $174.18 $170.84 $206.54 $242.24 7/1/2026 6/30/2027 $63.75 5.00% $59.26 $68.25 $158.79 $182.89 $179.38 $216.87 $254.36 7/1/2027 6/30/2028 $66.94 5.00% $62.22 $71.66 $166.73 $192.03 $188.35 $227.71 $267.07 7/1/2028 6/30/2029 $70.29 5.00% $65.33 $75.25 $175.07 $201.64 $197.77 $239.10 $280.43 7/2/2029 6/30/2030 $73.80 5.00% $68.60 $79.01 $183.82 $211.72 $125.96 $152.29 $178.61 7/1/2025 6/30/2026 $47.01 0.00% $37.01 $57.00 $99.19 $152.74 $132.26 $159.90 $187.54 7/1/2026 6/30/2027 $49.36 5.00% $38.86 $59.85 $104.15 $160.38 $138.88 $167.90 $196.92 7/1/2027 6/30/2028 $51.83 5.00% $40.81 $62.84 $109.35 $168.40 $145.82 $176.29 $206.77 7/1/2028 6/30/2029 $54.42 5.00% $42.85 $65.98 $114.82 $176.82 $153.11 $185.11 $217.10 7/2/2029 6/30/2030 $57.14 5.00% $44.99 $69.28 $120.56 $185.66 Prevailing Wage Rates at the time of work ***
To Be Determined
INSPECTOR VI **
(Field Rate)
*** Rates to be charged in accordance with
Prevailing Wage Rates at the time of work ***
Prevailing Wage Rates at the time of work ***
To Be Determined
INSPECTOR V **
(Field Rate)
*** Rates to be charged in accordance with
Prevailing Wage Rates at the time of work ***
To Be Determined
INSPECTOR IV **
(Field Rate)
*** Rates to be charged in accordance with
To Be Determined

CONSTRUCTION PROFESSIONAL I
(Field Rate)
Exempt/Hourly
To Be Determined
INSPECTOR VII **
(Field Rate)
*** Rates to be charged in accordance with
To Be Determined
INSPECTOR III **
(Field Rate)
Prevailing Wage Rates at the time of work ***
*** Rates to be charged in accordance with
Prevailing Wage Rates at the time of work ***
To Be Determined
INSPECTOR II **
(Field Rate)
*** Rates to be charged in accordance with
January 2020

Page 7 of 12 ends

ITEM 9.12.

ATTACHMENT 2

Page 489 of 654 ends

SPECIFIC RATE OF COMPENSATION (USE FOR ON-CALL OR AS-NEEDED CONTRACTS) (CONSTRUCTION ENGINEERING AND INSPECTION CONTRACTS)
Dewberry Engineers Inc.

Pre-Qualified List of
ConsultantsFederal Construction Management Services
Xx
$99.72 $120.56 $141.40 7/1/2025 6/30/2026 $37.21 0.00% $34.43 $40.00 $92.26 $107.19 $104.71 $126.59 $148.47 7/1/2026 6/30/2027 $39.07 5.00% $36.15 $42.00 $96.87 $112.55 $109.94 $132.92 $155.90 7/1/2027 6/30/2028 $41.03 5.00% $37.96 $44.10 $101.71 $118.18 $115.44 $139.57 $163.69 7/1/2028 6/30/2029 $43.08 5.00% $39.85 $46.31 $106.80 $124.08 $121.21 $146.54 $171.87 7/2/2029 6/30/2030 $45.23 5.00% $41.85 $48.62 $112.14 $130.29 $198.98 $198.98 $198.98 7/1/2025 6/30/2026 $67.62 0.00% $62.82 $72.42 $184.86 $213.10 $208.93 $208.93 $208.93 7/1/2026 6/30/2027 $71.00 5.00% $65.97 $76.04 $194.11 $223.75 $219.38 $219.38 $219.38 7/1/2027 6/30/2028 $74.55 5.00% $69.26 $79.84 $203.81 $234.94 $230.35 $230.35 $230.35 7/1/2028 6/30/2029 $78.28 5.00% $72.73 $83.84 $214.00 $246.69 $241.86 $241.86 $241.86 7/2/2029 6/30/2030 $82.20 5.00% $76.36 $88.03 $224.70 $259.02 $172.49 $172.49 $172.49 7/1/2025 6/30/2026 $58.62 0.00% $50.15 $67.10 $147.55 $197.43 $181.12 $181.12 $181.12 7/1/2026 6/30/2027 $61.55 5.00% $52.65 $70.45 $154.93 $207.30 $190.17 $190.17 $190.17 7/1/2027 6/30/2028 $64.63 5.00% $55.29 $73.97 $162.68 $217.67 $199.68 $199.68 $199.68 7/1/2028 6/30/2029 $67.86 5.00% $58.05 $77.67 $170.81 $228.55 $209.67 $209.67 $209.67 7/2/2029 6/30/2030 $71.25 5.00% $60.95 $81.55 $179.35 $239.98 $132.98 $132.98 $132.98 7/1/2025 6/30/2026 $45.19 0.00% $38.72 $51.66 $113.94 $152.02 $139.63 $139.63 $139.63 7/1/2026 6/30/2027 $47.45 5.00% $40.66 $54.25 $119.63 $159.62 $146.61 $146.61 $146.61 7/1/2027 6/30/2028 $49.82 5.00% $42.69 $56.96 $125.61 $167.60 $153.94 $153.94 $153.94 7/1/2028 6/30/2029 $52.31 5.00% $44.82 $59.81 $131.89 $175.98 $161.64 $161.64 $161.64 7/2/2029 6/30/2030 $54.93 5.00% $47.06 $62.80 $138.49 $184.78 $113.07 $113.07 $113.07 7/1/2025 6/30/2026 $38.43 0.00% $34.25 $42.60 $100.79 $125.35 $118.72 $118.72 $118.72 7/1/2026 6/30/2027 $40.35 5.00% $35.96 $44.73 $105.83 $131.62 $124.66 $124.66 $124.66 7/1/2027 6/30/2028 $42.36 5.00% $37.76 $46.97 $111.12 $138.20 $130.89 $130.89 $130.89 7/1/2028 6/30/2029 $44.48 5.00% $39.65 $49.31 $116.67 $145.11 $137.44 $137.44 $137.44 7/2/2029 6/30/2030 $46.71 5.00% $41.63 $51.78 $122.51 $152.37 $91.78 $91.78 $91.78 7/1/2025 6/30/2026 $31.19 0.00% $25.11 $37.28 $73.88 $109.68 $96.37 $96.37 $96.37 7/1/2026 6/30/2027 $32.75 5.00% $26.36 $39.14 $77.58 $115.17 $101.19 $101.19 $101.19 7/1/2027 6/30/2028 $34.39 5.00% $27.68 $41.10 $81.46 $120.93 $106.25 $106.25 $106.25 7/1/2028 6/30/2029 $36.11 5.00% $29.07 $43.15 $85.53 $126.97 $111.56 $111.56 $111.56 7/2/2029 6/30/2030 $37.91 5.00% $30.52 $45.31 $89.80 $133.32 $332.94 $332.94 $332.94 7/1/2025 6/30/2026 $113.15 0.00% $106.29 $120.00 $312.77 $353.11 $349.58 $349.58 $349.58 7/1/2026 6/30/2027 $118.80 5.00% $111.60 $126.00 $328.40 $370.76 $367.06 $367.06 $367.06 7/1/2027 6/30/2028 $124.74 5.00% $117.19 $132.30 $344.82 $389.30 $385.41 $385.41 $385.41 7/1/2028 6/30/2029 $130.98 5.00% $123.04 $138.92 $362.06 $408.76 $404.69 $404.69 $404.69 7/2/2029 6/30/2030 $137.53 5.00% $129.20 $145.86 $380.17 $429.20 To Be Determined
INSPECTOR I **
(Field Rate)
*** Rates to be charged in accordance with
Prevailing Wage Rates at the time of work ***

ADMIN PROFESSIONAL IV
Exempt/Hourly
To Be Determined

ADMIN PROFESSIONAL III
To Be Determined

ADMIN PROFESSIONAL V
Exempt/Hourly
To Be Determined
Exempt/Hourly
Exempt/Hourly
To Be Determined

ADMIN ASSISTANT I
Non-Exempt/Hourly
To Be Determined

ADMIN ASSISTANT II
To Be Determined

GEOGRAPHER/GIS IX
Exempt/Hourly
January 2020

Page 8 of 12 ends

ITEM 9.12.

ATTACHMENT 2

Page 490 of 654 ends

SPECIFIC RATE OF COMPENSATION (USE FOR ON-CALL OR AS-NEEDED CONTRACTS) (CONSTRUCTION ENGINEERING AND INSPECTION CONTRACTS)
Dewberry Engineers Inc.

Pre-Qualified List of
ConsultantsFederal Construction Management Services
Xx
$286.12 $286.12 $286.12 7/1/2025 6/30/2026 $97.23 0.00% $88.47 $106.00 $260.32 $311.91 $300.42 $300.42 $300.42 7/1/2026 6/30/2027 $102.10 5.00% $92.89 $111.30 $273.34 $327.51 $315.44 $315.44 $315.44 7/1/2027 6/30/2028 $107.20 5.00% $97.54 $116.87 $287.01 $343.88 $331.22 $331.22 $331.22 7/1/2028 6/30/2029 $112.56 5.00% $102.41 $122.71 $301.36 $361.08 $347.78 $347.78 $347.78 7/2/2029 6/30/2030 $118.19 5.00% $107.53 $128.84 $316.42 $379.13 $244.50 $244.50 $244.50 7/1/2025 6/30/2026 $83.09 0.00% $76.18 $90.00 $224.17 $264.83 $256.72 $256.72 $256.72 7/1/2026 6/30/2027 $87.25 5.00% $79.99 $94.50 $235.38 $278.07 $269.56 $269.56 $269.56 7/1/2027 6/30/2028 $91.61 5.00% $83.99 $99.23 $247.15 $291.97 $283.04 $283.04 $283.04 7/1/2028 6/30/2029 $96.19 5.00% $88.19 $104.19 $259.50 $306.57 $297.19 $297.19 $297.19 7/2/2029 6/30/2030 $101.00 5.00% $92.60 $109.40 $272.48 $321.90 $213.29 $213.29 $213.29 7/1/2025 6/30/2026 $72.48 0.00% $66.97 $78.00 $197.05 $229.52 $223.95 $223.95 $223.95 7/1/2026 6/30/2027 $76.11 5.00% $70.32 $81.90 $206.91 $241.00 $235.15 $235.15 $235.15 7/1/2027 6/30/2028 $79.91 5.00% $73.83 $86.00 $217.25 $253.04 $246.91 $246.91 $246.91 7/1/2028 6/30/2029 $83.91 5.00% $77.52 $90.29 $228.12 $265.70 $259.25 $259.25 $259.25 7/2/2029 6/30/2030 $88.10 5.00% $81.40 $94.81 $239.52 $278.98 $187.28 $187.28 $187.28 7/1/2025 6/30/2026 $63.64 0.00% $59.29 $68.00 $174.46 $200.09 $196.64 $196.64 $196.64 7/1/2026 6/30/2027 $66.83 5.00% $62.25 $71.40 $183.18 $210.10 $206.47 $206.47 $206.47 7/1/2027 6/30/2028 $70.17 5.00% $65.37 $74.97 $192.34 $220.60 $216.80 $216.80 $216.80 7/1/2028 6/30/2029 $73.68 5.00% $68.63 $78.72 $201.96 $231.63 $227.64 $227.64 $227.64 7/2/2029 6/30/2030 $77.36 5.00% $72.07 $82.65 $212.06 $243.22 $166.47 $166.47 $166.47 7/1/2025 6/30/2026 $56.57 0.00% $50.15 $63.00 $147.55 $185.38 $174.79 $174.79 $174.79 7/1/2026 6/30/2027 $59.40 5.00% $52.65 $66.15 $154.93 $194.65 $183.53 $183.53 $183.53 7/1/2027 6/30/2028 $62.37 5.00% $55.29 $69.46 $162.68 $204.38 $192.71 $192.71 $192.71 7/1/2028 6/30/2029 $65.49 5.00% $58.05 $72.93 $170.81 $214.60 $202.34 $202.34 $202.34 7/2/2029 6/30/2030 $68.76 5.00% $60.95 $76.58 $179.35 $225.33 $145.66 $145.66 $145.66 7/1/2025 6/30/2026 $49.50 0.00% $46.00 $53.00 $135.36 $155.96 $152.94 $152.94 $152.94 7/1/2026 6/30/2027 $51.98 5.00% $48.30 $55.65 $142.13 $163.75 $160.59 $160.59 $160.59 7/1/2027 6/30/2028 $54.57 5.00% $50.72 $58.43 $149.24 $171.94 $168.62 $168.62 $168.62 7/1/2028 6/30/2029 $57.30 5.00% $53.25 $61.35 $156.70 $180.54 $177.05 $177.05 $177.05 7/2/2029 6/30/2030 $60.17 5.00% $55.92 $64.42 $164.54 $189.56 $119.65 $119.65 $119.65 7/1/2025 6/30/2026 $40.66 0.00% $33.32 $48.00 $98.06 $141.24 $125.63 $125.63 $125.63 7/1/2026 6/30/2027 $42.69 5.00% $34.99 $50.40 $102.96 $148.30 $131.91 $131.91 $131.91 7/1/2027 6/30/2028 $44.83 5.00% $36.74 $52.92 $108.11 $155.72 $138.51 $138.51 $138.51 7/1/2028 6/30/2029 $47.07 5.00% $38.58 $55.57 $113.51 $163.51 $145.43 $145.43 $145.43 7/2/2029 6/30/2030 $49.42 5.00% $40.50 $58.34 $119.19 $171.68 Exempt/Hourly To Be Determined

GEOGRAPHER/GIS III
Exempt/Hourly
To Be Determined

GEOGRAPHER/GIS II
To Be Determined

GEOGRAPHER/GIS VIII
Exempt/Hourly
To Be Determined

GEOGRAPHER/GIS VII
Exempt/Hourly
To Be Determined

GEOGRAPHER/GIS VI
Exempt/Hourly
To Be Determined

GEOGRAPHER/GIS V
Exempt/Hourly
To Be Determined

GEOGRAPHER/GIS IV
Exempt/Hourly
January 2020

Page 9 of 12 ends

ITEM 9.12.

ATTACHMENT 2

Page 491 of 654 ends

SPECIFIC RATE OF COMPENSATION (USE FOR ON-CALL OR AS-NEEDED CONTRACTS) (CONSTRUCTION ENGINEERING AND INSPECTION CONTRACTS)
Dewberry Engineers Inc.

Pre-Qualified List of
ConsultantsFederal Construction Management Services
Xx
$109.24 $109.24 $109.24 7/1/2025 6/30/2026 $37.13 0.00% $36.25 $38.00 $106.67 $111.82 $114.71 $114.71 $114.71 7/1/2026 6/30/2027 $38.98 5.00% $38.06 $39.90 $112.01 $117.41 $120.44 $120.44 $120.44 7/1/2027 6/30/2028 $40.93 5.00% $39.97 $41.90 $117.61 $123.28 $126.46 $126.46 $126.46 7/1/2028 6/30/2029 $42.98 5.00% $41.97 $43.99 $123.49 $129.44 $132.79 $132.79 $132.79 7/2/2029 6/30/2030 $45.13 5.00% $44.06 $46.19 $129.66 $135.91 To Be Determined

GEOGRAPHER/GIS I
Exempt/Hourly
(add pages as necessary)
NOTES:

1. Key personnel must be marked with an asterisk (*) and employees that are subject to prevailing wage requirements must be marked with two asterisks (**).All costs must comply with the Federal cost principles. Subconsultants will provide their own cost proposals.

2. The cost proposal format shall not be amended.

3. Billing rate = (actual hourly rate * (1+ ICR) * (1+ Fee))+(actual hourly rate * FCCM)) . Indirect cost rates shall be updated on an annual basis in accordance with the consultant’s annual accounting period and established by a cognizant agency or accepted by Caltrans. All costs must comply with the Federal cost principles for reimbursement.

4. For named employees and key personnel enter the actual hourly rate. For classifications only, enter the Average Hourly Rate for that classification.

January 2020

Page 10 of 12 ends

ITEM 9.12.

ATTACHMENT 2

Page 492 of 654 ends

Consultant Prime Consultant
Project No. Date
Subconsultant 1:

Subconsultant 2:

Subconsultant 3:

January 2020
$75.00 $0.00
Cultural Record Search 0.0 EA $400.00
EA
$0.00
Tolls & Parking 0.0 EA $15.00 $0.00

0.0 EA $200.00 $0.00
Per Diem (At Current GSA Rate) 0.0 EA $150.00

PRIME CONSULTANT
DESCRIPTION OF ITEMS Quantity Unit
$0.725 $0.00
Unit Cost Total
Outside Vendor Printing & Reproduction (Note 5) 0.0 EA $500.00 $0.00 U.S. Mail 0.0 EA
Overnight Mail Service 0.0 EA $30.00 $0.00
Personal Vehicle 0.0 Mile
COST PROPOSAL FORM 2 OF 3

SPECIFIC RATE OF COMPENSATION (USE FOR ON-CALL OR AS-NEEDED CONTRACTS) (CONSTRUCTION ENGINEERING AND INSPECTION CONTRACTS)
Subconsultant

SCHEDULE OF OTHER DIRECT COST ITEMS
Dewberry Engineers Inc.
#SPILL! 4/17/2026Contract No. 0
EDR Record Search 0.0 $350.00 $0.00
$0.00
R.E.Y. Engineers
Total ODC's
$0.00R.E.Y. Engineers - pg. 2
Trimble Rental 0.0 Per Day $300.00 $0.00
Rental Vehicle & Gas
$20.00 $0.00

0.0 Day
Cost ProposalLocal Assistance Procedures Manual
NOTES:

1. List other direct cost items with estimated costs. These costs should be competitive in their respective industries and supported with appropriate documentation.

2. Proposed ODC items should be consistently billed regardless of client and contract type.

3. Items when incurred for the same purpose, in like circumstance, should not be included in any indirect cost pool or in the overhead rate.

4. Items such as special tooling, will be reimbursed at actual cost with supporting documentation (invoice).

5. Items listed above that would be considered "tools of the trade" are not reimbursable as other direct cost.

6. Travel related costs should be pre-approved by the contracting agency and shall not exceed current State Department of Personnel Administration rules.

7. If mileage is claimed, the rate should be properly supported by the consultant's calculation of their actual costs for company vehicles. In addition, the miles claimed should be supported by mileage logs.

8. If a consultant proposes rental costs for a vehicle, the company must demonstrate that this is its standard procedure for all of their contracts and that they do not own any vehicles that could be used for the same purpose.

9. The cost proposal format shall not be amended. All costs must comply with the Federal cost principles.

10. Add additional pages if necessary.

11. Subconsultants must provide their own cost proposals $0.00
$0.00
ENGEO
Total Subconsultants $0.00
Note: Add Additional pages if necessary.
$0.00
Research Fees
X
ITEM 9.12.

ATTACHMENT 2

Page 493 of 654 ends

Local Assistance Procedures Manual Cost Proposal
Certification of Direct Costs:

Prime Consultant or Subconsultant Certifying:

Name: Title*:

Signature: 4/17/2026
Email: Phone Number:

Address:

List services the consultant is providing under the proposed contract:

January 2020

4. 48 Code of Federal Regulations Part 31 - Contract Cost Principles and Procedures COST PROPOSAL Page 3 of 3
I, the undersigned, certify to the best of my knowledge and belief that all direct costs identified on the cost proposal(s) in this contract are actual, reasonable, allowable, and allocable to the contract in accordance with the contract terms and the following requirements:

1. Generally Accepted Accounting Principles (GAAP)

2. Terms and conditions of the contract

3. Title 23 United States Code Section 112 - Letting of Contracts

5. 23 Code of Federal Regulations Part 172 - Procurement, Management, and Administration of Engineering and Design Related Service

6. 48 Code of Federal Regulations Part 9904 - Cost Accounting Standards Board (when applicable) All costs must be applied consistently and fairly to all contracts. All documentation of compliance must be retained in the project files and be in compliance with applicable federal and state requirements. Costs that are noncompliant with the federal and state requirements are not eligible for reimbursement.

Local governments are responsible for applying only cognizant agency approved or Caltrans accepted Indirect Cost Rate(s).

Dennis Haglan Vice President
Transportation Design, Environmental Studies, Water/Wastewater Design, Public Outreach, Construction Management, Transportation Planning, Grant Writing
Date of Certification (mm/dd/yyyy):
[email protected] (916) 363-4210
11060 White Rock Road, Suite 200 | Rancho Cordova, CA 95670 *An individual executive or financial officer of the consultant’s or subconsultant’s organization at a level no lower than a Vice President or a Chief Financial Officer, or equivalent, who has authority to represent the financial information utilized to establish the cost proposal for the contract.

ITEM 9.12.

ATTACHMENT 2

Page 494 of 654 ends

Local Assistance Procedures Manual Exhibit 10-H2
Cost Proposal
Note: Mark-ups are Not Allowed
Consultant ENGEO Incorporated Prime Consultant Subconsultant 2nd Tier Sunconsultant Project No. Federal CM Services Contract No. Date 4/16/2026 For Combined Rate
176.00% 86.00% 262.00%
Fringe Benefit % + General and Administrative % = Combined ICR % FEE % = 10.00%
Actual or avg. % or $
hourly rate3 increase
Principal Engineer/Geologist $389.16 01/01/26 12/31/26 $97.73 0 $76.92 $139.42 $408.62 01/01/27 12/31/27 $102.62 5.00% $80.77 $146.39
$429.05 01/01/28 12/31/28 $107.75 5.00% $84.80 $153.71
$450.50 01/01/29 12/31/29 $113.13 5.00% $89.04 $161.40
$473.03 01/01/30 12/31/30 $118.79 5.00% $93.50 $169.47
Associate Engineer/Geologist $280.33 01/01/26 12/31/26 $70.40 0 $63.46 $83.65 $294.35 01/01/27 12/31/27 $73.92 5.00% $66.63 $87.83
$309.07 01/01/28 12/31/28 $77.62 5.00% $69.96 $92.22
$324.52 01/01/29 12/31/29 $81.50 5.00% $73.46 $96.84
$340.75 01/01/30 12/31/30 $85.57 5.00% $77.14 $101.68
Senior Engineer/Geologist/Environmental Scientist $238.96 01/01/26 12/31/26 $60.01 0 $53.85 $65.87 $250.91 01/01/27 12/31/27 $63.01 5.00% $56.54 $69.16
$263.45 01/01/28 12/31/28 $66.16 5.00% $59.37 $72.62
$276.63 01/01/29 12/31/29 $69.47 5.00% $62.34 $76.25
$290.46 01/01/30 12/31/30 $72.94 5.00% $65.46 $80.07
Project Engineer/Geologist $187.83 01/01/26 12/31/26 $47.17 0 $38.46 $57.69 $197.22 01/01/27 12/31/27 $49.53 5.00% $40.38 $60.57
$207.08 01/01/28 12/31/28 $52.00 5.00% $42.40 $63.60
$217.44 01/01/29 12/31/29 $54.61 5.00% $44.52 $66.78
$228.31 01/01/30 12/31/30 $57.34 5.00% $46.75 $70.12
Staff Engineer/Geologist/Environmental Scientist $156.17 01/01/26 12/31/26 $39.22 0 $33.00 $44.71 $163.98 01/01/27 12/31/27 $41.18 5.00% $34.65 $46.95
$172.18 01/01/28 12/31/28 $43.24 5.00% $36.38 $49.29
$180.79 01/01/29 12/31/29 $45.40 5.00% $38.20 $51.76
$189.83 01/01/30 12/31/30 $47.67 5.00% $40.11 $54.35
Hourly range - for
classifications only
Hourly Billing Rates2 Effective date of hourly rate
Name/Job Title/Classification1
Straight OT(1.5x) OT(2x) From To

BILLING INFORMATION CALCULATION INFORMATION
(CONSTRUCTION ENGINEERING AND INSPECTION CONTRACTS)
COST PROPOSAL 2
Participation Amount $

SPECIFIC RATE OF COMPENSATION (USE FOR ON-CALL OR AS-NEEDED CONTRACTS) January 2018
ITEM 9.12.

ATTACHMENT 2

Page 495 of 654 ends

Local Assistance Procedures Manual Exhibit 10-H2
Cost Proposal
Sr. GIS Developer $230.68 01/01/26 12/31/26 $57.93 0 $57.21 $58.65 $242.21 01/01/27 12/31/27 $60.83 5.00% $60.07 $61.58
$254.32 01/01/28 12/31/28 $63.87 5.00% $63.07 $64.66
$267.04 01/01/29 12/31/29 $67.06 5.00% $66.23 $67.89
$280.39 01/01/30 12/31/30 $70.41 5.00% $69.54 $71.29
GIS Developer $246.96 01/01/26 12/31/26 $62.02 0 $62.02 $62.02 $259.31 01/01/27 12/31/27 $65.12 5.00% $65.12 $65.12
$272.28 01/01/28 12/31/28 $68.38 5.00% $68.38 $68.38
$285.89 01/01/29 12/31/29 $71.80 5.00% $71.80 $71.80
$300.19 01/01/30 12/31/30 $75.39 5.00% $75.39 $75.39
GIS Analyst $143.59 01/01/26 12/31/26 $36.06 0 $36.06 $36.06 $150.77 01/01/27 12/31/27 $37.86 5.00% $37.86 $37.86
$158.31 01/01/28 12/31/28 $39.76 5.00% $39.76 $39.76
$166.22 01/01/29 12/31/29 $41.74 5.00% $41.74 $41.74
$174.54 01/01/30 12/31/30 $43.83 5.00% $43.83 $43.83
Sr. CAD Specialist $195.16 01/01/26 12/31/26 $49.01 0 $39.42 $57.69 $204.92 01/01/27 12/31/27 $51.46 5.00% $41.39 $60.57
$215.16 01/01/28 12/31/28 $54.03 5.00% $43.46 $63.60
$225.92 01/01/29 12/31/29 $56.74 5.00% $45.63 $66.78
$237.22 01/01/30 12/31/30 $59.57 5.00% $47.92 $70.12
Project Assistant $174.57 01/01/26 12/31/26 $43.84 0 $27.88 $88.94 $183.30 01/01/27 12/31/27 $46.03 5.00% $29.27 $93.39
$192.46 01/01/28 12/31/28 $48.33 5.00% $30.74 $98.06
$202.09 01/01/29 12/31/29 $50.75 5.00% $32.27 $102.96
$212.19 01/01/30 12/31/30 $53.29 5.00% $33.89 $108.11
Senior Project Manager $250.15 $284.70 $319.25 01/01/26 12/31/26 $62.82 0 $58.00 $67.79 $262.66 $298.94 $335.21 01/01/27 12/31/27 $65.96 5.00% $60.90 $71.18 $275.79 $313.88 $351.97 01/01/28 12/31/28 $69.26 5.00% $63.95 $74.74 $289.58 $329.58 $369.57 01/01/29 12/31/29 $72.72 5.00% $67.14 $78.48 $304.06 $346.06 $388.05 01/01/30 12/31/30 $76.36 5.00% $70.50 $82.40 Construction Services Manager II $220.32 $250.76 $281.19 01/01/26 12/31/26 $55.33 0 $50.00 $63.00 $231.34 $263.29 $295.25 01/01/27 12/31/27 $58.10 5.00% $52.50 $66.15 $242.91 $276.46 $310.01 01/01/28 12/31/28 $61.00 5.00% $55.13 $69.46 $255.05 $290.28 $325.51 01/01/29 12/31/29 $64.05 5.00% $57.88 $72.93 $267.81 $304.80 $341.78 01/01/30 12/31/30 $67.25 5.00% $60.78 $76.58 Construction Services Manager I $188.39 $214.41 $240.43 01/01/26 12/31/26 $47.31 0 $44.23 $52.40 $197.81 $225.13 $252.45 01/01/27 12/31/27 $49.68 5.00% $46.44 $55.02 $207.70 $236.39 $265.07 01/01/28 12/31/28 $52.16 5.00% $48.76 $57.77 $218.08 $248.21 $278.33 01/01/29 12/31/29 $54.77 5.00% $51.20 $60.66 $228.99 $260.62 $292.24 01/01/30 12/31/30 $57.51 5.00% $53.76 $63.69 January 2018
ITEM 9.12.

ATTACHMENT 2

Page 496 of 654 ends

Local Assistance Procedures Manual Exhibit 10-H2
Cost Proposal
Sr. Field Representative II** $235.97 $268.57 $301.16 01/01/26 12/31/26 $59.26 0 $52.50 $65.60 $247.77 $281.99 $316.22 01/01/27 12/31/27 $62.22 5.00% $55.13 $68.88 $260.16 $296.09 $332.03 01/01/28 12/31/28 $65.33 5.00% $57.88 $72.32 $273.17 $310.90 $348.63 01/01/29 12/31/29 $68.60 5.00% $60.78 $75.94 $286.83 $326.44 $366.06 01/01/30 12/31/30 $72.03 5.00% $63.81 $79.74 Sr. Field Representative I** $182.53 $207.75 $232.96 01/01/26 12/31/26 $45.84 0 $37.50 $63.00 $191.66 $218.13 $244.61 01/01/27 12/31/27 $48.13 5.00% $39.38 $66.15 $201.24 $229.04 $256.84 01/01/28 12/31/28 $50.54 5.00% $41.34 $69.46 $211.31 $240.49 $269.68 01/01/29 12/31/29 $53.07 5.00% $43.41 $72.93 $221.87 $252.52 $283.16 01/01/30 12/31/30 $55.72 5.00% $45.58 $76.58 Field Representative** $143.83 $163.70 $183.56 01/01/26 12/31/26 $36.12 0 $29.00 $50.25 $151.02 $171.88 $192.74 01/01/27 12/31/27 $37.93 5.00% $30.45 $52.76 $158.57 $180.47 $202.38 01/01/28 12/31/28 $39.82 5.00% $31.97 $55.40 $166.50 $189.50 $212.50 01/01/29 12/31/29 $41.81 5.00% $33.57 $58.17 $174.83 $198.97 $223.12 01/01/30 12/31/30 $43.90 5.00% $35.25 $61.08 Sr. Laboratory Technician $189.46 $215.63 $241.80 01/01/26 12/31/26 $47.58 0 $40.00 $61.06 $198.94 $226.41 $253.89 01/01/27 12/31/27 $49.96 5.00% $42.00 $64.11 $208.88 $237.73 $266.59 01/01/28 12/31/28 $52.46 5.00% $44.10 $67.32 $219.33 $249.62 $279.92 01/01/29 12/31/29 $55.08 5.00% $46.31 $70.68 $230.29 $262.10 $293.91 01/01/30 12/31/30 $57.83 5.00% $48.62 $74.22 Laboratory Technician $129.93 $147.88 $165.83 01/01/26 12/31/26 $32.63 0 $26.50 $47.00 $136.43 $155.27 $174.12 01/01/27 12/31/27 $34.26 5.00% $27.83 $49.35 $143.25 $163.04 $182.82 01/01/28 12/31/28 $35.97 5.00% $29.22 $51.82 $150.41 $171.19 $191.96 01/01/29 12/31/29 $37.77 5.00% $30.68 $54.41 $157.93 $179.75 $201.56 01/01/30 12/31/30 $39.66 5.00% $32.21 $57.13

4. For named employees and key personnel enter the actual hourly rate. For classifications only, enter the Average Hourly Rate for that classification.

3. Billing rate = actual hourly rate * (1+ ICR) * (1+ Fee). Indirect cost rates shall be updated on an annual basis in accordance with the consultant’s annual accounting period and established by a cognizant agency or accepted by Caltrans. All costs must comply with the Federal cost principles for reimbursement.

2. The cost proposal format shall not be amended.

Subconsultants will provide their own cost proposals.

January 2018
ITEM 9.12.

ATTACHMENT 2

Page 497 of 654 ends

Local Assistance Procedures Manual Exhibit 10-H2
Cost Proposal
Consultant or Subconsultant ENGEO Incorporated Contract No. Date PRIME CONSULTANT SUBCONSULTANT #1 SUBCONSULTANT #2

DESCRIPTION OF ITEMS UNIT UNIT COST TOTAL DESCRIPTIO

N OF ITEMS UNIT UNIT COST TOTAL

DESCRIPTI
ON OF
ITEMS

UNIT UNIT COST TOTAL

SEE ATTACHED RATE SHEET
PRIME TOTAL ODCs = $0 SUBCONSULTANT #1 ODCs = $0 SUBCONSULTANT #2 ODCs = $0 IMPORTANT NOTES:

1. List direct cost items with estimated costs. These costs should be competitive in their respective industries and supported with appropriate documentations.

2. Proposed items should be consistently billed directly to all clients (Commercial entities, Federal Govt., State Govt., and Local Govt. Agency), and not just when the client will pay for them as a direct cost.

3. Items when incurred for the same purpose, in like circumstance, should not be included in any indirect cost pool or in the overhead rate.

4. Items such as special tooling, will be reimbursed at actual cost with supporting documentation (invoice).

5. Items listed above that would be considered "tools of the trade" are not reimbursable as other direct cost.

6. Travel related costs should be pre-approved by the contracting agency.

8. If a consultant proposes rental costs for a vehicle, the company must demonstrate that this is their standard procedure for all of their contracts and that they do not own any vehicles purpose. that could be used for the same purpose.

SCHEDULE OF OTHER DIRECT COST ITEMS
COST PROPOSAL 2

SPECIFIC RATE OF COMPENSATION (USE FOR ON-CALL OR AS-NEEDED CONTRACTS) (CONSTRUCTION ENGINEERING AND INSPECTION CONTRACTS)
January 2018
ITEM 9.12.

ATTACHMENT 2

Page 498 of 654 ends

GEOTECHNICAL

ENVIRONMENTAL

WATER RESOURCES

CONSTRUCTION SERVICES

COASTAL/MARINE GEOTECHNICS

February 2026 Page 1 of 5 www.engeo.com

SUMMARY OF LABORATORY FEES
Effective February through December 2026 (Subject to 5% annual escalation) Our Laboratories are accredited by AASHTO, Caltrans, DSA, and the US Army Corps of Engineers LAB
CODE
TEST

SPECIFICATION

STANDARD

TURNAROUND
(BUSINESS
DAYS) *

STANDARD
PRICING*
RUSH

TURNAROUND
(BUSINESS
DAYS)*
RUSH
PRICING*

SOIL AND ROCK
8800 Caltrans Relative Compaction, CT216 3 $475 Same Day $950 9100 Clay Lumps and Friable Particles, ASTM C142 5 $425 Next Day $850 9130 Cleanness Value, CT 227 each 5 $295 2 $590
8310 Compaction, ASTM D1557 (A-C) 4 $420 2 $840
8309 Compaction, Manual, ASTM D1557 (A-C) 4 $575 2 $1,150 8311 Compaction Point, AASHTO T272 4 $375 2 $750
8312 Compaction, ASTM-1557 (A-D) or ASTM-D698 with Correction 4 $510 2 $1,020 8314 Rock crushing (25 lbs) 5 $205 2 $410
8315 Compaction, Rock Correction, ASTM D4718 4 $100 Next Day $200 8316 Compaction, ASTM D4253, Vibratory Table 4 $440 2 $880 8317 Compaction, Lime/Cement Treated, ASTM D558 5 $625 3 $1,250 8185 Compression Testing of CLSM (ASTM D4832) 5 $148 3 $296 8220 Consolidation – Incremental Loading ASTM D2435, Method A 32 $600 16 $1,200 8221 Consolidation – Incremental Loading ASTM D2435, Method B 32 $685 16 $1,370 8230 Consolidation, ASTM D2435 Unload – Reload Cycle 4 $125 2 Additional $250 8410 Consolidation – CRS, ASTM D4186, Depths from 0 to 75 feet 5 $800 4 $1,600 8411 Consolidation – CRS, ASTM D4186, Depths from 75 feet and below and/or stiff clays 5 $1,000 4 $2,000
Additional Unload – Reload Cycle (for CRS, Lab Code 8410 and 8411 only) 8412 Stress Range: 1 - 5 ksf Variable $390 N/A $780
8413 Stress Range: 5 - 10 ksf Variable $585 N/A $1,170
8414 Stress Range: 10 - 15 ksf Variable $585 N/A $1,170 8415 Stress Range: 15 - 20 ksf Variable $780 N/A $1,560 8184 Deep Soil Mix (DSM) Compression Test 5 $148 2 $296 8201 Direct Shear – CD, Additional Cycles (per point) ASTM D3080 2 $110 N/A $220 8202 Direct Shear – CD, (2-points) ASTM D3080 8 $590 5 $1,180 8203 Direct Shear – CD, (3-points) ASTM D3080 12 $826 8 $1,652 8204 Direct Shear – CD, (4-points) ASTM D3080 16 $1080 12 $2,160 8451 Direct Shear – CD, (Additional Point) ASTM D3080 5 $275 3 $550 8991 Cyclic Simple Shear Test (CSS), ASTM D8296 5 $2,100 5 $4,200 8992 Monotonic Simple Shear Test, Load-Controlled (per point) ASTM D6528 - Modified 5 $1,225 5 $2,450
8900 Durability Index, CT229 5 $345 Next Day $690
8320 Expansion Index, ASTM D4829 8 $500 4 $1,000
8321 Expansion Index, ASTM D4829 - Lime Treated in Lab Dependent on cure time $595 Dependent on
cure time $1,190
9630 Fine Aggregate Angularity Percentage, CT 234, AASHTO T304, Method A 5 $195 Next Day $390 8990 Laboratory Miniature Vane Shear (peak Value), ASTM D4648 5 $145 Next Day $290 8160 Moisture Content & Unit Weight, ASTM D7263 5 $75 Next Day $144 8140 Moisture Only, ASTM D2216, CT 226 5 $52 Next Day $104 8150 Moisture Only, ASTM D4643, CT 370 (By Microwave oven) 5 $110 Same Day $220 9590 Organic Content of Soil ASTM D2974 5 $200 Next Day $400 9090 Organic Impurities, ASTM C40 5 $195 Next Day $390
9120 Percent Crushed Particles Per Fraction, CT205 5 $295 Same Day $590 ITEM 9.12.

ATTACHMENT 2

Page 499 of 654 ends

February 2026 Page 2 of 5 www.engeo.com

SPECIFICATION

STANDARD

TURNAROUND
(BUSINESS
DAYS) *

STANDARD
PRICING*
RUSH

TURNAROUND
(BUSINESS
DAYS)*
RUSH
PRICING*
9110 Percent Flat or Elongated Particles, ASTM D4791, CT 235 5 $295 Same Day $590 8980 Soil pH, percent Lime for Stabilization, ASTM D6276 (Eades and Grimm) 5 $465 Next Day $930 8870 Soil pH, ASTM D4972, CT 643 5 $165 Same Day $330
8190 Plasticity Index, Dry Method - ASTM D4318 5 $318 Next Day $636 8191 Plasticity Index, Wet Method - ASTM D4318 (ASTM Default method) 5 $310 Next Day $620 8192 Plasticity Index, Lime/Cement Treated - ASTM D4318) 5 $345 Next Day $690 8510 Rock Core Unconfined Compressive Strength, ASTM D7012, Method C 5 $345 Same Day $690 8970 R-Value – Lime/Cement Treated, ASTM D2844 CT301 6 $735 3 $1,470 8290 R-Value, ASTM 2844, CT301 6 $720 3 $1,440
8281 Sand Cone Sand Calibration (50 pounds), ASTM D1556 5 $390 3 $780 8280 Sand Equivalent, CT 217, ASTM D2419 5 $295 Next Day $590 8261 Dry Sieve, ASTM D1140, C117 5 $195 Next Day $390
8262 #200 Wash, ASTM D1140, C117 5 $160 Next Day $320
8263 Sieve & #200 Wash, D6913, C136, CT202
(up to one 5-gal. bucket or 50 lbs) 5 $235 Next Day $470 8264 Sieve & Hydrometer, ASTM D422, D7928 5 $420 2 $840 8253 Specific Gravity, ASTM D854 5 $250 Next Day $500
8250 Specific Gravity Combined (ASTM C127 and (ASTM C128 or ASTM D854) one coarse fraction) 5 $490 Next Day $980
8251 Specific Gravity, ASTM C127 5 $185 Per
Size Fraction Next Day $370 Per
Size Fraction
8252 Specific Gravity, ASTM C128 5 $285 Per
Size Fraction Next Day $570 Per
Size Fraction
8660 Specimen Remolding and/or Lab Mixing (per specimen) Varies $185 Dependent
on type of
remolding
$370
8240 California Bearing Ratio (CBR), ASTM D1883 4 $780 Dependent on soil type $1,560
9070 Sulfate Soundness, CT 214, ASTM C88 6 $585/
Fraction
Dependent
on number
of fractions
$1,170/
Fraction
8111 Sulfate Testing in Soils ASTM C1580 5 $256 Next Day $512 8490 Swell Test A, per point ASTM D4546 - 2004 5 $390 4 $780 8500 Swell Test B, per point ASTM D4546 - 2004 5 $410 4 $820 8501 Swell Test C, per point ASTM D4546 - 2004 5 $410 4 $820 8491 Swell/Collapse Test A, per point ASTM D4546 8 $410 4 $820 8503 Swell/Collapse Test B, per point ASTM D4546 5 $410 Dependent
on material
behavior
$410
8502 Swell/Collapse Test C, per point ASTM D4546 5 $410 Dependent
on material
behavior
$820
8170 Soil Cement – Wet/Dry Durability, ASTM D559 Varies $1,250 N/A $2,500 8350 Isotropic Triaxial Compression – CU, Single Specimen, Multistage Test ASTM D4767 - Modified Varies $1,050/
Stage
Dependent
on number
of stages /
material type
$2,100/
Stage
8344 Triaxial CU Testing, SHANSEP Procedure (per point) USACE Varies $200 Varies $400 8340 Isotropic Triaxial Compression – CU (1 point ) ASTM D4767, USACE 5 $630 4 $1,260 8341 Isotropic Triaxial Compression – CU (2 points) ASTM D4767, USACE 9 $1,210 8 $2,420 8342 Isotropic Triaxial Compression – CU (3 points) ASTM D4767, USACE 14 $1,875 12 $3,750 8343 Isotropic Triaxial Compression – CU (4 points) ASTM D4767, USACE 18 $2,350 15 $4,700 8330 Isotropic Triaxial Compression – UU (per point) ASTM D2850, USACE 5 $295 Next Day $590 ITEM 9.12.

ATTACHMENT 2

Page 500 of 654 ends

February 2026 Page 3 of 5 www.engeo.com

SPECIFICATION

STANDARD

TURNAROUND
(BUSINESS
DAYS) *

STANDARD
PRICING*
RUSH

TURNAROUND
(BUSINESS
DAYS)*
RUSH
PRICING*
8180 Unconfined Compression - Soils, ASTM D2166 5 $195 Next Day $390 8181 Unconfined Compression, Lime/Cement-Treated Soil ASTM D5102/D1633 18 $395 9 $790
8182 Unconfined Compression, Lime/Cement-Treated Soil CTM 373 18 $1,170 9 $2,340 8178 Unconfined Compression, Lime/Cement Slurry 18 $212 9 $424 8183 Unconfined Compression, Lime/Cement -Treated Soil, Additional points 18 $100 9 $200 8179 Unconfined Compressive Strength Testing, Soil-Cement-Bentonite Slurry (field sample), ASTM D1633
Dependent on
the specified
break schedule
$235
Dependent on
the specified
break schedule
$470
8091 Unit Weight (does not include voids) ASTM C29 5 $195 3 $390 8092 Unit Weight and Voids of Coarse Aggregate (Oven Dry, SSD), ASTM C29, C127
5 $345 3 $690
8093 Unit Weight and Voids of Fine Aggregate (Oven Dry, SSD), ASTM C29, C128
5 $390 3 $780
8094 Unit Weight and Voids of Mixed Aggregates (Oven Dry, SSD), ASTM C29, C127, C128
5 $685 3 $1.370
8661 LA Abrasion (Rattler), ASTM C131, CT 211 4 $300 2 $600

CONCRETE
9220 Absorption, ASTM C642 6 $475 Next Day $950
9013 Shotcrete, Field cores (cored in the field), per core, ASTM C1140 5 $148 2 $296 9014 Shotcrete, 1 core, ASTM C1140 5 $190 2 $380
9320 Compression Test, per 6” x 12” cylinder, ASTM C39 5 $70 Same Day $140 9330 Compression Test, per 4” x 8” cylinder ASTM C39 5 $60 Same Day $120 9941 Flexural Strength of Concrete Beams (4”x4”x14”) ASTM C78 5 $200 Same Day $400 9940 Flexural Strength of Concrete Beams (6”x6”x21”) ASTM C78 5 $205 Same Day $410 9340 Compressive Strength of Lightweight Insulating Concrete (ASTM C495) 5 $196 3 $392 9020 Core Trimming, In Laboratory 5 $98 Same Day $196
9950 Thickness of Drilled Concrete Cores, ASTM C174 5 $98 Same Day $196 9060 Laboratory Trial Batch, ASTM C192, Including Test Cylinders 5 $1,170 Same Day $2,340 9080 Length Change (3 bars, 4 readings, up to 90 days), ASTM C157 modified 28-90 $610 28-90 $1,220 9050 Slab Moisture Determination Test Kit 5 $49 Next Day $98 9000 Unit Weight of Lightweight Concrete Cylinders (ASTM C495) 5 $110 Next Day $220

MORTAR & GROUT
9250 Compression Test 2” Mortar Cubes, ASTM C109 5 $100 Next Day $200 9240 Compression, Grout Prisms, ASTM C1019 5 $135 Next Day $270 9230 Compression, Mortar Cylinder, ASTM C39 5 $115 Next Day $230 9425 Grout Compression Conversion Factor for Alternative Method of Forming Test Specimens. (Typically, 20 breaks done at an age of 28 days) 30 $2,600 N/A N/A ASPHALTIC CONCRETE*
8010 AC Correction Factor, ASTM D6307, CT 382 N/A N/A N/A $780 8022 Aggregate Gradation Correction Factor (In conjunction with AC Correction Factor which is billed separately), AASHTO T308 (Annex A), ASTM D6307 N/A N/A N/A $1,350 8021 Aggregate Gradation Correction Factor, AASHTO T308(Annex A), ASTM D6307 N/A N/A N/A $2,250
8020 RAP Aggregate Gradation Correlation Factor, Caltrans LP-9 N/A N/A N/A $3,000 9071 Soundness of Aggregate by Freeze-Thaw (Setup), AASHTO T103 5 $400 3 $800 9072 Soundness of Aggregate by Freeze-Thaw, (per cycle), AASHTO T103 1 $100 1 $200 9073 Soundness of Aggregate by Sodium Sulfate (Setup), AASHTO T104 ASTM C88, CT214 5 $400 3 $800
9074 Soundness of Aggregate by Sodium Sulfate, (per cycle), AASHTO T104 ASTM C88, CT214 1 $100 1 $200
ITEM 9.12.

ATTACHMENT 2

Page 501 of 654 ends

February 2026 Page 4 of 5 www.engeo.com

SPECIFICATION

STANDARD

TURNAROUND
(BUSINESS
DAYS) *

STANDARD
PRICING*
RUSH

TURNAROUND
(BUSINESS
DAYS)*
RUSH
PRICING*
8265 Sieve & #200 Wash (Gradations on HMA extracted aggregates) AASHTO T30, ASTM D5444 N/A N/A N/A $450
8070 AC Maximum Density (Avg. of 3 Briquettes) D1188, CT308 N/A N/A N/A $655 8071 AC Maximum Density (Avg. of 3 Briquettes) D1188, CT 308 (S-Value is performed prior to LTMD) N/A N/A N/A $585
8080 AC Maximum Density by Superpave Gyratory Compactor (Avg. of 3 Briquettes) AASHTO T312, ASTM D6925 N/A N/A N/A $750
8090 AC Maximum Theoretical Unit Weight ASTM D2041, CT 309 (Rice Specific Gravity) N/A N/A N/A $485
9460 Asphalt Core Density (4” Core), ASTM D1188, ASTM 2726, CT308 N/A N/A N/A $145 9461 Asphalt Core Density (6” Core), ASTM D1188, ASTM 2726, CT 308 N/A N/A N/A $165 9462 Thickness of Asphalt Cores, CT 308 N/A N/A 2 $100
8532 Extraction by Centrifuge ASTM 2172 N/A N/A N/A $550 8531 Extraction by Ignition Oven, ASTM D6307, CT 382 N/A N/A N/A $450 8533 Extraction by Reflux Extractor, ASTM D2172 – Method B N/A N/A N/A $895 8050 Stability Test (Avg. of 3 Briquettes), ASTM D1560, CT 366, (w/o Max. Density test) N/A N/A N/A $900
8060 Marshall Stability and Flow of Bituminous Mixtures, ASTM D6927 5 N/A 3 $780

VOLUMETRIC PROPERTIES OF HMA
9660 Absorbed Asphalt Binder CT 367 N/A N/A N/A $210
9600 Air Void Content N/A N/A N/A $210
9670 Bulk Specific Gravity – Admixture Blend CT 367 N/A N/A N/A $210 9640 Dust Proportions, CT 367, Caltrans LP-4 N/A N/A N/A $210 9680 Effective Asphalt Binder of Volume, CT 367 N/A N/A N/A $210 9690 Effective Binder Content, CT 367 N/A N/A N/A $210
9580 Effective Specific Gravity of Aggregate-Admixture Blend, CT 367 N/A N/A N/A $210

9620 Void Filled With Asphalt CT 367, LP-3 N/A N/A N/A $210 9610 Voids in Mineral Aggregate CT 367, LP-2 N/A N/A N/A $210 Note: Lab fees for volumetric properties of HMA per CT 367 are based on tests CT 202, CT 308, CT 309, and CT 382 have been completed.

FIREPROOFING
9990 Oven Dry Density, Fireproofing, per sample 5 $150 Next Day $300

SAMPLE STORAGE
10000 Sample Storage per month/per cubic yard Per month $158 N/A N/A

• *Rush turnaround times are calculated based on the average minimum time required to complete the test and remain compliant with the applicable test standard.
• *Rush turnaround time prioritizes rush testing over other requested testing and dedicates a technician to complete the rush testing as quickly as possible. Rush turnaround times are estimates only and do not guarantee test completion within the estimated rush testing timeframe.
• *Test turnaround time is the amount of time required to perform the test once started. Test start times are dependent on availa ble labor and equipment. Please contact Lab Services at [email protected] to determine equipment capacity and availability. Tur naround times are estimates only and do not guarantee test completion within the estimated testing timeframe. • *The testing fees and test durations listed reflect the standard business hours required to perform the test. Samples requiring premium handling will incur additional hourly personnel charges in accordance with the Laboratory Technician Rate presented on our Fee Schedule. • *For HMA testing, only rush pricing is provided because all HMA testing is expedited on a rush basis. When HMA testing is requested, all other testing is secondary due to the timeliness needed for the HMA results. • Add three days to the estimated test duration for soil testing that requires remolded specimens. • The above fees are reviewed annually and are subject to change. Additional tests are available upon request. • Prices exclude field collection and transportation to the laboratory. • Supplemental fees for laboratory preparation of specimens are charged on an hourly basis.

ITEM 9.12.

ATTACHMENT 2

Page 502 of 654 ends

February 2026 Page 5 of 5 www.engeo.com
• Where tests are to be run on an immediate need basis (tests to be initiated out of order received and regardless of status of other previously received samples), the expediting fee is 100% of the listed unit rate. • There is a 3:00 pm cut-off time for sample delivery/test start time. • Turnaround times are based on samples delivered to the laboratory before 3:00 pm. Turnaround time on samples received after 3:00 pm will begin at 7:00 am the following business day.
• Concrete/masonry compression breaks requested prior to the scheduled break date and/or prior to 7:00 am will be considered rush testing requests and billed a rush fee.
• Witness testing will be billed at $150.00/hour per individual witness. • There is a 100% increase in fees per test for testing contaminated samples. • Disposal charges for contaminated samples will be billed to the project on a time-and-expense basis. • All project required weekend work is billed directly to the project with a 2-hour minimum charge. • Samples requiring premium handling, such as searching for testable portions (Shelby, D&M tubes, etc.), will be billed on a time-and-expense basis to the project.

ITEM 9.12.

ATTACHMENT 2

Page 503 of 654 ends

Sample Only - Required Cost Proposal Template To Be Determined By Agency Note: Mark-ups are Not Allowed
Consultant Subconsultant
Project No. Contract No. Date 4/15/2026
For Combined Rate Fringe % Overhead % G&A %

66.82% 91.47%
For Home Office Rate Fringe % Overhead % G&A %
For Field Office Rate Fringe % Overhead % G&A %
Actual or Avg.

Straight3 OT(1.5x) OT(2x) From To Hourly Rate4 Principal Engineer/Surveyor II $328.22 $328.22 $328.22 1/1/2026 12/31/2026 $110.50 $101.50 $119.50 Exempt $344.63 $344.63 $344.63 1/1/2027 12/31/2027 $116.03 5.0% $106.58 $125.48 $361.86 $361.86 $361.86 1/1/2028 12/31/2028 $121.83 5.0% $111.90 $131.75 $379.96 $379.96 $379.96 1/1/2029 12/31/2029 $127.92 5.0% $117.50 $138.34 $398.96 $398.96 $398.96 1/1/2030 12/31/2030 $134.31 5.0% $123.37 $145.25 Principal Engineer/Surveyor I $290.35 $290.35 $290.35 1/1/2026 12/31/2026 $97.75 $89.00 $106.50 Exempt $304.87 $304.87 $304.87 1/1/2027 12/31/2027 $102.64 5.0% $93.45 $111.83 $320.11 $320.11 $320.11 1/1/2028 12/31/2028 $107.77 5.0% $98.12 $117.42 $336.12 $336.12 $336.12 1/1/2029 12/31/2029 $113.16 5.0% $103.03 $123.29 $352.92 $352.92 $352.92 1/1/2030 12/31/2030 $118.82 5.0% $108.18 $129.45

0.00%

0.00%
Local Assistance Procedures Manual
OR
+ + = Field Office ICR %
SAMPLE COST PROPOSAL 2
SAMPLE COST PROPOSAL 2 Page 1 of 3
R.E.Y. Engineers, Inc. Prime Consultant 2nd Tier Subconsultant Participation Amount

BILLING INFORMATION CALCULATION INFORMATION
15%

5.0%
Hourly Billing Rates2 Effective Date of Hourly Rate Hourly Range - for Classifications Only
% or $
Increase

SPECIFIC RATE OF COMPENSATION (USE FOR ON-CALL OR AS-NEEDED CONTRACTS) (CONSTRUCTION ENGINEERING AND INSPECTION CONTRACTS)
Fee =
% Increase =
158.29%
Combined ICR %+ + =
+ + = Home Office ICR %
Name/Job Title/Classification1
x

Page 1 of 12 ends

January 2018
ITEM 9.12.

ATTACHMENT 2

Page 504 of 654 ends

Actual or Avg.

Straight3 OT(1.5x) OT(2x) From To Hourly Rate4 Hourly Billing Rates2 Effective Date of Hourly Rate Hourly Range - for Classifications Only
% or $
IncreaseName/Job Title/Classification1
Senior Engineer/Surveyor V $273.72 $273.72 $273.72 1/1/2026 12/31/2026 $92.15 $86.80 $97.50 Exempt $287.40 $287.40 $287.40 1/1/2027 12/31/2027 $96.76 5.0% $91.14 $102.38 $301.77 $301.77 $301.77 1/1/2028 12/31/2028 $101.60 5.0% $95.70 $107.49 $316.86 $316.86 $316.86 1/1/2029 12/31/2029 $106.68 5.0% $100.48 $112.87 $332.70 $332.70 $332.70 1/1/2030 12/31/2030 $112.01 5.0% $105.51 $118.51 Senior Engineer/Surveyor IV $254.85 $254.85 $254.85 1/1/2026 12/31/2026 $85.80 $80.60 $91.00 Exempt $267.60 $267.60 $267.60 1/1/2027 12/31/2027 $90.09 5.0% $84.63 $95.55 $280.98 $280.98 $280.98 1/1/2028 12/31/2028 $94.59 5.0% $88.86 $100.33 $295.03 $295.03 $295.03 1/1/2029 12/31/2029 $99.32 5.0% $93.30 $105.34 $309.78 $309.78 $309.78 1/1/2030 12/31/2030 $104.29 5.0% $97.97 $110.61 Senior Engineer/Surveyor III $235.99 $235.99 $235.99 1/1/2026 12/31/2026 $79.45 $74.40 $84.50 Exempt $247.79 $247.79 $247.79 1/1/2027 12/31/2027 $83.42 5.0% $78.12 $88.73 $260.18 $260.18 $260.18 1/1/2028 12/31/2028 $87.59 5.0% $82.03 $93.16 $273.19 $273.19 $273.19 1/1/2029 12/31/2029 $91.97 5.0% $86.13 $97.82 $286.85 $286.85 $286.85 1/1/2030 12/31/2030 $96.57 5.0% $90.43 $102.71 Senior Engineer/Surveyor II $217.13 $217.13 $217.13 1/1/2026 12/31/2026 $73.10 $68.20 $78.00 Exempt $227.99 $227.99 $227.99 1/1/2027 12/31/2027 $76.76 5.0% $71.61 $81.90 $239.39 $239.39 $239.39 1/1/2028 12/31/2028 $80.59 5.0% $75.19 $86.00 $251.36 $251.36 $251.36 1/1/2029 12/31/2029 $84.62 5.0% $78.95 $90.29 $263.92 $263.92 $263.92 1/1/2030 12/31/2030 $88.85 5.0% $82.90 $94.81 Senior Engineer/Surveyor I $198.27 $198.27 $198.27 1/1/2026 12/31/2026 $66.75 $62.00 $71.50 Exempt $208.18 $208.18 $208.18 1/1/2027 12/31/2027 $70.09 5.0% $65.10 $75.08 $218.59 $218.59 $218.59 1/1/2028 12/31/2028 $73.59 5.0% $68.36 $78.83 $229.52 $229.52 $229.52 1/1/2029 12/31/2029 $77.27 5.0% $71.77 $82.77 $241.00 $241.00 $241.00 1/1/2030 12/31/2030 $81.14 5.0% $75.36 $86.91 Associate Engineer/Surveyor V $196.34 $196.34 $196.34 1/1/2026 12/31/2026 $66.10 $62.20 $70.00 Exempt $206.16 $206.16 $206.16 1/1/2027 12/31/2027 $69.41 5.0% $65.31 $73.50 $216.46 $216.46 $216.46 1/1/2028 12/31/2028 $72.88 5.0% $68.58 $77.18 $227.29 $227.29 $227.29 1/1/2029 12/31/2029 $76.52 5.0% $72.00 $81.03 $238.65 $238.65 $238.65 1/1/2030 12/31/2030 $80.34 5.0% $75.60 $85.09

Page 2 of 12 ends

January 2018
ITEM 9.12.

ATTACHMENT 2

Page 505 of 654 ends

Actual or Avg.

Straight3 OT(1.5x) OT(2x) From To Hourly Rate4 Hourly Billing Rates2 Effective Date of Hourly Rate Hourly Range - for Classifications Only
% or $
IncreaseName/Job Title/Classification1
Associate Engineer/Surveyor IV $181.78 $181.78 $181.78 1/1/2026 12/31/2026 $61.20 $57.40 $65.00 Exempt $190.87 $190.87 $190.87 1/1/2027 12/31/2027 $64.26 5.0% $60.27 $68.25 $200.42 $200.42 $200.42 1/1/2028 12/31/2028 $67.47 5.0% $63.28 $71.66 $210.44 $210.44 $210.44 1/1/2029 12/31/2029 $70.85 5.0% $66.45 $75.25 $220.96 $220.96 $220.96 1/1/2030 12/31/2030 $74.39 5.0% $69.77 $79.01 Associate Engineer/Surveyor III $167.23 $167.23 $167.23 1/1/2026 12/31/2026 $56.30 $52.60 $60.00 Exempt $175.59 $175.59 $175.59 1/1/2027 12/31/2027 $59.12 5.0% $55.23 $63.00 $184.37 $184.37 $184.37 1/1/2028 12/31/2028 $62.07 5.0% $57.99 $66.15 $193.59 $193.59 $193.59 1/1/2029 12/31/2029 $65.17 5.0% $60.89 $69.46 $203.27 $203.27 $203.27 1/1/2030 12/31/2030 $68.43 5.0% $63.94 $72.93 Associate Engineer/Surveyor II $152.68 $152.68 $152.68 1/1/2026 12/31/2026 $51.40 $47.80 $55.00 Exempt $160.31 $160.31 $160.31 1/1/2027 12/31/2027 $53.97 5.0% $50.19 $57.75 $168.32 $168.32 $168.32 1/1/2028 12/31/2028 $56.67 5.0% $52.70 $60.64 $176.74 $176.74 $176.74 1/1/2029 12/31/2029 $59.50 5.0% $55.33 $63.67 $185.58 $185.58 $185.58 1/1/2030 12/31/2030 $62.48 5.0% $58.10 $66.85 Associate Engineer/Surveyor I $138.12 $138.12 $138.12 1/1/2026 12/31/2026 $46.50 $43.00 $50.00 Exempt $145.03 $145.03 $145.03 1/1/2027 12/31/2027 $48.83 5.0% $45.15 $52.50 $152.28 $152.28 $152.28 1/1/2028 12/31/2028 $51.27 5.0% $47.41 $55.13 $159.89 $159.89 $159.89 1/1/2029 12/31/2029 $53.83 5.0% $49.78 $57.88 $167.89 $167.89 $167.89 1/1/2030 12/31/2030 $56.52 5.0% $52.27 $60.78 Assistant Engineer/Surveyor VII $188.08 $188.08 $188.08 1/1/2026 12/31/2026 $63.32 $59.64 $67.00 Exempt $197.49 $197.49 $197.49 1/1/2027 12/31/2027 $66.49 5.0% $62.62 $70.35 $207.36 $207.36 $207.36 1/1/2028 12/31/2028 $69.81 5.0% $65.75 $73.87 $217.73 $217.73 $217.73 1/1/2029 12/31/2029 $73.30 5.0% $69.04 $77.56 $228.61 $228.61 $228.61 1/1/2030 12/31/2030 $76.97 5.0% $72.49 $81.44 Assistant Engineer/Surveyor VI $174.94 $174.94 $174.94 1/1/2026 12/31/2026 $58.90 $55.29 $62.50 Exempt $183.68 $183.68 $183.68 1/1/2027 12/31/2027 $61.84 5.0% $58.05 $65.63 $192.87 $192.87 $192.87 1/1/2028 12/31/2028 $64.93 5.0% $60.96 $68.91 $202.51 $202.51 $202.51 1/1/2029 12/31/2029 $68.18 5.0% $64.01 $72.35 $212.64 $212.64 $212.64 1/1/2030 12/31/2030 $71.59 5.0% $67.21 $75.97 Assistant Engineer/Surveyor V $161.78 $161.78 $161.78 1/1/2026 12/31/2026 $54.47 $50.93 $58.00 Exempt $169.87 $169.87 $169.87 1/1/2027 12/31/2027 $57.19 5.0% $53.48 $60.90 $178.36 $178.36 $178.36 1/1/2028 12/31/2028 $60.05 5.0% $56.15 $63.95 $187.28 $187.28 $187.28 1/1/2029 12/31/2029 $63.05 5.0% $58.96 $67.14 $196.64 $196.64 $196.64 1/1/2030 12/31/2030 $66.20 5.0% $61.91 $70.50 Assistant Engineer/Surveyor V $161.78 $189.01 $216.24 1/1/2026 12/31/2026 $54.47 $50.93 $58.00 Non-Exempt $169.87 $198.46 $227.06 1/1/2027 12/31/2027 $57.19 5.0% $53.48 $60.90 $178.36 $208.39 $238.41 1/1/2028 12/31/2028 $60.05 5.0% $56.15 $63.95 $187.28 $218.80 $250.33 1/1/2029 12/31/2029 $63.05 5.0% $58.96 $67.14

Page 3 of 12 ends

January 2018
ITEM 9.12.

ATTACHMENT 2

Page 506 of 654 ends

Actual or Avg.

Page 4 of 12 ends

January 2018
ITEM 9.12.

ATTACHMENT 2

Page 507 of 654 ends

Actual or Avg.

Straight3 OT(1.5x) OT(2x) From To Hourly Rate4 Hourly Billing Rates2 Effective Date of Hourly Rate Hourly Range - for Classifications Only
% or $
IncreaseName/Job Title/Classification1
Assistant Engineer/Surveyor IV $147.88 $147.88 $147.88 1/1/2026 12/31/2026 $49.79 $46.57 $53.00 Exempt $155.27 $155.27 $155.27 1/1/2027 12/31/2027 $52.27 5.0% $48.90 $55.65 $163.04 $163.04 $163.04 1/1/2028 12/31/2028 $54.89 5.0% $51.34 $58.43 $171.19 $171.19 $171.19 1/1/2029 12/31/2029 $57.63 5.0% $53.91 $61.35 $179.75 $179.75 $179.75 1/1/2030 12/31/2030 $60.51 5.0% $56.61 $64.42 Assistant Engineer/Surveyor IV $147.88 $172.77 $197.66 1/1/2026 12/31/2026 $49.79 $46.57 $53.00 Non-Exempt $155.27 $181.41 $207.55 1/1/2027 12/31/2027 $52.27 5.0% $48.90 $55.65 $163.04 $190.48 $217.92 1/1/2028 12/31/2028 $54.89 5.0% $51.34 $58.43 $171.19 $200.00 $228.82 1/1/2029 12/31/2029 $57.63 5.0% $53.91 $61.35 $179.75 $210.00 $240.26 1/1/2030 12/31/2030 $60.51 5.0% $56.61 $64.42 Assistant Engineer/Surveyor III $134.72 $157.40 $180.07 1/1/2026 12/31/2026 $45.36 $42.21 $48.50 Non-Exempt $141.46 $165.27 $189.08 1/1/2027 12/31/2027 $47.62 5.0% $44.32 $50.93 $148.53 $173.53 $198.53 1/1/2028 12/31/2028 $50.00 5.0% $46.54 $53.47 $155.95 $182.21 $208.46 1/1/2029 12/31/2029 $52.50 5.0% $48.86 $56.14 $163.75 $191.32 $218.88 1/1/2030 12/31/2030 $55.13 5.0% $51.31 $58.95 Assistant Engineer/Surveyor II $121.58 $142.04 $162.51 1/1/2026 12/31/2026 $40.93 $37.86 $44.00 Non-Exempt $127.65 $149.14 $170.63 1/1/2027 12/31/2027 $42.98 5.0% $39.75 $46.20 $134.04 $156.60 $179.16 1/1/2028 12/31/2028 $45.13 5.0% $41.74 $48.51 $140.74 $164.43 $188.12 1/1/2029 12/31/2029 $47.38 5.0% $43.83 $50.94 $147.78 $172.65 $197.53 1/1/2030 12/31/2030 $49.75 5.0% $46.02 $53.48 Assistant Engineer/Surveyor I $108.42 $126.67 $144.92 1/1/2026 12/31/2026 $36.50 $33.50 $39.50 Non-Exempt $113.84 $133.00 $152.16 1/1/2027 12/31/2027 $38.33 5.0% $35.18 $41.48 $119.53 $139.65 $159.77 1/1/2028 12/31/2028 $40.24 5.0% $36.93 $43.55 $125.51 $146.63 $167.76 1/1/2029 12/31/2029 $42.25 5.0% $38.78 $45.73 $131.78 $153.96 $176.15 1/1/2030 12/31/2030 $44.37 5.0% $40.72 $48.01 Senior LiDAR Specialist II $219.06 $219.06 $219.06 1/1/2026 12/31/2026 $73.75 $68.00 $79.50 Exempt $230.02 $230.02 $230.02 1/1/2027 12/31/2027 $77.44 5.0% $71.40 $83.48 $241.52 $241.52 $241.52 1/1/2028 12/31/2028 $81.31 5.0% $74.97 $87.65 $253.59 $253.59 $253.59 1/1/2029 12/31/2029 $85.37 5.0% $78.72 $92.03 $266.27 $266.27 $266.27 1/1/2030 12/31/2030 $89.64 5.0% $82.65 $96.63

Page 5 of 12 ends

January 2018
ITEM 9.12.

ATTACHMENT 2

Page 508 of 654 ends

Actual or Avg.

Straight3 OT(1.5x) OT(2x) From To Hourly Rate4 Hourly Billing Rates2 Effective Date of Hourly Rate Hourly Range - for Classifications Only
% or $
IncreaseName/Job Title/Classification1
Senior LiDAR Specialist I $194.56 $194.56 $194.56 1/1/2026 12/31/2026 $65.50 $60.00 $71.00 Exempt $204.28 $204.28 $204.28 1/1/2027 12/31/2027 $68.78 5.0% $63.00 $74.55 $214.50 $214.50 $214.50 1/1/2028 12/31/2028 $72.21 5.0% $66.15 $78.28 $225.22 $225.22 $225.22 1/1/2029 12/31/2029 $75.82 5.0% $69.46 $82.19 $236.49 $236.49 $236.49 1/1/2030 12/31/2030 $79.62 5.0% $72.93 $86.30 LiDAR Technician III $187.38 $187.38 $187.38 1/1/2026 12/31/2026 $63.09 $58.17 $68.00 Exempt $196.75 $196.75 $196.75 1/1/2027 12/31/2027 $66.24 5.0% $61.08 $71.40 $206.59 $206.59 $206.59 1/1/2028 12/31/2028 $69.55 5.0% $64.13 $74.97 $216.92 $216.92 $216.92 1/1/2029 12/31/2029 $73.03 5.0% $67.34 $78.72 $227.77 $227.77 $227.77 1/1/2030 12/31/2030 $76.68 5.0% $70.71 $82.65 LiDAR Technician II $166.83 $166.83 $166.83 1/1/2026 12/31/2026 $56.17 $51.33 $61.00 Exempt $175.17 $175.17 $175.17 1/1/2027 12/31/2027 $58.97 5.0% $53.90 $64.05 $183.93 $183.93 $183.93 1/1/2028 12/31/2028 $61.92 5.0% $56.59 $67.25 $193.13 $193.13 $193.13 1/1/2029 12/31/2029 $65.02 5.0% $59.42 $70.62 $202.78 $202.78 $202.78 1/1/2030 12/31/2030 $68.27 5.0% $62.39 $74.15 LiDAR Technician I $145.55 $170.05 $194.55 1/1/2026 12/31/2026 $49.00 $44.50 $53.50 Non-Exempt $152.82 $178.55 $204.27 1/1/2027 12/31/2027 $51.45 5.0% $46.73 $56.18 $160.46 $187.48 $214.49 1/1/2028 12/31/2028 $54.02 5.0% $49.06 $58.98 $168.49 $196.85 $225.21 1/1/2029 12/31/2029 $56.72 5.0% $51.51 $61.93 $176.91 $206.69 $236.47 1/1/2030 12/31/2030 $59.56 5.0% $54.09 $65.03 GIS Manager $164.85 $164.85 $164.85 1/1/2026 12/31/2026 $55.50 $50.50 $60.50 Exempt $173.10 $173.10 $173.10 1/1/2027 12/31/2027 $58.28 5.0% $53.03 $63.53 $181.75 $181.75 $181.75 1/1/2028 12/31/2028 $61.19 5.0% $55.68 $66.70 $190.84 $190.84 $190.84 1/1/2029 12/31/2029 $64.25 5.0% $58.46 $70.04 $200.38 $200.38 $200.38 1/1/2030 12/31/2030 $67.46 5.0% $61.38 $73.54 GIS Analyst $142.58 $142.58 $142.58 1/1/2026 12/31/2026 $48.00 $43.00 $53.00 Exempt $149.70 $149.70 $149.70 1/1/2027 12/31/2027 $50.40 5.0% $45.15 $55.65 $157.19 $157.19 $157.19 1/1/2028 12/31/2028 $52.92 5.0% $47.41 $58.43 $165.05 $165.05 $165.05 1/1/2029 12/31/2029 $55.57 5.0% $49.78 $61.35 $173.30 $173.30 $173.30 1/1/2030 12/31/2030 $58.34 5.0% $52.27 $64.42 GIS Analyst $142.58 $166.58 $190.58 1/1/2026 12/31/2026 $48.00 $43.00 $53.00 Non-Exempt $149.70 $174.90 $200.10 1/1/2027 12/31/2027 $50.40 5.0% $45.15 $55.65 $157.19 $183.65 $210.11 1/1/2028 12/31/2028 $52.92 5.0% $47.41 $58.43 $165.05 $192.83 $220.62 1/1/2029 12/31/2029 $55.57 5.0% $49.78 $61.35 $173.30 $202.47 $231.65 1/1/2030 12/31/2030 $58.34 5.0% $52.27 $64.42 Senior Technician III $173.76 $173.76 $173.76 1/1/2026 12/31/2026 $58.50 $54.00 $63.00 Exempt $182.45 $182.45 $182.45 1/1/2027 12/31/2027 $61.43 5.0% $56.70 $66.15 $191.58 $191.58 $191.58 1/1/2028 12/31/2028 $64.50 5.0% $59.54 $69.46 $201.15 $201.15 $201.15 1/1/2029 12/31/2029 $67.72 5.0% $62.51 $72.93

Page 6 of 12 ends

January 2018
ITEM 9.12.

ATTACHMENT 2

Page 509 of 654 ends

Actual or Avg.

Straight3 OT(1.5x) OT(2x) From To Hourly Rate4 Hourly Billing Rates2 Effective Date of Hourly Rate Hourly Range - for Classifications Only
% or $
IncreaseName/Job Title/Classification1
$211.21 $211.21 $211.21 1/1/2030 12/31/2030 $71.11 5.0% $65.64 $76.58 Senior Technician II $155.20 $155.20 $155.20 1/1/2026 12/31/2026 $52.25 $48.00 $56.50 Exempt $162.96 $162.96 $162.96 1/1/2027 12/31/2027 $54.86 5.0% $50.40 $59.33 $171.11 $171.11 $171.11 1/1/2028 12/31/2028 $57.61 5.0% $52.92 $62.29 $179.66 $179.66 $179.66 1/1/2029 12/31/2029 $60.49 5.0% $55.57 $65.41 $188.65 $188.65 $188.65 1/1/2030 12/31/2030 $63.51 5.0% $58.34 $68.68

Page 7 of 12 ends

January 2018
ITEM 9.12.

ATTACHMENT 2

Page 510 of 654 ends

Actual or Avg.

Straight3 OT(1.5x) OT(2x) From To Hourly Rate4 Hourly Billing Rates2 Effective Date of Hourly Rate Hourly Range - for Classifications Only
% or $
IncreaseName/Job Title/Classification1
Senior Technician I $136.64 $136.64 $136.64 1/1/2026 12/31/2026 $46.00 $42.00 $50.00 Exempt $143.47 $143.47 $143.47 1/1/2027 12/31/2027 $48.30 5.0% $44.10 $52.50 $150.64 $150.64 $150.64 1/1/2028 12/31/2028 $50.72 5.0% $46.31 $55.13 $158.17 $158.17 $158.17 1/1/2029 12/31/2029 $53.25 5.0% $48.62 $57.88 $166.08 $166.08 $166.08 1/1/2030 12/31/2030 $55.91 5.0% $51.05 $60.78 Technician III $130.69 $152.69 $174.69 1/1/2026 12/31/2026 $44.00 $40.00 $48.00 Non-Exempt $137.23 $160.33 $183.43 1/1/2027 12/31/2027 $46.20 5.0% $42.00 $50.40 $144.09 $168.35 $192.60 1/1/2028 12/31/2028 $48.51 5.0% $44.10 $52.92 $151.30 $176.76 $202.23 1/1/2029 12/31/2029 $50.94 5.0% $46.31 $55.57 $158.86 $185.60 $212.34 1/1/2030 12/31/2030 $53.48 5.0% $48.62 $58.34 Technician II $112.87 $131.87 $150.87 1/1/2026 12/31/2026 $38.00 $34.00 $42.00 Non-Exempt $118.52 $138.47 $158.42 1/1/2027 12/31/2027 $39.90 5.0% $35.70 $44.10 $124.44 $145.39 $166.34 1/1/2028 12/31/2028 $41.90 5.0% $37.49 $46.31 $130.66 $152.66 $174.65 1/1/2029 12/31/2029 $43.99 5.0% $39.36 $48.62 $137.20 $160.29 $183.39 1/1/2030 12/31/2030 $46.19 5.0% $41.33 $51.05 Technician I $94.31 $110.18 $126.06 1/1/2026 12/31/2026 $31.75 $28.00 $35.50 Non-Exempt $99.02 $115.69 $132.36 1/1/2027 12/31/2027 $33.34 5.0% $29.40 $37.28 $103.97 $121.48 $138.98 1/1/2028 12/31/2028 $35.00 5.0% $30.87 $39.14 $109.17 $127.55 $145.93 1/1/2029 12/31/2029 $36.75 5.0% $32.41 $41.10 $114.63 $133.93 $153.22 1/1/2030 12/31/2030 $38.59 5.0% $34.03 $43.15 Grant Administrator $198.27 $198.27 $198.27 1/1/2026 12/31/2026 $66.75 $60.00 $73.50 Exempt $208.18 $208.18 $208.18 1/1/2027 12/31/2027 $70.09 5.0% $63.00 $77.18 $218.59 $218.59 $218.59 1/1/2028 12/31/2028 $73.59 5.0% $66.15 $81.03 $229.52 $229.52 $229.52 1/1/2029 12/31/2029 $77.27 5.0% $69.46 $85.09 $241.00 $241.00 $241.00 1/1/2030 12/31/2030 $81.14 5.0% $72.93 $89.34 Senior Project Coordinator $181.93 $181.93 $181.93 1/1/2026 12/31/2026 $61.25 $49.00 $73.50 Exempt $191.03 $191.03 $191.03 1/1/2027 12/31/2027 $64.31 5.0% $51.45 $77.18 $200.58 $200.58 $200.58 1/1/2028 12/31/2028 $67.53 5.0% $54.02 $81.03 $210.61 $210.61 $210.61 1/1/2029 12/31/2029 $70.90 5.0% $56.72 $85.09 $221.14 $221.14 $221.14 1/1/2030 12/31/2030 $74.45 5.0% $59.56 $89.34

Page 8 of 12 ends

January 2018
ITEM 9.12.

ATTACHMENT 2

Page 511 of 654 ends

Actual or Avg.

Page 9 of 12 ends

January 2018
ITEM 9.12.

ATTACHMENT 2

Page 512 of 654 ends

Actual or Avg.

Straight3 OT(1.5x) OT(2x) From To Hourly Rate4 Hourly Billing Rates2 Effective Date of Hourly Rate Hourly Range - for Classifications Only
% or $
IncreaseName/Job Title/Classification1
Apprentice - 3rd Period** $128.82 $150.51 $172.19 3/1/2026 2/28/2027 $43.37 $46.14 $46.14 Non-Exempt 3/1/2027 2/29/2028 DIR***
3/1/2028 2/28/2029 DIR***
3/1/2029 2/28/2030 DIR***
Prevailing Wage 3/1/2030 2/28/2031 DIR***
Apprentice - 2nd Period** $113.67 $132.81 $151.94 3/1/2026 2/28/2027 $38.27 $40.71 $40.71 Non-Exempt 3/1/2027 2/29/2028 DIR***
3/1/2028 2/28/2029 DIR***
3/1/2029 2/28/2030 DIR***
Prevailing Wage 3/1/2030 2/28/2031 DIR***
Apprentice - 1st Period** $90.92 $106.23 $121.53 3/1/2026 2/28/2027 $30.61 $32.57 $32.57 Non-Exempt 3/1/2027 2/29/2028 DIR***
3/1/2028 2/28/2029 DIR***
3/1/2029 2/28/2030 DIR***
Prevailing Wage 3/1/2030 2/28/2031 DIR***
NOTES:

3. Billing rate = actual hourly rate * (1+ICR) * (1+Fee). Indirect cost rates shall be updated on an annual basis in accordance with the consultant's annual accounting period and established by a cognized agency or accepted by Caltrans. All costs must comply with the Federal cost principles for reimbursement.

2. The cost proposal format shall not be amended.

1. Key Personnel must be marked wih an asterisk (*) and employees that are subject to prevailing wage requirements must be marked with two asterisks (**). All cots must comply with the Federal cost principles. Subconsultants will provide their own cost proposals.

5. Escalation for personnel subject to prevailing wage (***) shall follow the annual DIR determinations.

4. For named employees and key personnel enter the actual hourly rate. For classifications only, enter the Average Hourly Rate for that classification.

Page 10 of 12 ends

January 2018
ITEM 9.12.

ATTACHMENT 2

Page 513 of 654 ends

Consultant
Project No. Contract No. Date
Subconsultant 1:

Subconsultant 2:

Subconsultant 3:

Subconsultant 4:

Subconsultant 5:

NOTES:

9. The cost proposal format shall not be amended. All costs must comply with the Federal cost principles

3. Items when incurred for the same purpose, in like circumstance, should not be included in any indirect cost pool or in the overhead rate.

4. Items such as special tooling, will be reimbursed at actual cost with supporting documentation (invoice).

5. Items listed above that would be considered "tools of the trade" are not reimbursable as other direct cost.

6. Travel related costs should be pre-approved by the contracting agency and shall not exceed current State Department of Personnel Administration rules.

1. List other direct cost items with estimated costs. These costs should be competitive in their respective industries and supported with appropriate documentation.

2. Proposed ODC items should be consistently billed regardless of client and contract type. -$
-$
Bathymetric Survey Vessel
Plan Sheets (Color)
Plan Sheets (B&W)

1.00$ Sq Ft
Sq Ft 0.50$

SCHEDULE OF OTHER DIRECT COST ITEMS
235.00$
810.00$
815.00$
1,215.00$
Hour
Hour
Flight
Day
Terrestrial LiDAR (TLS) Equipment
Mobile LiDAR (MTLS) Equipment
UAV LiDAR
Local Assistance Procedures Manual SAMPLE COST PROPOSAL 2 Cost Proposal
SAMPLE COST PROPOSAL 2 Page 2 of 3

SPECIFIC RATE OF COMPENSATION (USE FOR ON-CALL OR AS-NEEDED CONTRACTS) (CONSTRUCTION ENGINEERING AND INSPECTION CONTRACTS)
R.E.Y. Engineers, Inc. Prime Consultant Subconsultant 2nd Tier Subconsultant 4/15/2026

10. Add additional pages if necessary.

11. Subconsultants must provide their own cost proposals. -$
-$
-$
-$
-$
-$
TotalUnit CostUnitQuantityDESCRIPTION OF ITEM
x

Page 11 of 12 ends

January 2018
ITEM 9.12.

ATTACHMENT 2

Page 514 of 654 ends

Certification of Direct Costs
1 Generally Accepted Accounting Principles (GAAP)
2 Terms and conditions of the contract
3 Title 23 United States Code Section 112 - Letting of Contracts 4 48 Code of Federal Regulations Part 31 - Contract Cost Principles and Procedures 5 23 Code of Federal Regulations Part 172 - Procurement, Management, and Administration of Engineering and Design Related Services
6 48 Code of Federal Regulations Part 9904 - Cost Accounting Standards Board (when applicable) Prime Consultant or Subconsultant Certifying
Name: Title:

Signature:

Email: Phone Number:

Address:

List services the consultant is providing under this proposed contract:

On-Call Land Surveying Services
4/15/2026
[email protected] 916-366-3040
905 Sutter Street, Suite 200, Folsom, CA 95630
*An individual executive or financial officer of the consultant’s or subconsultant’s organization at a level no lower than a Vice President or a Chief Financial Officer, or equivalent, who has authority to represent the financial information utilized to establish the cost proposal for the contract.

Local Assistance Procedures Manual SAMPLE COST PROPOSAL 2 Cost Proposal
Date of Certification:
(mm/dd/yyy)
SAMPLE COST PROPOSAL 2 Page 3 of 3
I, the undersigned, certify to the best of my knowledge and belief that all direct costs identified on the cost proposal(s) in this contract are actual, reasonable, allowable, and allocable to the contract in accordance with the contract terms and the following requirements:

All costs must be applied consistently and fairly to all contracts. All documentation of compliance must be retained in the project files and be in compliance with applicable federal and state requirements. Costs that are noncompliant with the federal and state requirements are not eligible for reimbursement.

Local governments are responsible for applying only cognizant agency approved or Caltrans accepted Indirect Cost Rate(s).

Jim Fisher, PE, QSD/P President
ITEM 9.12.

ATTACHMENT 2

Page 515 of 654 ends

&HUWL¿FDWLRQRI,QGLUHFW&RVWVDQG)LQDQFLDO0DQDJHPHQW6\VWHP,QGHSHQGHQW2I¿FHRI$XGLWVDQG,QYHVWLJDWLRQV5HYLVHG
Inspector General
California Department of Transportation
Certification of Indirect Costs and Financial Management System (Note: If a Safe Harbor Indirect Cost Rate is approved, this form is not required) Consultant’s Full Legal Name:

Important: Consultant means the individual or consultant providing engineering and design related services as a party of a contract with a recipient or sub-recipient of Federal assistance. Therefore, the Indirect Cost Rate(s) shall not be combined with its parent company or subsidiaries.

Indirect Cost Rate (ICR):

Combined Rate: Or
+RPH2ႈFH5DWH
DQG)LHOG2ႈFH5DWH
LIDSSOLFDEOH

Facilities Capital Cost of Money (if applicable):

Fiscal Period:*
* Fiscal period is annual one year applicable accounting period that the ICR was developed (not the contract period). The ICR is based on the FRQVXOWDQW¶VRQH\HDUDSSOLFDEOHDFFRXQWLQJSHULRGIRUZKLFKILQDQFLDOVWDWHPHQWVDUHUHJXODUO\SUHSDUHGE\WKHFRQVXOWDQW ,KDYHUHYLHZHGWKHSURSRVDOWRHVWDEOLVKDQ,&5
V
IRUWKHILVFDOSHULRGDVVSHFLILHGDERYHDQGKDYHGHWHUPLQHG to the best of my knowledge and belief that:
• All costs included in the cost proposal to establish the ICR(s) are allowable in accordance with the cost principles of the Federal Acquisition Regulation (FAR) 48, Code of Federal Regulations (CFR), Chapter 1, Part 31 (48 CFR Part 31)
• The cost proposal does not include any costs which are expressly unallowable under the cost principles of 48 CFR Part 31
• The accounting treatment and billing of prevailing wage delta costs are consistent with our prevailing wage policy as either direct labor, indirect costs, or other direct costs on all federally-funded A&E Consultant Contracts.
• $OONQRZQPDWHULDOWUDQVDFWLRQVRUHYHQWVWKDWKDYHRFFXUUHGVXEVHTXHQWWR\HDUHQGDIIHFWLQJWKHFRQVXOWDQW¶V RZQHUVKLSRUJDQL]DWLRQDQGLQGLUHFWFRVWUDWHVKDYHEHHQGLVFORVHGDVRIWKHGDWHRIWKLVFHUWLILFDWLRQ I am providing the required and applicable documents as instructed on the Financial Document Review Request form.

Financial Management System:
2XUODERUFKDUJLQJMREFRVWLQJDQGDFFRXQWLQJV\VWHPVPHHWWKHVWDQGDUGVIRU¿QDQFLDOUHSRUWLQJDFFRXQWLQJ records, and internal control adequate to demonstrate that costs claimed have been incurred, appropriately accounted for, are allocable to the contract, and comply with the federal requirements as set forth in Title 23 United States Code (U.S.C.) Section 1
12(b)(2); 48 CFR Part 31.201-2(d); 23 CFR, Chapter 1, Part 172.11(a)(2); and all applicable state and federal rules and regulations. 2XU¿QDQFLDOPDQDJHPHQWV\VWHPKDVWKHIROORZLQJDWWULEXWHV
•
Account numbers identifying allowable direct, indirect, and unallowable cost accounts; • Ability to accumulate and segregate allowable direct, indirect, and unallowable costs into separate cost accounts;
1
Dewberry Engineers Inc.
162.73 139.26
01/01/2024-12/31/2024
ITEM 9.12.

ATTACHMENT 2

Page 516 of 654 ends

&HUWL¿FDWLRQRI,QGLUHFW&RVWVDQG)LQDQFLDO0DQDJHPHQW6\VWHP,QGHSHQGHQW2I¿FHRI$XGLWVDQG,QYHVWLJDWLRQV5HYLVHG
• Ability to accumulate and segregate allowable direct costs by project, contract and type of cost; • ,QWHUQDOFRQWUROVWRPDLQWDLQLQWHJULW\RIILQDQFLDOPDQDJHPHQWV\VWHP

• Ability to account and record costs consistently and to ensure costs billed are in compliance with FAR; • Ability to ensure and demonstrate costs billed reconcile to general ledgers and job costing system; and • Ability to ensure costs are in compliance with contract terms and federal and state requirementV Cost Reimbursements on Contracts:

I also understand that failure to comply with 48 CFR Part 16.301-3 or knowingly charge unallowable costs to Federal-Aid Highway Program (FAHP) contracts may result in possible penalties and sanctions as provided by the following:
• Sanctions and Penalties - 23 CFR Part 172.11(c)(4)
• False Claims Act - Title 31 U.S.C. Sections 3729-3733 • Statements or entries generally - Title 18 U.S.C. Section 1001 • Major Fraud Act - Title 18 U.S.C. Section 1031
All A&E Contract Information:
• Total participation amount ___________________ on all State and FAHP contracts for Architectural & (QJLQHHULQJVHUYLFHVWKDWWKHFRQVXOWDQWUHFHLYHGLQWKHODVWWKUHHILVFDOSHULRGV • The number of states in which the consultant does business is • Years of consultant’s experience with 48 CFR Part 31 is • ,GHQWLI\WKHW\SHRIDXGLWVOLVWHGEHORZWKDWWKHFRQVXOWDQWKDVKDGSHUIRUPHG LIDSSOLFDEOH

Cognizant ICR Audit Local Govt ICR Audit
Caltrans ICR Audit
CPA ICR Audit Federal Govt ICR Audit
I, the undersigned, certify all of the above to the best of my knowledge and belief and that I have reviewed the ICR Schedule to determine that any costs which are expressly unallowable under the Federal cost principles have been removed and comply with Title 23 U.S.C. Section 112(b)(2), 48 CFR Part 31, 23 CFR Part 172, and all applicable state and federal rules and regulations. I also certify that I understand that all documentation of compliance must be retained by the consultant. I hereby acknowledge that costs that are noncompliant with the federal and state requirements are not eligible for reimbursement and must be returned to Caltrans.

Name
** T
itle**:

Signature: Date:

Phone**: Email**:

$QLQGLYLGXDOH[HFXWLYHRU¿QDQFLDORႈFHURIWKHFRQVXOWDQW¶VRUVXEFRQVXOWDQW¶VRUJDQL]DWLRQDWDOHYHOQRORZHUWKDQD 9LFH3UHVLGHQWD&KLHI)LQDQFLDO2ႈFHURUHTXLYDOHQWZKRKDVDXWKRULW\WRUHSUHVHQWWKH¿QDQFLDOLQIRUPDWLRQXVHGWR establish the indirect cost rate.

Note: Both prime and subconsultants as parties of a contract must complete their own forms. Caltrans will not SURFHVVORFDODJHQF\¶VLQYRLFHVXQWLODFRPSOHWHIRUPLVDFFHSWHGDQGDSSURYHGE\WKH,QGHSHQGHQW2ႈFHRI Audits and Investigations.
2
0
L2026-2107
45 44
Cynthia Chen
✔
✔ ✔
Chief Financial Officer
Cynthia Chen
Digitally signed by Cynthia Chen
Date: 2025.07.01 10:25:47 -04'00'
✔
[email protected](703) 849-0409
07/01/2025
ITEM 9.12.

ATTACHMENT 2

Page 517 of 654 ends

MEMORANDUM

City Council Staff Report - Page 1 of 2

ITEM 9.13.

DATE: June 15, 2026

TO: Honorable Mayor and Council Members

FROM: Erin Naderi, Finance Analyst II

SUBJECT: A RESOLUTION AUTHORIZING THE CITY MANAGER TO EXECUTE CONTRACT AMENDMENT NO. 2021-270-5 WITH THE

SACRAMENTO COUNTY DISTRICT ATTORNEY'S OFFICE IN AN
AMOUNT NOT TO EXCEED $193,592 FOR COMMUNITY
PROSECUTION PROGRAM SERVICES THROUGH JUNE 30, 2027

RECOMMENDATION

Adopt the Resolution.

RESULT OF RECOMMENDED ACTION

Adoption of the Resolution would authorize the City Manager to execute the fifth amendment to the city's Memorandum of Understanding with the Sacramento County District Attorney's Office in an amount not to exceed $193,592 for Community Prosecution Program Services through June 30, 2027.

BACKGROUND

The city has contracted with the Sacramento County District Attorney's Office since 2008 to work collaboratively with the Rancho Cordova Police Department, Neighborhood Services, and other local agencies to reduce the number of major nuisance properties, reduce crime, and address quality-of-life issues throughout the community.

As part of this agreement, a full-time Community Prosecutor is shared between the city and the Sacramento County Sheriff's East Division and is assigned to work out of the Rancho Cordova Police Department office. The city pays 50% of the cost of the assigned Community Prosecutor, totaling $193,592 for Fiscal Year 2026-2027.

The assigned Community Prosecutor works with members of the city team, law enforcement, local agencies, businesses, and the community to develop solutions and help address some of the most significant and persistent issues facing the city, including chronic nuisance offenders, theft, trespassing, problem properties, and other quality-of-life violations.

Over the last three years, the Community Prosecutor assigned to the City of Rancho Cordova has reviewed approximately five to ten search warrants per month and prosecuted approximately 40 individuals who participated in the CORE program, mental health diversion, and/or completed in-custody jail time. For these individuals, the Community Prosecutor

Page 518 of 654 ends

City Council Staff Report - Page 2 of 2

reviewed approximately eight to ten misdemeanor cases per person, totaling an estimated 320 to 400 misdemeanor cases over the three-year period. Several of these individuals participated in programs multiple times or qualified for the CORE program more than once.

During this same period, the Community Prosecutor worked with Code Enforcement and/or the POP team on approximately 35 projects involving businesses, apartments, hotels, and private residences. The Community Prosecutor also prosecuted approximately seven individuals charged with felony crimes, including felony stalking, assault with a deadly weapon, theft, and vandalism.

In addition to casework and project coordination, the Community Prosecutor regularly participates in the monthly FOZ Business Watch meeting, quarterly Neighborhood Watch meetings, community events in Rancho Cordova, internet safety presentations for elementary and middle school students, the RCPD Citizen’s Academy, and Leadership Rancho Cordova.

The Community Prosecutor also remains available to assist with questions and issues raised by officers at RCPD and the Sacramento County Sheriff's East Division.

The attached amendment to the city's Memorandum of Understanding with the Sacramento County District Attorney's Office extends the term of service through June 30, 2027. Continuing this partnership provides the city with dedicated legal expertise, coordinated problem-solving capacity, and focused support for recurring public safety and quality-of-life concerns.

FISCAL IMPACT AND FUNDING SOURCE

The Fiscal Impact will be an expense of $193,592 to the General Fund.

ATTACHMENT(S)

1. Resolution

2. Contract Amendment No. 2021-270-5

Page 519 of 654 ends

ITEM 9.13. ATTACHMENT 1 Resolution No. XX-2026 Page 1 of 2

CITY OF RANCHO CORDOVA

RESOLUTION NO. XX-2026

A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF RANCHO CORDOVA, STATE

OF CALIFORNIA, AUTHORIZING THE CITY MANAGER TO EXECUTE CONTRACT AMENDMENT NO. 2021-270-5 WITH THE SACRAMENTO COUNTY DISTRICT ATTORNEY'S OFFICE IN AN AMOUNT NOT TO EXCEED $193,592 FOR COMMUNITY PROSECUTION PROGRAM SERVICES THROUGH JUNE 30, 2027

WHEREAS, the Sacramento County District Attorney’s Office (“District Attorney”) operates a Community Prosecution Program to solve problems, ensure public safety, and enhance the quality of life; and

WHEREAS, the District Attorney Community Prosecution Program focuses on targeted areas and involves a long-term proactive partnership between prosecutors, law enforcement, the community, and public and private organizations; and

WHEREAS, the City of Rancho Cordova (“Rancho Cordova”) desires to obtain said Community Prosecution Program services for the improvement of Rancho Cordova; and

WHEREAS, the District Attorney and Rancho Cordova have previously entered into a Memorandum of Understanding (MOU) on July 1, 2021, to provide reimbursement for services for the Community Prosecution Program; and

WHEREAS, the District Attorney and Rancho Cordova desire to formally amend said MOU to modify the term and reimbursement amount for services by the Community Prosecution Program.

NOW, THEREFORE, BE IT HEREBY RESOLVED THE CITY COUNCIL OF THE CITY OF RANCHO CORDOVA authorizes the City Manager to execute Contract Amendment No. 2021-270-5 with the Sacramento County District Attorney’s Office in an amount not to exceed $193,592 for Community Prosecution Program Services through June 30, 2027, in a form approved by the City Attorney.

PASSED AND ADOPTED by the City Council of the City of Rancho Cordova on the 15th day of June 2026 by the following vote:

AYES:

NOES:

ABSENT:

ABSTAIN:

Garrett Gatewood, Mayor

Page 520 of 654 ends

ITEM 9.13. ATTACHMENT 1 Resolution No. XX-2026 Page 2 of 2 ATTEST:

Stacy Leitner, CMC
City Clerk

Page 521 of 654 ends

ITEM 9.13. ATTACHMENT 2

Page 1 of 7 ends

MEMORANDUM OF UNDERSTANDING
BETWEEN SACRAMENTO COUNTY DISTRICT ATTORNEY’S OFFICE
AND

CITY OF RANCHO CORDOVA FOR COMMUNITY PROSECUTION

PROGRAM SERVICES

THIS MEMORANDUM OF UNDERSTANDING (MOU) is made and entered into this ____________ day of _________________, 2026 by and between the City of Rancho Cordova, California, a California municipal corporation, hereinafter called “RANCHO CORDOVA,” and the County of Sacramento, California, District Attorney’s Office hereinafter called “DISTRICT ATTORNEY.”

WHEREAS, DISTRICT ATTORNEY operates a Community Prosecution Program to solve problems, ensure public safety and enhance the quality of life; and

WHEREAS, DISTRICT ATTORNEY’S Community Prosecution Program focuses on targeted areas and involves a long-term proactive partnership between prosecutors, law enforcement, the community and public and private organizations; and

WHEREAS, RANCHO CORDOVA desires to obtain said Community Prosecution Program services for the improvement of RANCHO CORDOVA;

NOW, THEREFORE, in consideration of the provisions of this MOU, both RANCHO CORDOVA and DISTRICT ATTORNEY agree as follows:

A. Scope of Services

The duties of a full time Community Prosecutor shared between RANCHO CORDOVA and the Sacramento County Sheriff’s East Division and assigned by DISTRICT ATTORNEY to the geographic area described in Attachment “A” shall include:

1. Community Prosecutor will be assigned to, and work out of an office located at, the Sacramento Sheriff’s Office (SSO) East Division/City of Rancho Cordova Police Department, 2897 Kilgore Road, Rancho Cordova, CA 95670.

2. Community Prosecutor will be an Attorney, Lv IV or above.

3. Community Prosecutor will work collaboratively with Rancho Cordova Police Department, SSO, and City Departments including, but not limited to, Neighborhood Services, Finance and
Community Development, and other local agencies to establish

Page 522 of 654 ends

ITEM 9.13. ATTACHMENT 2

Page 2 of 7 ends

priorities, geographic focus areas, and short and long-term goals, to include:

a. Reducing major nuisance properties; and

b. Reducing crime, addressing quality-of-life concerns, and mitigating nuisance violations in certain geographic areas as supported by data, the community, and the City’s Grow Strong Neighborhood initiative; and

c. Being part of the regional effort to reduce homelessness.

4. RANCHO CORDOVA community priorities as established by the Rancho Cordova City Council will be provided to the DISTRICT ATTORNEY Community Prosecutor and shall be considered in determining priorities and efforts.

a. In no way may these priorities interfere with DISTRICT ATTORNEY prosecutorial discretion.

b. RANCHO CORDOVA recognizes that the Community
Prosecutor's decision to take action on any particular case or matter must be consistent with the law including, but not limited to, criminal law, laws of evidence, criminal procedure and ethical responsibilities.

5. Community Prosecutor will familiarize him or herself with Rancho Cordova, including its ordinances. He or she will communicate with the Rancho Cordova City Attorney’s Office on any questions or issues that may have an impact with the Community Prosecutor performing his or her duties.

6. Community Prosecutor will work collaboratively with RANCHO CORDOVA, Sacramento County Law Enforcement, Rancho Cordova Neighborhood Services Director , Rancho Cordova City Manager and City Attorney, community members and community
organizations to focus resources, craft solutions and solve the most significant and pressing problems including, but not limited to, chronic offender rehabilitation effort (CORE), theft, trespassing, and other quality of life violations. Some of the duties the Community Prosecutor will perform include:

a. Attend meetings of community organizations to familiarize community members with the Community Prosecution
Program. Community meetings include, but are not limited to, Neighborhood Crime Watch meeting, Folsom Olsen and
Zinfandel Business Crime Watch meeting, Hotel Crime Watch

Page 523 of 654 ends

ITEM 9.13. ATTACHMENT 2

Page 3 of 7 ends

meeting, and Good Neighbor Day(s). Distribute a Needs
Assessment survey intended to reveal public safety and quality of life problems. Evaluate data from the Needs Assessment survey and formulate priorities for addressing the problems; priorities will also take into consideration data received from Rancho Cordova City Council and City officials.

b. Meet with community members and law enforcement at regular sessions of community groups, public and private
organizations, and neighborhood and business associations, or at discussion sessions organized by the Community Prosecutor.

The Community Prosecutor and Problem-Oriented Police (POP) Officers will meet with community groups to present survey results and solicit citizen ideas and concerns for ultimate strategies to address problems identified in the survey.

c. Discuss with POP officers legal issues that arise in the course of investigations, arrests, and searches in cases involving community problems. Consult with law enforcement agencies, Rancho Cordova City officials, and community members to devise strategies to eliminate community problems. Refine partnerships with Rancho Cordova Police Department, public and private agencies and community members, to focus
resources on identified community problems. Attend monthly POP and Code Enforcement collaboration meeting to identify nuisance property and quality of life issues throughout the City.

d. In working with law enforcement and the community to craft solutions, the Community Prosecutor will rely upon:

• Criminal Prosecution – Felony, Misdemeanor and Infraction • Civil Prosecution
• Probation and Parole Violations
• Informal Meetings
• Informal Mediation
• Citizen Mobilization
• Commercial Intervention
• Local and State Legislative Process
• Juvenile Prosecution
• Community Action
• Landlord Training
• Other applicable resources

e. Monitor the filing and prosecution of significant “impact” cases affecting the service area.

Page 524 of 654 ends

ITEM 9.13. ATTACHMENT 2

Page 4 of 7 ends

f. Educate community members on Victim/Witness Assistance Program services available through the District Attorney’s Office and the State of California; and familiarize community members with the criminal justice process.

g. Present and facilitate community forums throughout the community to address issues such as domestic violence,
unlawful sexual conduct, corporal punishment and gang
activity.

h. Periodically distribute a survey to evaluate the success of the Community Prosecution Program. Share the results of surveys with Rancho Cordova City staff.

i. The Sacramento County District Attorney’s Office executive team will meet semiannually with City officials, including Rancho Cordova Police Department leadership, Neighborhood Services, and the City Attorney’s Office. That discussion will include a review of completed projects, filed and completed criminal prosecutions (including Chronic Nuisance Offender cases), attendance at community meetings/activities, hosted meetings/activities/trainings, and ongoing long-term projects within the City of Rancho Cordova. RANCHO CORDOVA may
request a written summary of these reports.

B. Term

This MOU shall be effective July 1, 2026 through June 30, 2027.

RANCHO CORDOVA may renew this MOU annually by letter
amendment for four additional one-year periods for a total contract term up to five years.

C. Reimbursement

1. Upon receipt of quarterly invoices from DISTRICT ATTORNEY, RANCHO CORDOVA will reimburse DISTRICT ATTORNEY for 50% of the salary, benefits, vehicle and fuel costs of a full time Community Prosecutor from July 1, 2026 through June 30, 2027, not to exceed a total reimbursement of $193,592.

2. In anticipation of possible personnel, vehicle and fuel cost increases for the assigned Community Prosecutor, the annual reimbursement rate shall be reviewed by DISTRICT ATTORNEY and RANCHO CORDOVA for each of the subsequent twelve-month

Page 525 of 654 ends

ITEM 9.13. ATTACHMENT 2

Page 5 of 7 ends

periods under the terms of this MOU and revised as mutually agreed by letter amendment to this MOU.

D. Indemnification

1. To the fullest extent permitted by law, each party shall defend, indemnify and hold the other party, its governing body, officers, employees and agents harmless from and against any and all liability, loss, expense including reasonable attorneys’ fees, or claims for injury or damage arising out of the performance of this MOU. It is the intent of the parties hereto that, where negligence or fault is determined to have been contributory, the principles of comparative fault will be followed and each party shall bear the proportionate costs of any loss, damage, expense and liability attributable to a finding of that party's negligence or the fault of that party.

2. Nothing in this indemnity obligation shall be construed to create any duty to, any standard of care with reference to, or any liability or obligation, contractual or otherwise, to any third party.

3. This indemnity obligation shall not be limited by the types and amounts of insurance or self-insurance maintained by the parties.

4. The provisions of this Paragraph shall survive the expiration or termination of this MOU.

E. Insurance

Each party, at its sole cost and expense, shall carry insurance or self- insure its activities in connection with this MOU, and obtain and keep in force insurance or equivalent programs of self-insurance, for general liability, professional liability, workers’ compensation, and business automobile liability adequate to cover its potential liabilities hereunder. Each party agrees to provide the other thirty (30) days advance written notice of any cancellation, termination, or lapse of any of the insurance or self-insurance coverage.

F. Disputes

In the event of any dispute arising out of or relating to this MOU, the parties shall attempt, in good faith, to promptly resolve the dispute mutually between themselves. Pending resolution of any such dispute, DA shall continue without delay to carry out all its responsibilities under this MOU unless the MOU is otherwise terminated in accordance with the Termination provisions herein.

Page 526 of 654 ends

ITEM 9.13. ATTACHMENT 2

Page 6 of 7 ends

G. Termination

This MOU may be terminated without cause upon thirty (30) days written notice to the other party. Notice shall be deemed served on the date of mailing. Any overpayment for services that have not yet been rendered shall be returned to RANCHO CORDOVA by DISTRICT ATTORNEY.

H. Entire Agreement

This MOU constitutes the entire agreement between the parties with respect to the subject matter.

I. Alteration

This MOU may be modified or extended by letter amendment upon the mutual consent and signature of RANCHO CORDOVA and
DISTRICT ATTORNEY.

J. Notice

1. Notice to DISTRICT ATTORNEY:

Sacramento County District Attorney
901 G Street
Sacramento, CA 95814
Attn: Chief Deputy District Attorney

2. Notice to RANCHO CORDOVA:

City of Rancho Cordova
2729 Prospect Park Drive
Rancho Cordova, CA 95670
Attn: Neighborhood Services Director

IN WITNESS WHEREOF, this MOU has been executed by and on behalf of the parties here, the day and year first above written.

____________________________________

MICAH RUNNER
City Manager
City of Rancho Cordova

Page 527 of 654 ends

ITEM 9.13. ATTACHMENT 2

Page 7 of 7 ends

____________________________________

THIEN HO
District Attorney
Sacramento County District Attorney’s Office

Page 528 of 654 ends

MEMORANDUM

City Council Staff Report - Page 1 of 2

ITEM 9.14.

DATE: June 15, 2026

TO: Honorable Mayor and Council Members

FROM: Lydia Thung, Economic Development Management Analyst Amanda Norton, Economic Development Director

SUBJECT: A RESOLUTION AUTHORIZING THE CITY MANAGER TO EXECUTE CONTRACT AMENDMENT NO. 2025-271-2 WITH CREATIVE

NOGGIN, LLC FOR ECONOMIC DEVELOPMENT MARKETING AND

COMMUNICATIONS SERVICES MAKING THE CUMULATIVE
AMOUNT OF THE CONTRACT $160,000

RECOMMENDATION

Adopt the Resolution.

RESULT OF RECOMMENDED ACTION

Adoption of the Resolution would authorize the City Manager to execute Contract Amendment No. 2025-271-2 with Creative Noggin, LLC for economic development marketing and communications services making the cumulative amount of the contract $160,000.

BACKGROUND

On January 1, 2026, the city entered into a Professional Services Agreement with Creative Noggin, LLC to provide communications and graphic design support services for the Rancho Cordova Youth Center (RCYC) and the Rancho Cordova Promise Program (RCCP).

On March 3, 2026, the City Council approved a First Amendment to the Agreement to expand the scope of services to include development of an Economic Development Communications Strategy and Implementation Toolkit in support of the city’s Economic Development Strategic Plan (EDSP). The project included development of key messaging, visual assets, marketing templates, storytelling tools, and a communications framework designed to support the city’s business attraction, retention, and expansion efforts.

Through that work, the strategy and toolkit identified marketing and communications activities that would strengthen the city’s economic development initiatives. The city seeks to expand Creative Noggin’s scope of services to continue the implementation and advancement of the recommendations identified.

FISCAL IMPACT AND FUNDING SOURCE

The additional services would increase the Agreement amount by $30,000, for a total amount not to exceed $160,000.

Page 529 of 654 ends

City Council Staff Report - Page 2 of 2

This project has been budgeted for from the Economic Development Department’s approved Fiscal Year 2026-2027 Measure R budget.

ATTACHMENT(S)

1. Resolution

2. Contract Amendment No. 2025-271-2

Page 530 of 654 ends

ITEM 9.14. ATTACHMENT 1
Resolution No. XX-2026 Page 1 of 2

CITY OF RANCHO CORDOVA

RESOLUTION NO. XX-2026

A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF RANCHO CORDOVA, STATE

OF CALIFORNIA, AUTHORIZING THE CITY MANAGER TO EXECUTE CONTRACT AMENDMENT NO. 2025-271-2 WITH CREATIVE NOGGIN, LLC FOR ECONOMIC

DEVELOPMENT MARKETING AND COMMUNICATIONS SERVICES MAKING THE CUMULATIVE AMOUNT OF THE CONTRACT $160,000

WHEREAS, the City of Rancho Cordova entered into a Professional Services Agreement with Creative Noggin, LLC dated January 1, 2026, for communications and graphic design support services for the Rancho Cordova Youth Center (RCYC) and the Rancho Cordova Promise Program (RCCP); and
WHEREAS, on March 3, 2026, the City Council approved a First Amendment to the Agreement to expand the scope of services to include development of an Economic Development Communications Strategy and Implementation Toolkit; and WHEREAS, the Economic Development Communications Strategy and Implementation Toolkit identified recommendations to strengthen the city's economic development marketing and communications efforts; and
WHEREAS, the city desires to expand the scope of services under the Agreement to implement priority projects, marketing assets, storytelling initiatives, and related economic development marketing and communications activities; and WHEREAS, the second amendment increases the total compensation under the Agreement by $30,000, for a total not-to-exceed amount of $160,000; and WHEREAS, funding for the amendment is included in the approved Economic Development Department budget.

NOW, THEREFORE, BE IT HEREBY RESOLVED THE CITY COUNCIL OF THE CITY OF RANCHO CORDOVA does hereby authorize the City Manager to execute Contract Amendment No. 2025-271-2 with Creative Noggin, LLC in an amount not to exceed $30,000 for economic development marketing and communications services making the cumulative amount $160,000 in a form approved by the City Attorney.

PASSED AND ADOPTED by the City Council of the City of Rancho Cordova on the 15th day of June 2026 by the following vote:

AYES:

NOES:

ABSENT:

ABSTAIN:

Page 531 of 654 ends

ITEM 9.14. ATTACHMENT 1
Resolution No. XX-2026 Page 2 of 2 ATTEST:

Garrett Gatewood, Mayor

Stacy Leitner, CMC
City Clerk

Page 532 of 654 ends

CONTRACT NO. 2025-271-2
Second Amendment to Professional Services Agreement between City of Rancho Cordova and Creative Noggin, LLC Page 1 of 3 Revised 06/2025

SECOND AMENDMENT TO THE PROFESSIONAL SERVICES AGREEMENT BETWEEN

THE CITY OF RANCHO CORDOVA AND CREATIVE NOGGIN, LLC
Th
is Second Amendment to the Professional Services Agreement ( “Amendment”) is made by and between the City of Rancho Cordova (“City”) and Creative Noggin, LLC (“Professional”) as of June 16, 2026.

City and Professional are hereinafter collectively referred to as the “Parties.” RE
CITALS
W
HEREAS, the Parties entered into a Professional Services Agreement (“Agreement”) dated January 1, 2026; and
W
HEREAS, the Parties subsequently entered into a First Amendment to the Agreement dated March 3, 2026, to expand the scope of services to include Economic Development Marketing and Communications Support for the City’s Economic Development Department; and W
HEREAS, Creative Noggin developed an Economic Development Communications Strategy and Implementation Toolkit which recommended opportunities and priority projects to strengthen the City’s economic development marketing, business support, and storytelling efforts; and W
HEREAS, the City desires to expand the scope of services under the Agreement to include implementation of priority recommendations and completion of economic development marketing and communications projects; and
W
HEREAS, Creative Noggin possesses unique familiarity with the City’s Economic Development Strategic Plan, communications strategy, messaging framework, visual assets, and implementation priorities, making it well-positioned to efficiently provide the additional services; and W
HEREAS, the cost for additional implementation services is Thirty Thousand Dollars ($30,000); and
W
HEREAS, the Parties agree that changes to the compensation and services provided for in the PSA are necessary in order for the City to continue receiving services by Professional.

NO
W, THEREFORE, the Parties hereto agree as follows:

REEMENT

1. S
ection 2 of the Agreement, “Compensation,” provides for the City to pay Professional a sum not to exceed One Hundred Thousand Dollars: ($130,000.00). The Parties agree to amend Section 2 of the Agreement in order to increase the compensation amount to pay Professional for additional services. The first sentence of Section 2 of the Agreement is amended to read as follows:
"
City hereby agrees to pay Professional a sum not to exceed One Hundred Sixty Thousand Dollars: ($160,000.00), notwithstanding any contrary indication that may be contained in ITEM 9.14.

ATTACHMENT 2

Page 533 of 654 ends

CONTRACT NO. 2025-271-2

Second Amendment to Professional Services Agreement between City of Rancho Cordova and Creative Noggin, LLC Page 2 of 3 Revised 06/2025

Professional’s proposal, for services to be performed and reimbursable costs incurred under this Agreement.”

2. The document entitled “Scope of Services,” attached hereto as Exhibit A, shall replace and supersede the Agreement's Exhibit A.

3. The document entitled “Compensation Schedule,” attached hereto as Exhibit B, shall replace and supersede the Agreement's Exhibit B.

4. All other terms and conditions in the Agreement shall remain in full force and effect to the extent they are not in conflict with this Amendment.

5. The signatures of the Parties to this Amendment may be executed and acknowledged on separate pages or in counterparts which, when attached to this Amendment, shall constitute one complete Amendment.

ITEM 9.14.

ATTACHMENT 2

Page 534 of 654 ends

CONTRACT NO. 2025-271-2

Second Amendment to Professional Services Agreement between City of Rancho Cordova and Creative Noggin, LLC Page 3 of 3 Revised 06/2025

IN WITNESS WHEREOF , the parties have executed this A mendment as of the day and year first above written.

CITY OF RANCHO CORDOVA PROFESSIONAL

______________________________ ______________________________ Micah Runner, City Manager Tracy Marlowe, CEO

Date:__________________ Date:__________________

Attest:

______________________________
Stacy Leitner, CMC, City Clerk

Date:__________________

Approved as to Form:

______________________________
Adam U. Lindgren, City Attorney

Date:_________________

ITEM 9.14.

ATTACHMENT 2

Page 535 of 654 ends

CONTRACT NO. 2025-271-2

Second Amendment to Professional Services Agreement between City of Rancho Cordova and Creative Noggin, LLC – Exhibit A Page 1 of 5 Revised 06/2025

EXHIBIT A

SCOPE OF SERVICES

The Professional shall perform professional services for Communications and Graphic Design Support for the Rancho Cordova Youth Center (RCYC) and Rancho Cordova Promise Program (RCCP).

The Professional will be expected to manage and control costs and resources, and complete work in adherence to the agreed upon Project schedule and will assign a Project Manager who will act as the City’s primary contact and will be entirely responsible for project management activities throughout the life of the Project (including subconsultant work, if applicable).

The Professional shall, with guidance from the City’s Communications & Public Affairs Department and the City Manager’s Department, implement RCYC’s & RCCP’s strategic communications plans.

The main goals of the RCYC plan include increasing the number of students registered at RCYC and enrolled in new and seasonal programming, market new programming options, and build brand trust.

The main goal of the RCCP plan is to improve program awareness, enrollment and build brand trust.

The Professional will provide the scope of work below but also may include additional scope based on new programs or pilots and / or change of programs. The City may, from time to time, request changes to the Scope of Services, including but not limited to increases or decreases in the number or type of deliverables (such as additional editorial calendars, newsletter templates, or campaigns). No such change shall be effective or compensable unless authorized in advance through a written amendment to this Agreement executed by both Parties in accordance with Section 8.3 (“Amendments”). Any such amendment may, as appropriate, revise Exhibit A (Scope of Services), Exhibit B (Compensation Schedule), and/or the Term of the Agreement.

Content Development
• Produce monthly editorial calendars and develop compelling stories across all channels. • Update RCYC Programming Guide tri-annually (Fall / Winter, Winter / Spring and Summer). • Update RCYC flyers (general, February break, Spring break, specialty enrichment and Trunk-or- treat, transportation program) annually.
• Design RCCP two flyers for high school and veteran audiences annually. • Update RCYC and RCCP digital billboard advertising quarterly, as needed. • Create two (2) RCYC and RCCP electronic newsletter templates: one (1) template for the Rancho Cordova Youth Center (RCYC) and one (1) template for the Rancho Cordova Promise Program (RCCP), configured to be reusable by City staff.
• Design monthly Instagram and Facebook content for the RCYC and RCCP (approximately 16 annually).
• Generate original media assets (photo shoots, video shorts and reels) quarterly to showcase RCYC and RCCP benefits; maintain an archive for future use.

ITEM 9.14.

ATTACHMENT 2

Page 536 of 654 ends

CONTRACT NO. 2025-271-2

Second Amendment to Professional Services Agreement between City of Rancho Cordova and Creative Noggin, LLC – Exhibit A Page 2 of 5 Revised 06/2025

Digital Marketing & SEO
• Optimize the City’s RCYC and RCCP webpages for local search by enhancing metadata, adding location keywords and ensuring mobile friendly signup forms. • Collaborate with the city to strategize and manage advertising on Nextdoor and Meta (Instagram and Facebook); craft audience-specific parameters for advertising to targeted demographics to optimize campaigns for two to five campaigns annually.

In addition, the Professional will:
• Measure the success of tactical implementation of the RCYC Strategic Communications Plan by tracking and reporting performance metrics:
o Performance Metrics
 RCYC
• Increase website visits to program pages by 30% (leveraging local SEO and Nextdoor).
 Search engine ranking for keywords
• Improve enrollment conversion rates; track the impact of SMS and email campaigns on signups. • Grow social media reach and engagement (followers, shares, comments) across Meta and Nextdoor.
• Achieve specified attendance targets for open houses and info sessions. • Gather community feedback via surveys to gauge awareness and satisfaction. • Increase website visits to RCCP program pages by +30%

The Professional will attend and contribute to team meetings and brainstorm sessions and conduct other outreach as needed to gather information for story content.

The Professional shall complete all work under this Agreement by June 30, 2027, as referenced in subsection 1.1.

Accessibility Requirements

1. Accessibility Laws.

Professional acknowledges that City is a public entity subject to the Americans with Disabilities Act (“ADA”), including Title II, the U.S. Department of Justice’s 2024 ADA Title II Digital Accessibility Rule Section 504 (28 C.F.R. Part 35, Subpart I), Section 504 of the California Building Code accessibility requirements, and other applicable federal and state accessibility laws and regulations, including implementing regulations and successor standards (collectively, “Accessibility Laws”). Professional shall perform all Services in compliance with, and in support of City’s obligation to comply with, Accessibility Laws.

ITEM 9.14.

ATTACHMENT 2

Page 537 of 654 ends

CONTRACT NO. 2025-271-2

Second Amendment to Professional Services Agreement between City of Rancho Cordova and Creative Noggin, LLC – Exhibit A Page 3 of 5 Revised 06/2025

2. Accessible Deliverables.

To the extent required by law, Professional’s Services that include creation or modification of web content or mobile applications, shall:
a. Design, develop, and deliver content and materials that are: (1) accessible by default; (2) compatible with commonly used assistive technologies; and (3) generally consistent with then-current accessibility requirements under Accessibility Laws (including, where applicable, Web Content Accessibility Guidelines (“WCAG”) 2.1 Level AA or any successor standard that applies).
b. Not rely solely on accessibility overlays or automated tools as a substitute for creating, coding, and delivering accessible content.
c. Use accessibility language provided by City in notices and materials, and coordinate with City regarding any requested reasonable accommodations when assisting with public- facing outreach or events.

3. Testing and Certification.

At its sole cost and expense, Professional shall perform reasonable accessibility testing of its work product and deliverables to confirm compliance with Accessibility Laws and applicable accessibility standards.  Professional certifies that any deliverables under this Agreement have been tested and comply with such the Accessibility Laws.

4. Cooperation and Remediation.

Professional shall cooperate with City in assessing the accessibility of Professional’s work product and deliverables. If City, in its sole discretion, determines that Professional’s work product or deliverables do not meet the requirements of the Accessibility Laws or any standard therein, and which are within Professional’s control, Professional shall correct such issues within five (5) business days of identification at no additional cost to City.

A work plan for the Communications and Graphic Design Support for the RCYC and RCCP is also attached as part of Exhibit A and included on the following page.

The Professional shall also perform professional services in support of the City of Rancho Cordova’s Economic Development Department.

Economic Development Communications Strategy & Implementation Toolkit Project Timeline: March 3, 2026 – June 30, 2026

Purpose
The Professional shall, with guidance from the City’s Economic Development Department and the City’s Communications & Public Affairs Department, develop a comprehensive economic development communications strategy and implementation toolkit aligned with the City’s Economic Development Strategic Plan.

The main goal of the Economic Development communications strategy is to clearly articulate Rancho Cordova’s economic development value proposition; promote the City’s assets, target industries, and ITEM 9.14.

ATTACHMENT 2

Page 538 of 654 ends

CONTRACT NO. 2025-271-2

Second Amendment to Professional Services Agreement between City of Rancho Cordova and Creative Noggin, LLC – Exhibit A Page 4 of 5 Revised 06/2025

competitive advantages; highlight business success stories; and position Rancho Cordova as the premier place to do business in the region. This project would deliver ready-to-use tools that communicate the city’s economic development messages, promote the city’s assets to attract more business, feature key success stories, and measure results.

Deliverables
• Discovery: Review the city’s economic development strategic plan and already-available research and materials to understand key audiences and goals.
• Strategic Planning: Work with the city to develop a communications strategy for economic development.
o Identify priority audiences and sectors
o Identify key channels to best reach audiences/sectors o Identify tactics, including communications toolkit and website layout/configuration, to position Rancho Cordova as the place to do business
• Communications Toolkit: Deliver key assets, including messaging; visual templates; and video, social and digital storytelling.
o Develop key messaging
o Create a distinct look and feel for economic development that aligns with the city brand o Create new templates and new key assets, including but not limited to social media graphics, digital content graphics, flyer, one-pager, slide deck, and digital newsletter.  Work with the city to create both industry- and audience-specific assets. o Coordinate 5 videos with production company that bring sector stories and business wins to life.
o Develop Website Recommendations

Timeline: Professional shall complete and deliver all work no later than June 30, 2026.

Economic Development Communications Project Implementation Project Timeline: July 1, 2026 – December 31, 2026

The Professional will provide strategic marketing, communications, branding, and creative services to support the City's economic development objectives. Services may include planning, content development, creative direction, stakeholder coordination, marketing execution, and related consulting activities.

Projects may include: Marketing Videos Coordination and Creative Content, Branding and Collateral Creation, Digital Communications and Website Support, Social Media and Content Creation (20-30 social media posts), Paid Media Planning and Support, Email Communication Support, and General Consulting Services for Marketing and Communications.

Services will be provided on an as-needed basis and billed hourly. Specific tasks, deliverables, and timelines will be mutually agreed upon in writing prior to the commencement of work.

ITEM 9.14.

ATTACHMENT 2

Page 539 of 654 ends

CONTRACT NO. 2025-271-2

Second Amendment to Professional Services Agreement between City of Rancho Cordova and Creative Noggin, LLC – Exhibit A Page 5 of 5 Revised 06/2025

Work plan for the Communications and Graphic Design Support for the RCYC and RCCP

ITEM 9.14.

ATTACHMENT 2

Page 540 of 654 ends

CONTRACT NO. 2025-271-2

Second Amendment to Professional Services Agreement between City of Rancho Cordova and Creative Noggin, LLC – Exhibit B Page 1 of 4 Revised 06/2025

EXHIBIT B

COMPENSATION SCHEDULE

Communications and Graphic Design Support for the Rancho Cordova Youth Center (RCYC) and Rancho Cordova Promise Program (RCCP)

Professional shall be compensated for all services performed under this Agreement on a time-and- materials basis at a single blended hourly rate of One Hundred Fifty Dollars ($150.00) per hour for all classifications of Professional’s staff and services.

These services include:
• Marketing planning and strategy
• Account service
• Project management
• Creative concepting
• Copywriting
• Art direction
• Digital strategy and management
• Search Engine Optimization (SEO)
• Generative Engine Optimization (GEO, i.e. AI search optimization) • Design
• Website development

Marketing Services Estimates

1. City Onboarding, Research & Discovery
a. Onboarding
i. Set up as a client in Professional systems.
ii. Gain access to all necessary assets (website, analytics, dashboard, Meta, etc.). iii. Gain access to photo and video library, marketing and collateral files, past advertising history, etc.
b. Kickoff meeting
i. Identify key attendees.
ii. Schedule.
iii. Prepare agenda and discovery guide and share with client. iv. Conduct meeting.
v. Define goals, progress reporting needs and on-going meeting frequency. c. Research
i. Client, audience and industry research.
ii. Competitive research.

Approximately 23 hours ............................................................................. $3,400

ITEM 9.14.

ATTACHMENT 2

Page 541 of 654 ends

CONTRACT NO. 2025-271-2

Second Amendment to Professional Services Agreement between City of Rancho Cordova and Creative Noggin, LLC – Exhibit B Page 2 of 4 Revised 06/2025

2. Content Marketing
a. Social media writing and design as well as management of the overall monthly editorial calendar to ensure consistency in all channels of communications (managed quarterly at 4 posts per quarter = 60 hours over 18 months).
i. Includes set up and scheduling of all social media on city’s Hootsuite account. b. Update RCYC programming guide (five times over 18 months = 52 hours). c. Update RCYC flyers annually (2x over 18 months = 18 hours). d. Design RCCP flyers for high school and veterans in 2026 and update in 2027 (12 hours). e. Refresh RCCP and RCYC digital billboard ad quarterly (36 hours). f. Create RCCP and RCYC newsletter templates (10 hours).

Approximately 188 hours.............................................................................. $28,200

g. General original media assets (photo, video shots and reels) – quarterly i. Includes one pre-production meeting prior to each quarterly shoot day, concept creation, all shoot set-up and planning, background, interviewing if necessary, logging and script.
ii. ½-day shoot (up to 4 hours), 1–2 locations, 2–3-person video and still photo crew. iii. Deliverable of 25 edited photos, 3–5 short vertical reels (15–30 seconds) and 1 compiled horizontal 30–60 second cut for website.
iv. Includes captions, subtitles to meet city’s brand guidelines and licensed music if requested.
v. Includes one round of video edits.

$5,850 per quarter (x 6 quarters) .......................................................... $35,100

3. Digital Marketing & SEO
a. Optimize RCCP and RCYC webpages for local search and ensure mobile-friendly sign-up forms (14 hours).
i. On-page optimization (titles/meta/headers/alt text), local listings, basic schema where appropriate, and GA4/Search Console integration.
b. Conduct current search and keyword research, analyze current on-site content SEO and identify opportunities for improved/additional content to enhance organic search traction; does not include writing content; Professional can provide estimate once needs are determined (4 hours).
c. Collaborate with City to strategize and manage advertising on Nextdoor and Meta (Facebook and Instagram) to grow following and increase engagement with targeted demographics (assumes 6 campaigns over 18-month period, planned quarterly; 90 hours).
i. Includes optimization of accounts based upon reporting/dashboard findings. d. Costs do not include writing of SEO content for website, only recommendations.

Requested services (108 hours) ............................................................. $16,200

ITEM 9.14.

ATTACHMENT 2

Page 542 of 654 ends

CONTRACT NO. 2025-271-2

Second Amendment to Professional Services Agreement between City of Rancho Cordova and Creative Noggin, LLC – Exhibit B Page 3 of 4 Revised 06/2025

4. Success Measurement & Reporting – Custom Monthly Reporting a. Professional will work with city to gain access to all desired platforms that the city would like included in report.
b. Professional will develop the template for a custom, PDF-based report that will be run monthly and sent to the city.
c. Monthly report will be automatically generated and emailed to the city. d. Includes set-up of report, as well as monitoring.
e. Assumes first report at the end of February 2026 with last report in June of 2027.

Estimated 24 hours for set-up and monthly review ................................. $3,600

5. Account & Project Management
a. Attend and contribute to team meetings and brainstorm sessions. b. Weekly or bi-weekly meetings to discuss project status, move things forward and keep abreast of city happenings and needs.
c. Conduct outreach and communications with city, as needed, to gather information for social and story content.
d. Internal management of projects to ensure deliverables meet city needs, are strategically aligned, and are on time and on budget.

Estimated 90 hours ............................................................................... $13,500

6. Marketing Services Budget
a. As there will be a larger amount of time spent up front with onboarding, discovery, setting up of campaigns, new templates, reports, etc., Professional will invoice on a monthly basis for the hours that were accrued the month prior, per section 2.1 of this Agreement.

The Professional will track hours against budget and provide a regular monthly update to ensure Professional is on track and on budget.

Economic Development Communications Strategy & Implementation Toolkit

1. Communications Strategy & Implementation Toolkit

Estimated 200 hours ............................................................................... $30,000

2. Project Implementation

Estimated 200 hours ............................................................................... $30,000

ITEM 9.14.

ATTACHMENT 2

Page 543 of 654 ends

CONTRACT NO. 2025-271-2

Second Amendment to Professional Services Agreement between City of Rancho Cordova and Creative Noggin, LLC – Exhibit B Page 4 of 4 Revised 06/2025

The total compensation for the Communications and Graphic Design Support for the Rancho Cordova Youth Center (RCYC) and Rancho Cordova Promise Program (RCCP) and the Economic Development Communications Strategy & Implementation shall not exceed One-Hundred Sixty Thousand dollars ($160,000).

ITEM 9.14.

ATTACHMENT 2

Page 544 of 654 ends

MEMORANDUM

City Council Staff Report - Page 1 of 3

ITEM 11.1.

DATE: June 15, 2026

TO: Honorable Mayor and Council Members

FROM: Brenda Roach, Assistant Director of Administrative Services - Human Resources

SUBJECT: CITY OF RANCHO CORDOVA'S 2025 VACANCIES, RECRUITMENT

AND RETENTION EFFORTS (COMPLIANCE WITH ASSEMBLY BILL
2561/GOVERNMENT CODE SECTION 3502.3)

RECOMMENDATION

Receive a presentation regarding the city's vacancies, recruitment and retention efforts pursuant to Assembly Bill (AB) 2561.

RESULT OF RECOMMENDED ACTION

This item is for informational purposes only. No action is required.

BACKGROUND

Assembly Bill (AB) 2561 was enacted into law and codified as Government Code section 3502.3 effective January 1, 2025. The bill was introduced to address the issue of job vacancies in local government, which adversely affects the delivery of public services and negatively impacts employee workload.

AB 2561 established several annual reporting requirements for local agencies, including:

1. Holding at least one (1) public hearing each fiscal year to present the status of vacant positions and related recruitment and retention strategies.

2. Hold the hearing prior to the adoption of an annual or multi-year budget, if applicable.

3. Identify any necessary changes to policies, procedures, or recruitment practices that may hinder hiring efforts.

4. Provide recognized employee organizations the opportunity to present during the hearing.

The City of Rancho Cordova does not currently have employee organizations representing city staff; therefore, the fourth requirement is not applicable.

During calendar year 2025, the city maintained a relatively low vacancy rate, averaging approximately five percent (5%) across regular full-time positions. A total of six (6) employees separated from city service during the year. Vacancies occurred for a variety of reasons, including retirements, promotional opportunities, newly added positions, and employee transitions to other organizations.

Page 545 of 654 ends

City Council Staff Report - Page 2 of 3

Despite ongoing competition in the public-sector labor market, the city continued to make progress in filling vacant positions throughout the year, particularly following the addition of four (4) newly budgeted positions in July 2025. A month-by-month summary of vacancies, separations, hiring activity, and promotions is provided in Table 1.

Table 1: 2025 Vacancies Per Month

2025 Jan Feb Mar Apr May June
# of Vacancies 10.00 10.00 9.00 9.00 9.00 6.00
# of Separations 0 1 0 0 0 0
# of New Hires 2 1 1 0 0 3
# of Promotions 4 0 10 0 0 0
# of Budgeted
FTEs
126.00 126.00 126.00 126.00 126.00 126.00
% of Vacancies 8% 8% 7% 7% 7% 5%
2025 July Aug Sep Oct Nov Dec
# of Vacancies 5.00 5.00 3.00 4.00 5.00 5.00
# of Separations 1 1 0 1 0 2
# of New Hires 2 2 2 1 0 2
# of Promotions 0 2 0 3 3 2
# of Budgeted
FTEs
130.00 130.00 130.00 130.00 130.00 130.00
% of Vacancies 4% 4% 2% 3% 4% 4%

Page 546 of 654 ends

City Council Staff Report - Page 3 of 3

Consistent with AB 2561 requirements, staff reviewed current recruitment and hiring practices to evaluate whether any policies or procedures may be creating barriers to attracting qualified candidates. At this time, staff did not identify any significant impediments within the city’s hiring process.

The city continues to support recruitment and retention through competitive compensation, comprehensive benefits, professional development opportunities, and organizational flexibility where appropriate. Similar to regional trends experienced by other public agencies, recruitment remains challenging in certain specialized classifications, particularly traffic engineering positions, due to a limited pool of qualified candidates and strong market competition.

Staff will continue to monitor workforce trends and evaluate opportunities to enhance recruitment outreach, streamline hiring processes, and support long-term employee retention.

FISCAL IMPACT AND FUNDING SOURCE

There is no fiscal impact associated with this report.

ATTACHMENT(S)

None

Page 547 of 654 ends

MEMORANDUM

City Council Staff Report - Page 1 of 2

ITEM 12.1.

DATE: June 15, 2026

TO: Honorable Mayor and Council Members

FROM: Brenda Roach, Assistant Director of Administrative Services - Human Resources

SUBJECT: A RESOLUTION APPROVING THE FISCAL YEAR 2026-27 SALARY

SCHEDULE AND IDENTIFYING EXCEPTIONAL PERFORMANCE

BONUS PROGRAM ELIGIBILITY

RECOMMENDATION

Adopt the Resolution.

RESULT OF RECOMMENDED ACTION

Adoption of the Fiscal Year 2026–27 Salary Schedule shall replace all previously adopted salary schedules and shall become effective on July 5, 2026. This action also identifies classifications eligible to receive a performance bonus as required by CalPERS and SB 707 transparency requirements.

BACKGROUND

The City of Rancho Cordova annually reviews and adopts a salary schedule to ensure compensation structures remain current, competitive, and aligned with organizational needs.

The salary schedule establishes the authorized salary ranges for all city classifications and is maintained in accordance with California Public Employees’ Retirement System (CalPERS) regulations, including California Code of Regulations, Title 2, Section 570.5, which requires public agencies to maintain and publicly adopt a salary schedule. Adoption of the salary schedule established authorized ranges only and does not establish or modify the salary of any individual employee.

In addition to adopting the salary schedule, the city is identifying classifications eligible for participation in the Exceptional Performance Bonus Program. The program originated in 2003 with the city’s first City Manager employment agreement and was established to recognize exceptional performance and contributions that advance city priorities and strategic objectives.

Recent amendments to the Brown Act through Senate Bill 707, effective January 1, 2026, require additional public transparency regarding executive compensation prior to final approval by a legislative body. Consistent with those requirements, the city is publicly identifying the structure of the Exceptional Performance Bonus Program and the classifications eligible to participate. Pursuant to Government code section 54953(d)(3), the City Manager will provide an oral report to the City Council identifying any proposed exceptional performance bonus awards and the amount of each award prior to final Council action authorizing payment. Eligible

Page 548 of 654 ends

City Council Staff Report - Page 2 of 2

classifications may receive an exceptional performance bonus of up to five percent (5%) of annual base pay. Eligibility does not guarantee an award. Any performance bonus is discretionary, based on individual performance, subject to City Manager approval, and contingent upon available funding.

Pursuant to California Code of Regulations, Title 2, Section 571(a)(1) and (a)(5), compensation programs recognized by CalPERS must be available to a group or class of employees rather than a single individual. Accordingly, the City Manager has designated certain executive and management classifications as eligible for participation in the Exceptional Performance Bonus Program, as identified in Exhibit B to the Resolution (Attachment 3).

FISCAL IMPACT AND FUNDING SOURCE

Adoption of the salary schedule establishes authorized compensation ranges but does not create an immediate fiscal impact. Any exceptional performance bonuses awarded would be funded within the approved Fiscal Year 2025-27 operating budget.

ATTACHMENT(S)

1. Resolution

2. Exhibit A to the Resolution - FY 2026-2027 Salary Schedule

3. Exhibit B to the Resolution - Exceptional Performance Bonus List

Page 549 of 654 ends

ITEM 12.1. ATTACHMENT 1 Resolution No. XX-2026 Page 1 of 2

CITY OF RANCHO CORDOVA

RESOLUTION NO. XX-2026

A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF RANCHO CORDOVA, STATE

OF CALIFORNIA, ADOPTING THE FULL-TIME EMPLOYEE SALARY SCHEDULE AND

ACKNOWLEDGING THE EXCEPTIONAL PERFORMANCE BONUS PROGRAM

WHEREAS, the City of Rancho Cordova annually reviews and adopts a salary schedule establishing authorized salary ranges for the city classifications; and

WHEREAS, the City Manager has the authority to recommend and implement adjustments to the salary schedule to ensure the city maintains a competitive compensation program; and

WHEREAS, the Fiscal Year 2025-2027 Operating Budget anticipates salary adjustments for each of the two fiscal years in accordance with the city’s compensation philosophy; and,

WHEREAS, Title 2, California Code of Regulations, Section 570.5 requires that all pay schedules be made publicly available and approved by the City Council; and

WHEREAS, the Fiscal Year 2026-2027 Salary Schedule shall become effective beginning with the pay period commencing on July 5, 2026; and

WHEREAS, Government Code section 3511.2, as amended by Senate Bill 707, requires public disclosure of executive compensation prior to final approval by a legislative body; and

WHEREAS, the city maintains an Exceptional Performance Bonus Program for designated classifications; and

WHEREAS, the City Manager has designated the classifications identified in Exhibit B as eligible for participation in the Exceptional Performance Bonus Program.

NOW, THEREFORE, BE IT HEREBY RESOLVED THE CITY COUNCIL OF THE CITY OF RANCHO CORDOVA approves and adopts the Fiscal Year 2026-2027 Salary Schedule attached hereto as Exhibit A, effective July 5, 2026, and identifies the classifications listed in Exhibit B as eligible classifications under the city's Exceptional Performance Bonus Program.

PASSED AND ADOPTED by the City Council of the City of Rancho Cordova on the 15th day of June 2026 by the following vote:

AYES:

NOES:

ABSENT:

ABSTAIN:

Page 550 of 654 ends

ITEM 12.1. ATTACHMENT 1 Resolution No. XX-2026 Page 2 of 2 ATTEST:

Garrett Gatewood, Mayor

Stacy Leitner, CMC
City Clerk

Page 551 of 654 ends

Classification
Step A
Hourly
Step A
Monthly
Step A1
Hourly
Step A1
Monthly
Step B
Hourly
Step B
Monthly
Step B1
Hourly
Step B1
Monthly
Step C
Hourly
Step C
Monthly
Step C1
Hourly
Step C1
Monthly
Step D
Hourly
Step D
Monthly
Step D1
Hourly
Step D1
Monthly
Step E
Hourly
Step E
Monthly
Accountant 44.47$ 7,708.46$ 45.58$ 7,901.16$ 46.72$ 8,098.70$ 47.89$ 8,301.17$ 49.09$ 8,508.70$ 50.32$ 8,721.40$ 51.57$ 8,939.45$ 52.86$ 9,162.92$ 54.18$ 9,392.00$ Accounting Technician 32.31$ 5,600.40$ 33.12$ 5,740.80$ 33.95$ 5,884.67$ 34.80$ 6,032.00$ 35.67$ 6,182.80$ 36.56$ 6,337.07$ 37.47$ 6,494.80$ 38.41$ 6,657.73$ 39.37$ 6,824.00$ Administrative Assistant I 31.38$ 5,439.20$ 32.16$ 5,574.40$ 32.97$ 5,714.80$ 33.79$ 5,856.93$ 34.63$ 6,002.53$ 35.50$ 6,153.33$ 36.39$ 6,307.60$ 37.30$ 6,465.33$ 38.23$ 6,627.27$ Administrative Assistant II 34.52$ 5,983.47$ 35.38$ 6,132.53$ 36.27$ 6,286.80$ 37.18$ 6,444.53$ 38.10$ 6,604.00$ 39.06$ 6,770.40$ 40.03$ 6,938.53$ 41.03$ 7,111.87$ 42.06$ 7,290.00$ Administrative Services Director 95.67$ 16,582.37$ 98.06$ 16,996.92$ 100.51$ 17,421.84$ 103.02$ 17,857.39$ 105.60$ 18,303.83$ 108.24$ 18,761.43$ 110.94$ 19,230.45$ 113.72$ 19,711.21$ 116.56$ 20,204.00$ Animal Services Officer I 31.15$ 5,399.33$ 31.93$ 5,534.53$ 32.72$ 5,671.47$ 33.55$ 5,815.33$ 34.38$ 5,959.20$ 35.24$ 6,108.27$ 36.12$ 6,260.80$ 37.02$ 6,416.80$ 37.95$ 6,577.27$ Animal Services Officer II 34.26$ 5,938.40$ 35.11$ 6,085.73$ 35.99$ 6,238.27$ 36.90$ 6,396.00$ 37.81$ 6,553.73$ 38.76$ 6,718.40$ 39.73$ 6,886.53$ 40.72$ 7,058.13$ 41.74$ 7,235.00$ Assistant Administrative Services Director - Finance 83.18$ 14,417.22$ 85.26$ 14,777.66$ 87.39$ 15,147.10$ 89.57$ 15,525.77$ 91.81$ 15,913.93$ 94.11$ 16,311.77$ 96.46$ 16,719.56$ 98.87$ 17,137.55$ 101.34$ 17,566.00$ Assistant Administrative Services Director - Human Resources 83.18$ 14,417.26$ 85.26$ 14,777.69$ 87.39$ 15,147.12$ 89.57$ 15,525.79$ 91.81$ 15,913.93$ 94.11$ 16,311.77$ 96.46$ 16,719.56$ 98.87$ 17,137.55$ 101.34$ 17,566.00$ Assistant City Clerk 58.62$ 10,160.02$ 60.08$ 10,414.02$ 61.58$ 10,674.37$ 63.12$ 10,941.23$ 64.70$ 11,214.75$ 66.32$ 11,495.12$ 67.98$ 11,782.51$ 69.68$ 12,077.07$ 71.42$ 12,379.00$ Assistant City Manager 105.23$ 18,240.28$ 107.86$ 18,696.28$ 110.56$ 19,163.69$ 113.32$ 19,642.78$ 116.16$ 20,133.84$ 119.06$ 20,637.20$ 122.04$ 21,153.12$ 125.09$ 21,681.94$ 128.22$ 22,224.00$ Assistant Civil Engineer 49.35$ 8,554.30$ 50.59$ 8,768.18$ 51.85$ 8,987.38$ 53.15$ 9,212.06$ 54.48$ 9,442.36$ 55.84$ 9,678.41$ 57.23$ 9,920.39$ 58.66$ 10,168.38$ 60.13$ 10,422.61$ Assistant Community Development Director 83.18$ 14,417.26$ 85.26$ 14,777.69$ 87.39$ 15,147.12$ 89.57$ 15,525.79$ 91.81$ 15,913.93$ 94.11$ 16,311.77$ 96.46$ 16,719.56$ 98.87$ 17,137.55$ 101.34$ 17,566.00$ Assistant Planner 42.50$ 7,367.32$ 43.57$ 7,551.51$ 44.66$ 7,740.29$ 45.77$ 7,933.81$ 46.92$ 8,132.15$ 48.09$ 8,335.45$ 49.29$ 8,543.84$ 50.52$ 8,757.43$ 51.79$ 8,976.36$ Assistant Public Works Director 83.18$ 14,417.22$ 85.26$ 14,777.66$ 87.39$ 15,147.10$ 89.57$ 15,525.77$ 91.81$ 15,913.93$ 94.11$ 16,311.77$ 96.46$ 16,719.56$ 98.87$ 17,137.55$ 101.34$ 17,566.00$ Assistant to the City Manager 67.14$ 11,637.77$ 68.82$ 11,928.71$ 70.54$ 12,226.93$ 72.30$ 12,532.61$ 74.11$ 12,845.93$ 75.96$ 13,167.07$ 77.86$ 13,496.25$ 79.81$ 13,833.65$ 81.80$ 14,179.50$ Assistant Transportation Planner 44.70$ 7,748.59$ 45.82$ 7,942.31$ 46.97$ 8,140.86$ 48.14$ 8,344.38$ 49.34$ 8,552.98$ 50.58$ 8,766.81$ 51.84$ 8,985.99$ 53.14$ 9,210.63$ 54.47$ 9,440.91$ Associate Civil Engineer 56.75$ 9,837.47$ 58.17$ 10,083.41$ 59.63$ 10,335.50$ 61.12$ 10,593.87$ 62.65$ 10,858.73$ 64.21$ 11,130.19$ 65.82$ 11,408.45$ 67.46$ 11,693.65$ 69.15$ 11,986.00$ Associate Planner 46.75$ 8,104.05$ 47.92$ 8,306.65$ 49.12$ 8,514.33$ 50.35$ 8,727.18$ 51.61$ 8,945.37$ 52.90$ 9,168.99$ 54.22$ 9,398.22$ 55.58$ 9,633.17$ 56.97$ 9,874.00$ Associate Transportation Planner 49.17$ 8,523.45$ 50.40$ 8,736.54$ 51.66$ 8,954.96$ 52.95$ 9,178.82$ 54.28$ 9,408.30$ 55.64$ 9,643.51$ 57.03$ 9,884.59$ 58.45$ 10,131.72$ 59.91$ 10,385.00$ Building Inspector I 39.15$ 6,786.00$ 40.13$ 6,955.87$ 41.13$ 7,129.20$ 42.16$ 7,307.73$ 43.21$ 7,489.73$ 44.29$ 7,676.93$ 45.40$ 7,869.33$ 46.54$ 8,066.93$ 47.70$ 8,268.18$ Building Inspector II 43.06$ 7,463.73$ 44.14$ 7,650.93$ 45.24$ 7,841.60$ 46.38$ 8,039.20$ 47.54$ 8,240.27$ 48.72$ 8,444.80$ 49.94$ 8,656.27$ 51.19$ 8,872.93$ 52.47$ 9,095.00$ Building Inspector Supervisor 59.06$ 10,236.74$ 60.53$ 10,492.67$ 62.05$ 10,754.99$ 63.60$ 11,023.87$ 65.19$ 11,299.47$ 66.82$ 11,581.96$ 68.49$ 11,871.51$ 70.20$ 12,168.30$ 71.96$ 12,472.50$ Building Permit Services Supervisor 42.11$ 7,298.87$ 43.17$ 7,481.35$ 44.24$ 7,668.38$ 45.36$ 7,860.08$ 46.48$ 8,056.58$ 47.65$ 8,257.99$ 48.84$ 8,464.43$ 50.06$ 8,676.05$ 51.31$ 8,892.95$ Building Permit Technician I 30.26$ 5,245.07$ 31.02$ 5,376.80$ 31.79$ 5,510.27$ 32.59$ 5,648.93$ 33.40$ 5,789.33$ 34.24$ 5,934.93$ 35.09$ 6,082.27$ 35.97$ 6,234.80$ 36.87$ 6,390.91$ Building Permit Technician II 33.29$ 5,770.27$ 34.12$ 5,914.13$ 34.97$ 6,061.47$ 35.85$ 6,214.00$ 36.75$ 6,370.00$ 37.66$ 6,527.73$ 38.61$ 6,692.40$ 39.57$ 6,858.80$ 40.56$ 7,030.00$ Building Plans Examiner I 40.60$ 7,036.81$ 41.61$ 7,212.73$ 42.65$ 7,393.04$ 43.72$ 7,577.85$ 44.81$ 7,767.31$ 45.93$ 7,961.48$ 47.08$ 8,160.51$ 48.26$ 8,364.53$ 49.46$ 8,573.64$ Building Plans Examiner II 44.66$ 7,740.46$ 45.77$ 7,933.97$ 46.92$ 8,132.32$ 48.09$ 8,335.62$ 49.29$ 8,544.01$ 50.52$ 8,757.60$ 51.79$ 8,976.54$ 53.08$ 9,200.97$ 54.41$ 9,431.00$ Chief Building Official 72.21$ 12,515.56$ 74.01$ 12,828.44$ 75.86$ 13,149.18$ 77.76$ 13,477.90$ 79.70$ 13,814.84$ 81.69$ 14,160.21$ 83.74$ 14,514.22$ 85.83$ 14,877.07$ 87.98$ 15,249.00$ Chief Innovation/Information Officer 95.67$ 16,582.37$ 98.06$ 16,996.92$ 100.51$ 17,421.84$ 103.02$ 17,857.39$ 105.60$ 18,303.83$ 108.24$ 18,761.43$ 110.94$ 19,230.45$ 113.72$ 19,711.21$ 116.56$ 20,204.00$ City Clerk 75.68$ 13,117.17$ 77.57$ 13,445.10$ 79.51$ 13,781.24$ 81.49$ 14,125.76$ 83.53$ 14,478.90$ 85.62$ 14,840.89$ 87.76$ 15,211.91$ 89.96$ 15,592.20$ 92.20$ 15,982.00$ City Manager (1/1/2026 - 12/31/2026) 152.88$ 26,500.00$ Code Enforcement Manager 64.34$ 11,152.85$ 65.95$ 11,431.68$ 67.60$ 11,717.46$ 69.29$ 12,010.40$ 71.02$ 12,310.65$ 72.80$ 12,618.43$ 74.62$ 12,933.90$ 76.48$ 13,257.25$ 78.40$ 13,588.69$ Code Enforcement Officer I 33.58$ 5,820.53$ 34.42$ 5,966.13$ 35.28$ 6,115.20$ 36.16$ 6,267.73$ 37.06$ 6,423.73$ 37.99$ 6,584.93$ 38.94$ 6,749.60$ 39.91$ 6,917.73$ 40.91$ 7,090.91$ Code Enforcement Officer II 36.93$ 6,401.20$ 37.86$ 6,562.40$ 38.80$ 6,725.33$ 39.78$ 6,895.20$ 40.77$ 7,066.80$ 41.79$ 7,243.60$ 42.83$ 7,423.87$ 43.90$ 7,609.33$ 45.00$ 7,800.00$ Communications and Public Affairs Director 95.67$ 16,582.37$ 98.06$ 16,996.92$ 100.51$ 17,421.84$ 103.02$ 17,857.39$ 105.60$ 18,303.83$ 108.24$ 18,761.43$ 110.94$ 19,230.45$ 113.72$ 19,711.21$ 116.56$ 20,204.00$ Communications Manager 64.34$ 11,152.85$ 65.95$ 11,431.68$ 67.60$ 11,717.46$ 69.29$ 12,010.40$ 71.02$ 12,310.65$ 72.80$ 12,618.43$ 74.62$ 12,933.90$ 76.48$ 13,257.25$ 78.40$ 13,588.69$ Communications Officer I 42.23$ 7,319.56$ 43.28$ 7,502.56$ 44.37$ 7,690.11$ 45.48$ 7,882.36$ 46.61$ 8,079.44$ 47.78$ 8,281.41$ 48.97$ 8,488.44$ 50.20$ 8,700.66$ 51.45$ 8,918.18$ Communications Officer II 46.45$ 8,051.53$ 47.61$ 8,252.81$ 48.80$ 8,459.12$ 50.02$ 8,670.61$ 51.27$ 8,887.36$ 52.56$ 9,109.56$ 53.87$ 9,337.29$ 55.22$ 9,570.73$ 56.60$ 9,810.00$ Community Development Director 95.67$ 16,582.37$ 98.06$ 16,996.92$ 100.51$ 17,421.84$ 103.02$ 17,857.39$ 105.60$ 18,303.83$ 108.24$ 18,761.43$ 110.94$ 19,230.45$ 113.72$ 19,711.21$ 116.56$ 20,204.00$ Community Engagement Manager 64.34$ 11,152.85$ 65.95$ 11,431.68$ 67.60$ 11,717.46$ 69.29$ 12,010.40$ 71.02$ 12,310.65$ 72.80$ 12,618.43$ 74.62$ 12,933.90$ 76.48$ 13,257.25$ 78.40$ 13,588.69$ Community Services Director 95.67$ 16,582.35$ 98.06$ 16,996.89$ 100.51$ 17,421.82$ 103.02$ 17,857.36$ 105.60$ 18,303.81$ 108.24$ 18,761.41$ 110.94$ 19,230.45$ 113.72$ 19,711.21$ 116.56$ 20,204.00$ Customer Service Representative I 23.32$ 4,042.13$ 23.90$ 4,142.67$ 24.50$ 4,246.67$ 25.12$ 4,354.13$ 25.74$ 4,461.60$ 26.38$ 4,572.53$ 27.04$ 4,686.93$ 27.72$ 4,804.80$ 28.41$ 4,924.55$ Customer Service Representative II 25.65$ 4,446.00$ 26.29$ 4,556.93$ 26.95$ 4,671.33$ 27.63$ 4,789.20$ 28.31$ 4,907.07$ 29.02$ 5,030.13$ 29.74$ 5,154.93$ 30.49$ 5,284.93$ 31.25$ 5,417.00$ Deputy City Clerk 36.39$ 6,307.60$ 37.30$ 6,465.33$ 38.23$ 6,626.53$ 39.20$ 6,794.67$ 40.17$ 6,962.80$ 41.17$ 7,136.13$ 42.20$ 7,314.67$ 43.26$ 7,498.40$ 44.34$ 7,686.00$ Development Senior Analyst 65.27$ 11,313.08$ 66.90$ 11,595.91$ 68.57$ 11,885.81$ 70.29$ 12,182.95$ 72.04$ 12,487.52$ 73.84$ 12,799.71$ 75.69$ 13,119.71$ 77.58$ 13,447.70$ 79.52$ 13,783.90$ Economic Development Director 95.67$ 16,582.37$ 98.06$ 16,996.92$ 100.51$ 17,421.84$ 103.02$ 17,857.39$ 105.60$ 18,303.83$ 108.24$ 18,761.43$ 110.94$ 19,230.45$ 113.72$ 19,711.21$ 116.56$ 20,204.00$ Economic Development Manager 70.30$ 12,186.03$ 72.06$ 12,490.68$ 73.86$ 12,802.94$ 75.71$ 13,123.02$ 77.60$ 13,451.10$ 79.54$ 13,787.37$ 81.53$ 14,132.04$ 83.57$ 14,485.34$ 85.66$ 14,847.48$ Engineering Technician I 34.91$ 6,051.07$ 35.78$ 6,201.87$ 36.67$ 6,356.13$ 37.60$ 6,517.33$ 38.53$ 6,678.53$ 39.49$ 6,844.93$ 40.48$ 7,016.53$ 41.49$ 7,191.60$ 42.53$ 7,371.82$ Engineering Technician II 38.39$ 6,654.27$ 39.35$ 6,820.67$ 40.34$ 6,992.27$ 41.35$ 7,167.33$ 42.38$ 7,345.87$ 43.44$ 7,529.60$ 44.53$ 7,718.53$ 45.64$ 7,910.93$ 46.78$ 8,109.00$ Events Attendant 20.28$ 3,515.20$ 20.79$ 3,603.60$ 21.31$ 3,693.73$ 21.85$ 3,787.33$ 22.39$ 3,880.93$ 22.95$ 3,978.00$ 23.52$ 4,076.80$ 24.11$ 4,179.07$ 24.71$ 4,282.21$ Events Coordinator I 30.91$ 5,357.73$ 31.68$ 5,491.20$ 32.47$ 5,628.13$ 33.29$ 5,770.27$ 34.12$ 5,914.13$ 34.97$ 6,061.47$ 35.85$ 6,214.00$ 36.74$ 6,368.27$ 37.66$ 6,528.18$ Events Coordinator II 34.00$ 5,893.33$ 34.85$ 6,040.67$ 35.72$ 6,191.47$ 36.62$ 6,347.47$ 37.53$ 6,505.20$ 38.47$ 6,668.13$ 39.43$ 6,834.53$ 40.42$ 7,006.13$ 41.43$ 7,181.00$ Facilities Maintenance Technician I 31.40$ 5,442.67$ 32.19$ 5,579.60$ 32.99$ 5,718.27$ 33.82$ 5,862.13$ 34.66$ 6,007.73$ 35.53$ 6,158.53$ 36.42$ 6,312.80$ 37.33$ 6,470.53$ 38.26$ 6,630.91$ Facilities Maintenance Technician II 34.54$ 5,986.93$ 35.40$ 6,136.00$ 36.29$ 6,290.27$ 37.20$ 6,448.00$ 38.12$ 6,607.47$ 39.08$ 6,773.87$ 40.05$ 6,942.00$ 41.05$ 7,115.33$ 42.08$ 7,294.00$ Facilities Services Manager 56.74$ 9,835.02$ 58.16$ 10,080.89$ 59.61$ 10,332.92$ 61.10$ 10,591.23$ 62.63$ 10,856.02$ 64.20$ 11,127.42$ 65.80$ 11,405.59$ 67.45$ 11,690.75$ 69.13$ 11,983.00$ Finance Analyst I 45.67$ 7,916.46$ 46.81$ 8,114.36$ 47.98$ 8,317.23$ 49.18$ 8,525.16$ 50.41$ 8,738.30$ 51.67$ 8,956.76$ 52.97$ 9,180.69$ 54.29$ 9,410.20$ 55.65$ 9,645.45$ Finance Analyst II 50.24$ 8,708.12$ 51.50$ 8,925.82$ 52.78$ 9,148.97$ 54.10$ 9,377.68$ 55.45$ 9,612.14$ 56.84$ 9,852.44$ 58.26$ 10,098.75$ 59.72$ 10,351.21$ 61.21$ 10,610.00$ Finance Manager 69.19$ 11,992.74$ 70.92$ 12,292.56$ 72.69$ 12,599.88$ 74.51$ 12,914.87$ 76.37$ 13,237.75$ 78.28$ 13,568.69$ 80.24$ 13,907.92$ 82.24$ 14,255.61$ 84.30$ 14,612.00$ Housing Manager 64.34$ 11,152.85$ 65.95$ 11,431.68$ 67.60$ 11,717.46$ 69.29$ 12,010.40$ 71.02$ 12,310.65$ 72.80$ 12,618.43$ 74.62$ 12,933.90$ 76.48$ 13,257.25$ 78.40$ 13,588.69$ Human Resources Analyst I 46.33$ 8,029.88$ 47.48$ 8,230.63$ 48.67$ 8,436.39$ 49.89$ 8,647.30$ 51.14$ 8,863.49$ 52.41$ 9,085.07$ 53.72$ 9,312.20$ 55.07$ 9,545.01$ 56.44$ 9,783.64$ Human Resources Analyst II 50.96$ 8,832.87$ 52.23$ 9,053.70$ 53.54$ 9,280.05$ 54.88$ 9,512.04$ 56.25$ 9,749.85$ 57.66$ 9,993.60$ 59.10$ 10,243.44$ 60.57$ 10,499.52$ 62.09$ 10,762.00$ Human Resources Manager 70.11$ 12,151.97$ 71.86$ 12,455.78$ 73.66$ 12,767.17$ 75.50$ 13,086.34$ 77.39$ 13,413.51$ 79.32$ 13,748.84$ 81.30$ 14,092.56$ 83.34$ 14,444.89$ 85.42$ 14,806.00$ Human Resources Technician I 34.50$ 5,980.00$ 35.36$ 6,129.07$ 36.24$ 6,281.60$ 37.15$ 6,439.33$ 38.08$ 6,600.53$ 39.03$ 6,765.20$ 40.00$ 6,933.33$ 41.00$ 7,106.67$ 42.03$ 7,285.45$ Human Resources Technician II 37.94$ 6,576.27$ 38.89$ 6,740.93$ 39.86$ 6,909.07$ 40.87$ 7,084.13$ 41.88$ 7,259.20$ 42.93$ 7,441.20$ 44.00$ 7,626.67$ 45.10$ 7,817.33$ 46.23$ 8,014.00$ Information Technology Analyst I 44.26$ 7,671.76$ 45.37$ 7,863.55$ 46.50$ 8,060.13$ 47.66$ 8,261.63$ 48.85$ 8,468.18$ 50.08$ 8,679.88$ 51.33$ 8,896.88$ 52.61$ 9,119.31$ 53.93$ 9,347.27$ Information Technology Analyst II 48.69$ 8,438.93$ 49.90$ 8,649.90$ 51.15$ 8,866.13$ 52.43$ 9,087.80$ 53.74$ 9,315.00$ 55.08$ 9,547.87$ 56.46$ 9,786.55$ 57.87$ 10,031.23$ 59.32$ 10,282.00$ Information Technology Manager 71.01$ 12,308.73$ 72.79$ 12,616.46$ 74.61$ 12,931.86$ 76.47$ 13,255.17$ 78.38$ 13,586.54$ 80.34$ 13,926.21$ 82.35$ 14,274.35$ 84.41$ 14,631.22$ 86.52$ 14,997.00$ Information Technology Technician 40.77$ 7,066.80$ 41.79$ 7,243.60$ 42.84$ 7,425.60$ 43.91$ 7,611.07$ 45.01$ 7,801.73$ 46.13$ 7,995.87$ 47.29$ 8,196.93$ 48.47$ 8,401.47$ 49.68$ 8,612.00$ Maintenance & Operations Supervisor 48.70$ 8,442.18$ 49.92$ 8,653.23$ 51.17$ 8,869.58$ 52.45$ 9,091.31$ 53.76$ 9,318.60$ 55.11$ 9,551.56$ 56.48$ 9,790.34$ 57.89$ 10,035.11$ 59.34$ 10,286.00$ Maintenance & Operations Technician I 31.53$ 5,465.20$ 32.32$ 5,602.13$ 33.13$ 5,742.53$ 33.96$ 5,886.40$ 34.81$ 6,033.73$ 35.68$ 6,184.53$ 36.57$ 6,338.80$ 37.48$ 6,496.53$ 38.42$ 6,660.00$ Maintenance & Operations Technician II 34.69$ 6,012.93$ 35.56$ 6,163.73$ 36.45$ 6,318.00$ 37.37$ 6,477.47$ 38.29$ 6,636.93$ 39.25$ 6,803.33$ 40.23$ 6,973.20$ 41.24$ 7,148.27$ 42.27$ 7,326.00$ Management Analyst I 44.23$ 7,666.51$ 45.34$ 7,858.18$ 46.47$ 8,054.65$ 47.63$ 8,256.00$ 48.82$ 8,462.42$ 50.04$ 8,673.97$ 51.29$ 8,890.81$ 52.58$ 9,113.09$ 53.89$ 9,340.91$ Management Analyst II 48.65$ 8,433.17$ 49.87$ 8,644.00$ 51.12$ 8,860.11$ 52.39$ 9,081.61$ 53.70$ 9,308.65$ 55.05$ 9,541.37$ 56.42$ 9,779.90$ 57.83$ 10,024.39$ 59.28$ 10,275.00$ Management Technician 37.97$ 6,581.47$ 38.92$ 6,746.13$ 39.89$ 6,914.27$ 40.89$ 7,087.60$ 41.91$ 7,264.40$ 42.96$ 7,446.40$ 44.03$ 7,631.87$ 45.13$ 7,822.53$ 46.26$ 8,019.00$ Neighborhood Services Director 95.67$ 16,582.35$ 98.06$ 16,996.89$ 100.51$ 17,421.82$ 103.02$ 17,857.36$ 105.60$ 18,303.81$ 108.24$ 18,761.41$ 110.94$ 19,230.45$ 113.72$ 19,711.21$ 116.56$ 20,204.00$ Negotiated by City Council
Fiscal Year 2026/2027 (Effective 7/5/2026)
ITEM 12.1.

ATTACHMENT 2
Exhibit A to the Resolution

Page 552 of 654 ends

Council Member (monthly stipend) 500.00$
College Intern 19.10$ -$ 19.55$ -$ 20.01$ -$ 20.49$ -$ 20.97$ -$ 21.47$ -$ 21.99$ -$ 22.51$ -$ 23.05$ -$ Engineering Intern 19.10$ -$ 19.55$ -$ 20.01$ -$ 20.49$ -$ 20.97$ -$ 21.47$ -$ 21.99$ -$ 22.51$ -$ 23.05$ -$ Events Attendant 18.95$ -$ 19.43$ -$ 19.92$ -$ 20.43$ -$ 20.95$ -$ 21.48$ -$ 22.03$ -$ 22.59$ -$ 23.16$ -$ Note: In accordance with Resolution #103-2012 and 20-2004, the City Manager is authorized to make title, salary range and classification changes during the fiscal year.

Revision Summary:

Resolution 75-2020; Effective 7-1-2020
Resolution 80-2021; Effective 6-27-2021
Resolution 122-2022; Effective 6-26-2022
Resolution 65-2023; Effective 6-25-2023
Resolution 119-2024; Retroactivley effective 7-7-2024
Resolution 55-2025; Effective 6-22-2025
Resolution xx-2026; Effective 7-5-2026
ITEM 12.1.

ATTACHMENT 2
Exhibit A to the Resolution

Page 553 of 654 ends

ITEM 12.1. ATTACHMENT 3
Exhibit B to the Resolution

EXHIBIT B

ELIGIBLE CLASSIFICATIONS FOR THE EXCEPTIONAL PERFORMANCE BONUS PROGRAM The following classifications are designated as eligible for participation in the City's Exceptional Performance Bonus Program:
• City Manager
• Assistant City Manager
• Administrative Services Director
• Assistant Administrative Services Director – Human Resources • City Clerk
• Chief Technology and Innovation Officer
• Communications and Legislative Affairs Director
• Community Development Director
• Community Services Director
• Economic Development Director
• Neighborhood Services Director
• Public Works Director
Eligibility for participation in the Exceptional Performance Bonus Program does not guarantee the award of a bonus. Any bonus awarded is discretionary, subject to City Manager approval, individual performance, and available funding.

Page 554 of 654 ends

MEMORANDUM

City Council Staff Report - Page 1 of 2

ITEM 12.2.

DATE: June 15, 2026

TO: Honorable Mayor and Council Members

FROM: Micah Runner, City Manager

SUBJECT: A RESOLUTION AUTHORIZING THE CITY MANAGER TO EXECUTE CONTRACT NO. 2026-83 FOR LAW ENFORCEMENT SERVICES

BETWEEN THE COUNTY OF SACRAMENTO AND THE CITY OF
RANCHO CORDOVA FOR A TERM STARTING JULY 1, 2026, AND
ENDING JUNE 30, 2031

RECOMMENDATION

Adopt the Resolution.

RESULT OF RECOMMENDED ACTION

Adoption of the Resolution would allow the County of Sacramento to continue operating as the Rancho Cordova Police Department through June 30, 2031.

BACKGROUND

The City of Rancho Cordova was incorporated on July 1, 2003. Pursuant to Government Code section 57384, the County of Sacramento continued to provide law enforcement services to the city for the remainder of Fiscal Year 2003/04. On July 1, 2004, the city and county entered into an agreement for continued law enforcement services through June 30, 2010. In 2010, both parties agreed to continue the partnership and enter into a new Agreement for Law Enforcement Services. The current agreement has been amended to extend the term four (4) times with an effective current term ending on June 30, 2026.

The new proposed agreement for law enforcement services includes some updated language from the 2010 agreement:
• Length of the Contract - Five (5) years (July 1, 2026 - June 30, 2031) • Incorporation of Data Sharing to support Growing Strong Neighborhoods & city services • Formalized collaboration for media strategy
• Formalized Rancho Cordova Police Department updates/reports from the Police Chief to City Council
• Formalized the Police Chief's participation in the city's Leadership team • Incorporated the ability to provide pay differential for additional positions • Maintained a minimum assignment period for personnel in select positions

Page 555 of 654 ends

City Council Staff Report - Page 2 of 2

The contract provides a partnership between the City of Rancho Cordova and Sacramento County Sheriff's Office to provide comprehensive law enforcement services with the contract outlining the overall service delivery, operational responsibilities, communication protocols and accountability measures. The approval for the service plan that incorporates the service level is adopted biennially with the budget process. The proposed new Agreement would set the term of the agreement for five (5) years to June 30, 2031.

FISCAL IMPACT AND FUNDING SOURCE

The cost of the service plan is incorporated into the city's adopted budgets moving forward. For Fiscal Year 2026-27, the proposed budget is $29,599,367 funded from the general fund and $1,787,038 from the Community Enhancement Fund for the Crime Suppression Unit, Youth Services Officer and the Folsom Olson Zinfandel (FOZ) Officer and approved in the adopted Fiscal Year 2025-27 operating budget.

ATTACHMENT(S)

1. Resolution

2. Exhibit A to the Resolution - Law Enforcement Services Contract No. 2026-83

3. Presentation

Page 556 of 654 ends

ITEM 12.2. ATTACHMENT 1 Resolution No. XX-2026 Page 1 of 2

CITY OF RANCHO CORDOVA

RESOLUTION NO. XX-2026

A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF RANCHO CORDOVA, STATE OF CALIFORNIA, AUTHORIZING THE CITY MANAGER TO EXECUTE AGREEMENT 2026- 83 FOR LAW ENFORCEMENT SERVICES BETWEEN THE COUNTY OF SACRAMENTO

AND THE CITY OF RANCHO CORODVA

WHEREAS, the City of Rancho Cordova incorporated on July 1, 2003; and

WHEREAS, pursuant to Government Code Section 57384, the County of Sacramento continued to provide law enforcement services to the city for the remainder of fiscal year 2003/04; and

WHEREAS, the city and county entered into an agreement on July 1, 2004, for three subsequent years; and

WHEREAS, the city and county entered into a subsequent three year agreement on July 1, 2007, which was automatically renewed for an additional three years; and

WHEREAS, the city and county entered into a subsequent agreement on July 1, 2010, which was extended multiple times for an additional sixteen years; and

WHEREAS, the city and county have agreed to terminate the existing agreement for services that would have expired June 30, 2026 with the execution of this new agreement; and

WHEREAS, the city desires to have the Sacramento County Sheriff's Office ("Sheriff' or "County Sheriff') continue to provide law enforcement services within the city's municipal boundaries; and

WHEREAS, the county, through the County Sheriff, is capable of rendering such law enforcement services under the terms and conditions set forth in this agreement; and

WHEREAS, the city and county are authorized to enter into this Agreement pursuant to Article 1 (commencing with Section 51300) of Chapter 1 of Part 2 of Division 1 of Title 5 of the California Government Code; and

WHEREAS, this Agreement establishes the service level standards for the County Sheriff's performance of law enforcement services within the city's municipal boundaries; and

WHEREAS, the County Sheriff will continue to operate a shared command municipal police force on behalf of the city, utilizing personnel from the Sheriff's Office; and

WHEREAS, as part of this Agreement, the city and county agree that the city will have significant and meaningful input into the selection and continued assignment of personnel from the Sheriff's Office performing services under this Agreement; and

WHEREAS, the Parties wish to enter into Agreement 2026-83 for Law Enforcement Services (Exhibit A) for services from July 1, 2026, through June 30, 2031.

Page 557 of 654 ends

ITEM 12.2. ATTACHMENT 1 Resolution No. XX-2026 Page 2 of 2

NOW, THEREFORE, BE IT HEREBY RESOLVED THE CITY COUNCIL OF THE CITY OF RANCHO CORDOVA does authorize the City Manager to execute Contract No. 2026-83 for Law Enforcement Services between the County of Sacramento and the City of Rancho Cordova in a form approved by the City Attorney.

PASSED AND ADOPTED by the City Council of the City of Rancho Cordova on the 15th day of June 2026 by the following vote:

AYES:

NOES:

ABSENT:

ABSTAIN:

ATTEST:

Garrett Gatewood, Mayor

Stacy Leitner, CMC
City Clerk

Page 558 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 1 of 34

AGREEMENT FOR LAW ENFORCEMENT SERVICES

BETWEEN THE COUNTY OF SACRAMENTO

AND THE CITY OF RANCHO CORDOVA

ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 559 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 2 of 34 Contract No. 2026-83

TABLE OF CONTENTS
RECITALS ……………………………………………………………………………………………………. 4

1. Incorporation of Recitals ………………………………………………………………………….. 5

2. Scope of Services ……………………………………………………………………………………. 5

3. Term ……………………………………………………………………………………………………….8

4. Service Plan ……………………………………………………………………………………………. 8

5. Selection and Assignment of Police Commander …………………………………………. 10

6. Selection and Assignment of Personnel ………………………………………………………. 11

7. Supplemental Enforcement Services by City ……………………………………………….. 12

8. Supervision and Labor Agreements ……………………………………………………………. 12

9. Provision of Labor, Equipment and Supplies ………………………………………………… 13

10. Employment Status of Personnel ……………………………………………………………….. 15

11. Labor Relations ………………………………………………………………………………………. 15

12. Temporary Reassignment During Labor Action of Personnel …………………………… 15 Performing Services Under this Agreement

13. Rules, Regulations, Policies and Procedures ……………………………………………….. 16

14. Scheduling of Shifts …………………………………………………………………………………. 16

15. Reporting Requirements …………………………………………………………………………… 17

16. Training ………………………………………………………………………………………………….. 18

17. City Powers and Enforcement of City Ordinances …………………………………………. 19

18. Mutual Aid ……………………………………………………………………………………………….19

19. Compensation of Services ………………………………………………………………………… 19

20. Invoices and Payment ………………………………………………………………………………. 20

21. Penal Code Section 13823.95 Costs and Booking Costs ………………………………… 23

22. Fines, Forfeitures and Miscellaneous Reimbursements …………………………………. 24

23. Asset Seizures and Forfeitures …………………………………………………………………… 24

24. Complaints …………………………………………………………………………………………….. 25

25. Enhanced Service of Specialized Equipment ……………………………………………….. 25

26. Termination ……………………………………………………………………………………………..26

27. Administration ………………………………………………………………………………………… 27

28. Audit ……………………………………………………………………………………………………… 27

29. Indemniﬁcation ………………………………………………………………………………………..28

30. Insurance ………………………………………………………………………………………………..29

31. Assignment ……………………………………………………………………………………………..29

32. Amendments …………… ………………………………………………………………………………29

33. Integration ……………………………………………………………………………………………….29

34. Construction and Interpretation ………………………………………………………………….29

35. Waiver …………………………………………………………………………………………………….30
ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 560 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 3 of 34

36. Severability …………………………………………………………………………………………….. 30

37. Successors and Assigns …………………………………………………………………………… 30

38. Notices ………………………………………………………………………………………………….. 30

39. Dispute Resolution ………………………………………………………………………………….. 30

40. Data Sharing …………………………………………………………………………………………… 31

ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 561 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 4 of 34

CITY OF RANCHO CORDOVA

AGREEMENT FOR LAW ENFORCEMENT SERVICES

BETWEEN THE COUNTY OF SACRAMENTO

AND THE CITY OF RANCHO CORDOVA

This Agreement (“Agreement”) is made and entered into this ____ day of June, 2026, by and between the County of Sacramento, a political subdivision of the State of California (“County”), and the City of Rancho Cordova, a municipal corporation organized and existing under the laws of the State of California (“City”), collectively referred to as “the Pa r t i e s .”

RECITALS
WHEREAS, the City of Rancho Cordova incorporated on July 1, 2003; and WHEREAS, pursuant to Government Code Section 57384, the County continued to provide law enforcement services to the City for the remainder of ﬁscal year 2003/2004; and WHEREAS, City and County entered into an agreement on July 1, 2004, for three subsequent years; and
WHEREAS, City and County entered into a subsequent three year agreement on July 1, 2007, which was automatically renewed for an additional three years; and WHEREAS, City and County entered into a subsequent agreement on July 1, 2010, which was extended multiple times for an additional sixteen years; and WHEREAS, City and County have agreed to terminate the existing agreement for services that would have expired June 30, 2026 with the execution of this new agreement; and WHEREAS, the City desires to have the Sacramento County Sheriff’s Office ("Sheriff' or "County Sheriff') continue to provide law enforcement services within the City's municipal boundaries; and
WHEREAS, the County, through the County Sheriff, is capable of rendering such law enforcement services under the terms and conditions set forth in this Agreement; and WHEREAS, the City and County are authorized to enter into this Agreement pursuant to Article 1 (commencing with Section 51300) of Chapter 1 of Part 2 of Division 1 of Title 5 of the Government Code; and
WHEREAS, this Agreement establishes the service level standards for the County Sheriff's performance of law enforcement services within the City's municipal boundaries; and WHEREAS, the County Sheriff will continue to operate a shared command municipal police force on behalf of the City, utilizing personnel from the Sheriff’s Office; and ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 562 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 5 of 34 WHEREAS, as part of this Agreement, the City and County agree that the City will have signiﬁcant and meaningful input into the selection and continued assignment of personnel from the Sheriff’s Office performing services under this Agreement.

AGREEMENT
NOW, THEREFORE, in consideration of the mutual promises, conditions, and covenants hereinafter set forth, the City and the County hereby agree as follows:

1. INCORPORATION OF RECITALS. The foregoing recitals are hereby incorporated by reference.

2. SCOPE OF SERVICES.

A. Duties and Functions. The County agrees to have the County Sheriff’s Office provide municipal law enforcement services within the corporate limits of the City, to the extent and in the manner set forth under this Agreement. The services shall encompass duties and functions of the type falling under the jurisdiction of, and customarily rendered by, a city police department under applicable State statutes. Such services shall include: (1) the enforcement of State statutes and City codes and ordinances; (2) patrol and traffic enforcement; (3) investigative services; and (4) such other special services customarily performed by police departments to the extent speciﬁcally set forth in this Agreement.

B. County as Independent Contractor. County enters into this Agreement as, and shall at all times remain as to the City, an independent contractor. The County is not an employee of the City. Nothing in this Agreement shall be construed to be inconsistent with this relationship or status. County shall at all times while performing services under this Agreement conduct itself as an independent contractor and City shall not have the right to control the means and methods by which County provides the services rendered pursuant to this Agreement.

The County shall have no power or authority to bind the City, except as set forth under this Agreement. County shall not incur or have the power to incur any debt, obligation, or liability whatever against City, or bind City in any manner.

C. County Employees, Agents, Contractors or Subcontractors. All employees, agents, contractors or subcontractors hired or retained by the County to perform services under this Agreement are, and at all times shall be, employees, agents, contractors or subcontractors of the County and not of the City. The personnel performing the services under this Agreement on behalf of County shall at all times be under County's exclusive direction and control and the City shall not have the right to control the means and methods by which the County’s personnel, officers, employees, or agents provide the services rendered ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 563 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 6 of 34 pursuant to this Agreement. Neither City nor any of its officers, employees or agents shall have control over the conduct of County or any of County's officers, employees, or agents, except as set forth in this Agreement. County shall not at any time or in any manner represent that it or any of its officers, employees, or agents are in any manner officers or employees of the City, and shall not represent that they are agents of the City of Rancho Cordova except in the limited capacity to perform services under this Agreement.

D. Compensation, Beneﬁts and Claims related to County Employees. The City shall not be responsible, obligated, or liable in any way to pay any salary, wage, compensation, tax, withholding, beneﬁt, injury, illness claims or other claims made against the County and/or the City by any County employee, agent, contractor or subcontractor, or any other person arising from performance of this Agreement. The County shall be solely responsible, obligated, and liable for any and/or all salary, wage, compensation, tax, withholding, beneﬁt, injury, illness or other similar employment related claims made against County and/or the City by any such employees, agents, contractors or subcontractors, or other person arising from performance of this Agreement. The County shall indemnify, defend and hold harmless the City against such claims.

E. Performance of Services under this Agreement as Rancho Cordova Police Department. Any performance under this Agreement shall be by only the County, its employees, agents, contractors, subcontractors or others performing directly at the County’s direction. Notwithstanding the foregoing limitation, the City expects the Sheriff to publicly identify personnel assigned to perform services under this Agreement as members of the Rancho Cordova Police Department. Such identiﬁcation is expected to take the form of patrol cars, uniforms, business cards, stationary, forms and similar items. i. External Communications – Coordination and Authority. The City and County agree to collaborate regarding all external communications, press releases, and media statements concerning Rancho Cordova Police Department operations, including social media content and postings. • The City will manage non-law enforcement/softer side of law enforcement/routine public communications, media relations, and community messaging on behalf of the Department.
• The Sheriff’s Office will manage public communications, press releases, and media statements regarding law enforcement operations, public safety matters, and other official activities.

In circumstances involving imminent public safety needs, time-sensitive operational matters, or other urgent situations, the Sheriff will make ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 564 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 7 of 34 reasonable, good faith efforts to collaborate with the City prior to issuing public communications. When advance collaboration is not practicable, the Sheriff may issue or post factual information as necessary and will notify the City as soon as reasonably practicable in real-time or shortly thereafter.

In all other situations, the Sheriff’s Office will collaborate with the City in good faith in advance of external communications to promote consistency and accuracy. The City and Sheriff’s Office agree to collaborate in good faith on messaging and public information efforts.

The City retains ownership and administrative control of RCPD branding assets and digital platforms, including websites, domain names, and social media accounts, as well as associated content and analytics. The Sheriff’s Office shall have appropriate access to these platforms and may utilize them for official law enforcement communications consistent with this agreement. ii. Social Media Services in the Service Plan. The parties agree that RCPD social media and website is an external communication subject to City coordination and ﬁnal authority under this Section. At the City’s election, the Service Plan shall include Social Media Services delivered by a non-sworn County employee assigned as the RCPD Social Media Coordinator (“Coordinator”). The Coordinator is a County employee and shall be supervised by the RCPD Chief of Police, but shall coordinate on all non-law enforcement external communications (as deﬁned in section E. paragraph i.) with the City’s Communications Manager or designee, coordinate with the Sheriff’s PIO as needed, and comply with City communications policies and applicable law. All RCPD social media accounts, handles, URLs, content, and analytics are City-owned; credentials are administered by the City and provided to County staff for use during the term. The County shall follow City credential, archiving, and records-retention protocols; provide monthly metrics reports; and promptly remove or replace the Coordinator at the City’s written request for documented reasons. Costs for Social Media Services (including the non-sworn position) shall be included in the Service Plan and may be adjusted by mutual written agreement.

3. TERM.

A. Effective Date and Term. This Agreement shall be effective July 1, 2026, and shall continue in force until June 30, 2031, unless terminated earlier pursuant to Section 26 below. The parties indemniﬁcation obligations set forth in Section 29 hereof and the City's obligations for funding and repaying the County's self- insurance program as set forth in Section 30 hereof shall survive the termination and/or expiration of this Agreement.

No later than eighteen (18) months prior to
ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 565 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 8 of 34 the expiration date, the City shall notify the County of its intent to continue this Agreement or pursue an alternative service-delivery method, which notice shall not be unreasonably withheld, delayed, or conditioned.

B. Recission of July 1, 2010 Agreement. The City and County have agreed to terminate the existing agreement for the contract with an effective date of July 1, 2010.

4. SERVICE PLAN.

A. Preparation and Submission of Service Plan. In support of the City's preparation of its annual budget, and as a means of establishing appropriate levels of service under this Agreement, the Sheriff shall prepare and submit by April 1st of each year during the term of this Agreement, a proposed Service Plan for the next ﬁscal year. The estimated cost of performing the services described in the proposed Service Plan will be included in such plan. The proposed Service Plan will be prepared in consultation with the City Manager, and/or the City Manager's designee (hereinafter "City Manager").

B. Contents of Service Plan. The Service Plan includes two components: (1) The Goals & Performance Measures [see Attachment A], and (2) the Staffing & Budget Plan (separately adopted each ﬁscal year).

C. Goals & Performance Measures. The Goals & Performance Measures for this Agreement are included as Attachment A. The Sheriff’s Office will work together with the City to implement appropriate systems and tools to measure and evaluate the performance activities listed in Attachment A by September 30, 2026.

i. Quarterly Reporting. Effective at the end of the ﬁrst quarter of this Agreement, the outcomes or results for all Performance Measure that can be measured via current systems shall be provided to the City Manager on a quarterly basis.

ii. Modiﬁcation of Goals & Performance Measures. The City Manager and Sheriff by mutual agreement can modify Attachment A during the term of this Agreement.

D. Staffing & Budget Plan. A Staffing & Budget Plan will be prepared by the Sheriff’s Office on an annual basis. The County shall provide law enforcement services for ﬁscal year 2026-2031 at the levels speciﬁed in the Staffing & Budget Plan as approved by the City Manager and the Sheriff or the Board of Supervisors as required by the County. The Staffing & Budget Plan will be developed based on the outcomes desired in the Goals & Performance Measures subject to ﬁscal ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 566 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 9 of 34 constraints.

i. Annual Staffing & Budget Plan. The Sheriff’s Office shall annually provide the City a Staffing & Budget Plan that will detail the deployment of resources consistent with the speciﬁc performance measures and outcomes described in the Goals & Performance Measures. The budget for each Fiscal Year during the term of this Agreement shall be adopted by the City Council (by adoption of the relevant ﬁscal year operating budget) and approved in writing by the Sheriff and the County Executive. Once the Staffing & Budget Plan is established, the Sheriff agrees to and is responsible for the implementation of the Staffing & Budget Plan in such a manner as to substantially comply with the scope and cost of services set forth therein.

ii. Modiﬁcation of Staffing & Budget Plan. Consistent with this Section, the Sheriff has the discretion to modify the Staffing & Budget Plan after obtaining the written agreement of the City Manager.

E. Adoption of Service Plan. The parties shall use reasonable efforts to adopt an updated Service Plan, as well as the estimated cost for performance of such plan, by June 15th of each year, commencing July 1, 2026. The updated Service Plan and the compensation for such services shall be incorporated into this Agreement by means of an adopted Service Plan for the new ﬁscal year, which shall be approved by the City Manager and signed by both the City Manager and the Sheriff. In the event of any delay in the adoption of an annual Service Plan and estimated cost pursuant to this section, the County is authorized to continue providing services pursuant to the previously adopted Service Plan until such time as a new Service Plan is adopted as set forth above. The City shall continue to pay the County for all costs incurred by County in providing services pursuant to such previously adopted plan as set forth in Sections 19 and 20 below.

F. Adjustment of Staffing Levels. The City Manager shall have ﬂexibility to adjust staffing levels or position classiﬁcations and related budget based on the determination of changing and legitimate needs, unless such changes increase the staffing and or budget in which case the change needs to be approved by the Board of Supervisors. The City Manager will not request adjusting staffing up and down based on seasonal effects. Changes to the Service Plan shall occur within 90 days from the date of request from the City Manager. In case Board of Supervisors approval is required, the Sheriff Department will bring the modiﬁcation to a Board of Supervisors meeting in a timely manner.

The rendition of the services performed by the Sheriff’s Office, the standards of performance, the discipline of personnel, and other matters incident to the performance of such services and the control of personnel so employed shall ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 567 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 10 of 34 remain with the Sheriff. In the event of a dispute between the parties to this Agreement as to the extent of the duties and functions to be rendered hereunder, or level of services or manner of performance of such services, the Sheriff and the City shall meet and confer to resolve such disputes.

5. SELECTION AND ASSIGNMENT OF POLICE COMMANDER/CHIEF

A. Selection of Police Commander/Chief. The Sheriff shall provide to the City a list of at least three persons within the Sheriff’s Office whom the Sheriff believes to be appropriate for serving as the City's Police Commander or Chief ("Commander'). The City Manager shall, at his/her discretion, select one of the persons identiﬁed by the Sheriff or request the Sheriff to supply several additional names for consideration and possible selection. The City Manager shall identify from the original or additional list of names provided by the Sheriff a person to serve as the City's Police Commander. Subject to the ultimate control of the Sheriff under the terms of this Agreement, the Police Commander shall perform the traditional role of a municipal Police Commander at the direction of the City for no less than three (3) years.

B. Reassignment of Police Commander. The City Manager may request reassignment of the Police Commander at any time. The Sheriff and City Manager shall meet and confer regarding the request within ten (10) days after the Sheriff’s receipt of the request. Subject to Section 5(A) of this Agreement and reasonable notice (preferably of at least forty-ﬁve (45) days), the Sheriff shall likewise have the absolute and unqualiﬁed right to reassign the Commander to other duties within the Sheriff’s Office. Should the Sheriff reassign the Commander, the Sheriff shall provide alternative names to the City Manager for review and selection as replacement Commander, consistent with the provisions of Section 5(A) of this Agreement. The City Manager shall have the absolute and unqualiﬁed right to have the Sheriff reassign the persons serving as management personnel for the City upon thirty (30) days written notice.

Subject to reasonable notice (at least thirty (30) days), the Sheriff shall have the absolute and unqualiﬁed right to reassign these management personnel to other duties within the Sheriff’s Office

C. Assignment of Management Personnel. The Police Commander shall select his/her management personnel to work with the Commander for the City. For purposes of this provision, management personnel shall be deﬁned as personnel within the Sheriff’s Office with a civil service classiﬁcation of lieutenant or higher. These management personnel shall be assigned to the City.

The City Manager may request reassignment of the management personnel at any time. The Sheriff and City Manager shall meet and confer regarding the request within ten (10) days after the Sheriff’s receipt of the request. The City Manager shall have the absolute and unqualiﬁed right to have the Sheriff ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 568 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 11 of 34 reassign the persons serving as management personnel for the City upon thirty (30) days written notice. Subject to reasonable notice (at least thirty (30) days), the Sheriff shall have the absolute and unqualiﬁed right to reassign these management personnel to other duties within the Sheriff’s Office.

6. SELECTION AND ASSIGNMENT OF PERSONNEL.

A. Selection of Personnel. The Commander shall work collaboratively with the City Manager in developing criteria for the selection of personnel from the Sheriff’s Office to be assigned to perform law enforcement services for the City pursuant to this Agreement. The City shall have the unqualiﬁed right to select from the top ten (10) personnel that are interested and available to serve in the position being recruited for with the additional ﬂexibility that the City can hire personnel beyond the top ten list for personnel with identiﬁed, specialized skills and/or training related to the position. If the City is recruiting for more than one of the same position at one time, the City will receive the right to select from ﬁve additional interested and available personnel beyond the ﬁrst position for each additional position to be ﬁlled (i.e. if the City is recruiting for two officer positions the qualiﬁed, interested list shall consist of the top ﬁfteen personnel). The City Manager has the right to designate any City staff to interview personnel at any rank or class. The ultimate authority with respect to the assignment of such personnel shall rest with the Sheriff.

B. Minimum Year Requirement. It is understood and agreed that line-level personnel assigned to the City will normally be so assigned for a minimum period of three (3) years. Mid-level and supervisory personnel shall serve at least two (2) years. Notwithstanding this normal commitment, such personnel may be assigned to other duties within the Sheriff’s Office for purposes of promotional opportunities or career advancement. The Sheriff shall provide the Commander and the City Manager reasonable notice (when possible of at least thirty (30) days unless such notice is waived by the City Manager) of any person's reassignment from the City.

C. Additional Personnel Provisions – Longevity and Pay Differentials. To promote continuity, effectiveness, and institutional knowledge, personnel assigned to the Homeless Outreach Team (HOT), Problem Oriented Policing (POP) Team, Crime Suppression Unit (CSU) Team, Traffic (Motors) Team and select Administrative Staff (collectively, “Specialty Assignments”) shall ordinarily serve a minimum of three (3) years in their designated Specialty Assignment, unless reassignment is requested by the City or is necessitated by performance, promotion, or other good cause. The City may authorize pay differentials for Specialty Assignments as part of the annually adopted Service Plan. Nothing in this subsection limits the Sheriff’s ultimate authority with respect to assignment decisions under this Agreement, or alters any applicable civil service or labor obligations.

ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 569 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 12 of 34

D. Reassignment of Personnel. The City Manager shall have the right to request the Commander to reassign any personnel assigned to the City, pursuant to this Agreement, upon notice to the employee by the Commander, or his/her designee, of the reason for the transfer. The City Manager may request reassignment of personnel at any time. The Sheriff and City Manager shall meet and confer regarding the request within ten (10) days after the Sheriff’s receipt of the request. Such reassignment may be to another position within the services provided under this Agreement ("City Contract Service") or may be to County service and shall take place within thirty (30) days.

E. Onboarding Program. The Sheriff and City shall jointly develop and implement a standardized onboarding program for all personnel newly assigned under this Agreement. The onboarding program shall include orientation to City policies, community standards, performance expectations, partnership protocols, data and reporting systems, and any Specialty Assignment responsibilities to ensure consistent service philosophy and operational integration. Costs associated with onboarding shall be incorporated into the Service Plan consistent with the training cost provisions of this Agreement.

F. Commander and Management Personnel. The provisions of Section 6 (a) - 6(c) shall not apply to the Commander or management personnel as deﬁned in Section 5 hereof.

G. No Reassignment due to Layoffs. All personnel, including management, shall be retained within the City Contract Service and not subject to reassignment due to seniority in the event of a Sheriff’s Office layoff. This provision shall not apply if the employee is the subject of a layoff.

7. SUPPLEMENTAL ENFORCEMENT SERVICES BY CITY . The City shall have the right to augment non-sworn law enforcement services as it deems necessary outside the scope of this Agreement.

8. SUPERVISION AND LABOR AGREEMENTS.

A. Labor and Employment. Subject to the provisions of Section 5 and 6 of this Agreement, the Sheriff shall have the responsibility for supervision of law enforcement services, hiring of personnel, establishing employee standards of performance for individual personnel, assignment of personnel, determining and effecting discipline, determining required training, maintaining personnel ﬁles, and other matters relating to the performance of employee services and control of personnel. In the event of a dispute between the Parties as to the manner of performance by personnel of required services, the City shall be consulted and a mutual determination thereof shall be made by the Sheriff and ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 570 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 13 of 34 the City Manager. In recognition of the Sheriffs professional expertise in the area of law enforcement, it is agreed that, in any unresolved dispute related to personnel, the Sheriff shall have the ﬁnal and conclusive determination as between the Parties hereto subject to the provisions of Sections 5 and 6 under this Agreement.

B. Bargaining Agreements. The City acknowledges that the County is legally obligated to comply with bargaining agreements covering County employees performing services pursuant to this Agreement and, as a result, agrees that the County's performance under this Agreement shall be subject to any such bargaining agreements.

C. Service During Labor Actions. The County shall be obligated to provide service comparable to that in the unincorporated area and other cities the County contracts with to provide law enforcement services regardless of any event of a strike, work slowdown, "blue ﬂu" or any other type of job action (formal or informal) by County employees assigned to perform services under this Agreement. Any Labor Action does not excuse the County from providing such a comparable level of service during the duration of the Labor Action. In the event of any Labor Action the County will have to use replacement workers, management personnel or make other arrangements to furnish such comparable level of services for the duration of the Labor Action.

9. PROVISION OF LABOR, EQUIPMENT AND SUPPLIES.

A. County Resources and Equipment. For the purpose of performing the services required by this Agreement, the County shall furnish all necessary labor, supervision, equipment, communications facilities, and supplies necessary to maintain the level of service set forth in the adopted Service Plan.

B. Annual Inventory of City Owned Equipment. The County shall conduct an Annual Inventory of all City owned equipment and present an Inventory List separately identifying federally purchased items. The annual inventory list will be provided to the City Finance Department by July 15th of each year reporting to assets owned as of June 30th. All purchases of City owned equipment shall follow City purchasing requirements. The City Finance Director shall be authorized signer for police grants at all times. If city owned property is sold, proceeds shall be reported and remitted to the City.

C. City Provided Supplies. The City shall be responsible for supplying any special supplies, stationery, notices, forms or similar items that it requires to be issued with the City logo. All such items shall be approved by the Police Commander and provided at the City's sole cost and expense.

ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 571 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 14 of 34 D. Use of Existing County Resources. In order to provide the law enforcement services set forth in this Agreement, the County may use existing County resources including, but not limited to, County facilities, equipment, general supplies, and non-law enforcement support personnel and, in addition, may acquire new resources. An appropriate charge for the use of such County resources is included in the County's charges set forth in the adopted Service Plan.

E. Acquisition of New Equipment. To the extent that the County acquires new equipment and supplies for its use in providing services under this Agreement, the City will pay for the cost of such acquisition through the above-referenced charges. Upon the expiration or termination of this Agreement, the County shall be entitled to retain any equipment or supplies acquired by it to provide law enforcement services to the City pursuant to this Agreement. In return for the County's right to retain such equipment and supplies for its own use, the City shall be entitled to a credit for any fair market value of such property and supplies as of the date of termination or expiration of the Agreement. This credit shall be accounted for in the ﬁnal reconciliation of costs and payments.

F. City's Right to Augment County Resources. The City shall have the option of acquiring equipment and supplies and furnishing them to augment the resources used by the County for the County's use in providing services pursuant to this Agreement, either through direct procurement or grants awarded to the Rancho Cordova Police Department. Upon expiration or termination of this Agreement, the City shall be entitled to retain any equipment or supplies acquired by the City.

G. Relocation of Operations. The County shall not relocate any of its operations to perform services under this Agreement without the prior express written agreement of the City. For purposes of this Agreement, "operations" shall mean "the principal place of operation within the City, e.g. the Police Station. "

H. Prior Agreement Before Obtaining Equipment or Services. The County shall not obtain any equipment or services for use within the City or to provide services under this Agreement without the prior express written agreement of the City or as speciﬁcally set forth in the Service Plan. The City shall have no obligation to reimburse for any cost of equipment obtained by the County prior to the execution of this Agreement or without the express written agreement of the City having been ﬁrst obtained unless speciﬁcally set forth in the Service Plan.

10. EMPLOYMENT STATUS OF PERSONNEL.

A. Status of County Personnel. Any person employed by the County for the performance of services pursuant to this Agreement shall remain employees of ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 572 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 15 of 34 the County on special assignment to the City for purposes of this Agreement, shall at all times be under the direction and control of the County, and shall not be considered employees of the City. All persons employed by County to perform services pursuant to this Agreement shall be entitled solely to the rights and privileges afforded to County employees and shall not be entitled, as a result of providing services hereunder, to any additional rights or privileges that may be afforded to City employees.

B. Salaries, Wages, Compensation and Beneﬁts. City shall not be liable for the direct payment of any salaries, wages, compensation or other beneﬁts to any County employee performing services pursuant to this Agreement, or for compensation or indemnity to any County employee for injury or sickness arising out of his or her employment.

11. LABOR RELATIONS. County shall be responsible for negotiating and administering all labor relations agreements and personnel rules and procedures between County and its employees rendering services pursuant to this Agreement.

12. TEMPORARY REASSIGNMENT DURING LABOR ACTION OF PERSONNEL PERFORMING SERVICES UNDER THIS AGREEMENT.

A. Use of Mutual Aid. In the event of a Labor Action by County employees or other emergency, the City understands and agrees that the County may use the Mutual Aid (as deﬁned in Section 18, of this Agreement) to establish police services within the City at a level comparable to that it was receiving prior to the labor action or emergency, at the discretion of the Sheriff. Prior to utilizing such mutual aid, the Sheriff shall advise the Police Commander of the need for mutual aid and seek the input of the Police Commander with respect to the Sheriff's proposed use of such mutual aid.

B. Temporary Reduction of Service. The City understands that if law enforcement personnel assigned to provide services under this Agreement are utilized outside the City for Mutual Aid under these circumstances the City may be temporarily provided with a reduced level of service. If such reduced level of service results from a Labor Action by County employees, City will be invoiced a reduced amount for services based on the percentage reduction in the level of services provided. The County agrees that it will continue to provide service to the City comparable to that in the unincorporated area and other cities the County contracts with to provide law enforcement services and further agrees that the City, at its option, may secure law enforcement services from another public agency during the duration of any Labor Action or other emergency. The County and the Sheriff further agree under these circumstances to utilize resources reasonably available from the unincorporated area before utilizing ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 573 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 16 of 34 City contracted for resources.

13. RULES, REGULATIONS, POLICIES AND PROCEDURES.

A. County Procedures. County personnel assigned to provide services under this Agreement are required to abide by all rules, regulations, policies and procedures applicable to employees of the Sheriff’s Office ("County Procedures"), a true, accurate and current copy of which is incorporated into this Agreement by this reference and shall be available at all times in the office of the Police Commander and the City Manager's office.

B. City Procedures. County personnel performing services pursuant to this Agreement may be requested by the City Manager to comply with speciﬁed city procedures ("City Procedures"). County personnel will comply with such City Procedures, except where such City Procedures may conﬂict with County Procedures or the requirements of this Agreement, or both.

C. Conﬂicts between Procedures or Agreement. The provisions of this Agreement shall take precedence over any conﬂicting City Procedures or County procedures. The Sheriff and the City Manager shall confer should any conﬂict exist between City Procedures and County Procedures. However, in light of the Sheriff's expertise with respect to law enforcement procedures and their impact upon the operations of the Sheriff’s Office, the Sheriff shall retain as related to speciﬁc law enforcement issues the ﬁnal authority to determine how conﬂicts between City Procedures and County Procedures will be resolved as long as such resolution is consistent with the implementation and cost of the Staffing & Budget Plan.

14. SCHEDULING OF SHIFTS. All patrol and supervisory shifts shall be established by the Commander after consultation with the City Manager. Personnel assigned to each shift may work varying and different times, and may be deployed to other shifts, at the discretion of the Commander. Any long-term shift deployment change will not be implemented by the Commander without ﬁrst consulting with the City Manager.

15. REPORTING REQUIREMENTS.

A. Quarterly Reports. The County shall provide the City Manager with accurate and timely quarterly reports in a mutually agreeable format. Such reports will include the following items: crime statistics speciﬁc to the corporate limits of the City, progress reports and signiﬁcant activities related to the adopted Goals & Performance Measures, any major incidents occurring during the reporting period and signiﬁcant staffing issues. In the event the results of the Performance Measures are not presented to the City Manager within sixty (60) days of the ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 574 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 17 of 34 conclusion of each quarter, the City may charge a penalty equal to 10% of the next regularly scheduled monthly payment

B. Monthly Reports. In addition, the Commander shall report monthly the number of instances where contract personnel respond to calls for service or an event outside the city boundaries as well as when personnel assigned to areas outside of the City boundaries respond to calls or an event within the boundaries.

C. City Council Presentations. Upon request of the City Manager or City Council, the Police Commander/Chief shall provide updates and reports to the City Council, including presentations on performance, staffing, and signiﬁcant initiatives.

D. Coordination Meetings. The Police Commander/Chief and appropriate staff shall attend a monthly coordination meeting with City executive leadership to review operations, staffing, reporting, and strategic priorities. The Police Commander/Chief (or designee) shall attend weekly City leadership team meetings and additional City meetings as reasonably requested by the City Manager.

E. Reports Requested by City Manager. As reasonably requested and directed by the City Manager, County shall also provide the City Manager with reports pertaining to issues the City Manager determines are either relevant to the County's performance under the terms of this Agreement and/or the Service Plan, or which are reasonably related to the City's interests concerning law enforcement activities within the City.

F. Annual Reports. The County shall submit an annual report to the City Manager and City Council highlighting services provided during the prior year and setting forth objectives for the upcoming year.

G. Statistics to State and Federal Agencies. The County shall provide statistics for State and Federal agencies that collect the information on a jurisdictional basis.

H. Information for Grants. The County shall also be responsible for preparing on the City's behalf any crime statistics or other reports necessary to comply with Federal or State grants including but not limited to Byrne Grants, U.S. Homeland Security Grants, and COPS program grant requirements which provide funding for any law enforcement services provided under this Agreement. Such reporting shall be sufficient to result in any allocation of funds from any state or federal funding program to the City of Rancho Cordova as its own individual police department including but not limited to Byrne Grant allocations and COPS grant allocations.

ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 575 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 18 of 34

16. TRAINING.

A. Required Experience and Training. The County agrees to provide personnel with the required experience and training to perform the services speciﬁed in this Agreement.

B. Request to Increase Number of Personnel by City. If, during the term of this Agreement, the City increases the number of personnel allocated hereunder, the City agrees to reimburse the County for "All Costs" incurred in training all levels of personnel hired or promoted by the County as a result of such increased staffing allocation as set forth in the adopted Service Plan. "All Costs" as used in this Section 16 mean direct training costs, such as tuition, training materials and travel expenses associated with training, as well as associated costs such as overtime or other relief while personnel are unable to perform normal services due to training, on a per person basis.

C. Specialized Training. The City shall also be responsible for All Costs associated with any specialized training (e.g. traffic enforcement) required for personnel directly assigned to perform services under this Agreement as set forth in the adopted Service Plan.

D. Reimbursements for Training. Any reimbursement received by the County from the State Commission on Peace Officer Standards and Training, or from any other non-County funding source, for training provided to personnel assigned to perform services hereunder shall be credited to the City, prorated on a per person basis, unless already factored into the allocated costs set forth in the adopted Service Plan.

E. Reassignment of Trained Personnel. If any personnel providing service under this Agreement and trained at the expense of the City, as set forth in this Section, is reassigned within 24 months after the training has commenced to perform for the County duty not covered by this Agreement, and was not reassigned at the request of the City, the County shall pay to the City All Costs of training for that employee paid by the City on a pro-rata basis, based on the actual number of months of reassignment during the 24 month period, for training that is required for a municipal policing agency.

17. CITY POWERS AND ENFORCEMENT OF CITY ORDINANCES.

A. Power to Enforce Local Ordinances. In performing services pursuant to this Agreement, the County shall have all the powers of the City and shall receive the full cooperation and assistance of the City, its officers, agents and employees in enforcing rules, regulations, codes and ordinances of the City pursuant to this Agreement.

ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 576 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 19 of 34 B. Validity of City Rules, Regulations, Code and Ordinances. The City shall be responsible for the validity of its rules, regulations, codes and ordinances, including any ordinances or codes incorporated by reference in the City's ordinances or code. The City shall defend, hold harmless, and indemnify the County, its officers, agents and employees with respect to any claim or action challenging the validity of any City ordinance or with respect to any claim or action that any arrest, citation or other action taken under an invalid City ordinance.

18. MUTUAL AID.

A. Mutual Aid Plan. The State of California Law Enforcement Mutual Aid Plan provides the basis for emergency law enforcement operational deployment procedures within the statewide mutual aid system. The Parties to this Agreement agree to abide by such plan in support of the mutual aid system.

B. Use of Personnel Performing Services Under this Agreement. The City understands and agrees that the Sheriff may use employees performing services under this Agreement to meet the needs under a request for Mutual Aid. The Sheriff shall consult with the Police Commander regarding the City's level of participation in Mutual Aid requests. The County/Sheriff agrees to utilize resources reasonably available from the unincorporated area before utilizing City contracted for resources.

19. COMPENSATION FOR SERVICES.

A. Compensation for Law Enforcement Services. The City shall pay the County for providing the law enforcement services set forth in this Agreement. The costs of these services shall be set forth in the Service Plan. All such costs for services provided hereunder will be segregated and recorded within a separate index established within the County's ﬁnancial system. For each Fiscal Year, the total budgeted cost for providing law enforcement services pursuant to this Agreement shall not exceed the amount set forth in the Service Plan. The Service Plan shall contain a speciﬁc breakdown of the budgeted cost of the various components of these law enforcement services. A budgeted amount for each of the subsequent ﬁscal years during the term of this Agreement shall be developed pursuant to the procedure set forth in Section 4 hereof. The amount paid by the City will not exceed the amount stated in the Service Plan, except in the case of an emergency as deﬁned by Section 20(E).

B. Adjustment of Rates and Staffing Levels. In the event that the City and the County are unable to agree on an updated Service Plan, the existing Service Plan shall continue in effect and the County may adjust the rates set forth in such Service Plan up to a maximum cost escalation not to exceed the CPI for the ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 577 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 20 of 34 State of California. The County reserves the right to adjust staffing levels to achieve this cost maximum. The City will select the positions to be eliminated in this process. The City shall be provided with written notice of any proposed change in the rates to be charged to the City at least sixty (60) days prior to submittal of the proposed change to the County Board of Supervisors for adoption. During this period, the City shall be afforded the opportunity to review the proposed change with County staff. The City shall thereafter be notiﬁed of the adoption of any new rates to be charged to the City and the date upon which such new rates shall become effective. If City fails to appropriate or expend the funds necessary to support the level of service provided under the existing Service Plan, the County shall reduce the level of service consistent with the amount of funds the City makes available to support law enforcement services.

No change in funds beyond an annual CPI adjustment or positions may occur until both parties agree to a change.

C. Pursuit of State and Federal Grants. County staff is encouraged to aggressively pursue any and all state and federal grant opportunities, however, any grant accepted for the city must be accepted by the City Finance Director or their designee. The County agrees to administer the grant in conformance with federal and state guidelines and regulations and by the City's internal control requirements.

20. INVOICES AND PAYMENT.

A. Payment of Actual Costs. Except as otherwise speciﬁed in this Section, the City shall pay the County for all actual costs incurred by County in providing the law enforcement services set forth in this Agreement. Such costs, which are set forth in the Service Plan, shall include both direct costs and indirect overhead costs allocated to the Sheriff’s Office as part of the countywide cost allocation plan as approved by the State Controller's office ("A-87 Plan"). All such costs for services provided hereunder will be segregated and recorded within a separate index established within the County's ﬁnancial system. A speciﬁc breakdown of the budgeted cost of the various components of these law enforcement services is set forth in the Service Plan.

B. Change in Cost Allocation Methodology. At any time during the term of this Agreement, the City may propose that an indirect cost allocation methodology other than A-87 be used in determining the indirect costs payable by the City to the County pursuant to this Agreement. Upon receipt of such request in writing and a written description of the proposed alternative methodology, the County shall be obligated to meet and confer with the City in a good faith effort to reach a mutually acceptable agreement with respect to the implementation of an indirect cost allocation methodology other than A-87. Any change in the indirect cost allocation methodology from A-87 to a mutually agreeable alternative shall ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 578 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 21 of 34 be implemented in the form of an amendment to this Agreement that shall be approved by the City Council and the Board of Supervisors.

C. Compensation Schedule. Compensation by the City to the County for the law enforcement services rendered under this Agreement shall be paid on a monthly period basis during the term of this Agreement at the rate of one-twelfth (1/12) of the annual cost of providing such services as set forth in the Service Plan. The City shall make this payment to the County in equal monthly installments beginning on July 1, 2026. The parties understand and agree that the Service Plan for ﬁscal year 2026-2027 represents estimated costs for the entire ﬁscal year.

D. Invoices by County. The County shall, no later than the end of the each month, provide a report to the City for each monthly period detailing the County's cost of providing law enforcement services pursuant to this Agreement during the preceding monthly period.

E. Costs in Excess of Agreed Upon Amount. If in any month during the term of this Agreement the County's actual costs exceed the agreed costs as set forth in the Service Plan, the County shall, within thirty (30) days, state in detail the cause(s) of the excess and set forth a plan for completing the Service Plan at the agreed service levels and agreed cost receipt. If the excess is due to an "Emergency Beyond the Reasonable Control of the County and the City" the City and the County shall agree upon a method for the City to pay for those excessive costs incurred by "Emergency Beyond the Control of the County and the City. " The phrase "Emergency Beyond the Reasonable Control of the County and the City" shall mean situations where because of ﬂood, earthquake, or other disaster or emergency within the City of Rancho Cordova, the Commander determines that a form of emergency response over and above that contemplated by the Service Plan is required.

F. Timing of Payment; Late Fee. The City agrees to make monthly payments within thirty (30) days of invoice receipt. The County may assess a 10% late fee for payments received sixty (60) days or more delinquent.

G. Government Code Section 51350. In conformance with Government Code Section 51350 the County agrees to not charge the City any portion of the cost allocated in the A- 87 Plan which are attributable to services made available to all portions of the County. In the course of negotiating the terms and conditions of this Agreement, the City and County have agreed to implement the provisions of Government Code Section 51350 as set forth in subsections (i)-(v) below.

i. Service Plan. The Service Plan each year sets forth all the direct and indirect costs that the County will charge to the City for law enforcement services during ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 579 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 22 of 34 any ﬁscal year. The City will have a full and complete opportunity to review those costs and the methodology used in calculating them. Each Annual Service Plan shall be subject to negotiation and mutual agreement consistent with the provisions of Section 4 of this Agreement.

ii. City's Review of Methodology in Service Plan. In approving any Service Plan during the term of this Agreement, the City agrees and acknowledges that it has had a full and complete opportunity to review the costs set forth in any such Service Plan, together with the methodology used in calculating them, and, based upon such review, is satisﬁed that such costs are appropriately charged by the County and paid by the City.

iii. Legal Action Regarding Methodology. The City shall have the right to challenge the legal validity of any direct or any indirect costs under any approved Service Plan (pursuant to Section 4 of this Agreement) charged by the County so long as such challenge is ﬁled within one hundred eighty (180) days after the Service Plan goes into effect. The City may challenge the methodology in, the charges made under, and any payments made pursuant to the continuing Service Plan as not in compliance with law, including but not limited to Government Code section 51350.

iv. Legal Action Regarding Services Not Received. Nothing in this Section shall preclude the City from challenging any charge by the County for law enforcement services on the basis that the service for which the charge was assessed was not actually provided by the County.

v. Limited to Contractual Relationship under Agreement. The provisions of this Section are intended to be limited to the contractual relationship between the City and the County during the term of this Agreement only and shall not be construed so as to bind or otherwise limit the City with respect to any legal rights that it may seek to exercise under Government Code Section 51350 outside the scope of this Agreement or with any other Agreement the City may have with the County.

H. Actual Costs Less than Costs Paid by City. If at the end of the Service Plan quarter the County's costs were less than the costs paid by the City, the County shall adjust the next monthly billing to the City by the difference. If at the end of the Service Plan quarter the County's costs were more than the costs paid by the City, the County shall adjust the next monthly billing by the difference.

I. Risk-Management Cost Adjustments and Pension-Obligation-Bond Costs. The County shall provide the City with not less than ninety (90) days’ written notice of any anticipated changes to risk-management, insurance, or self-insurance cost allocations applicable to this Agreement. The Parties shall meet and confer ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 580 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 23 of 34 in good faith to review the methodology and ﬁscal impacts prior to inclusion in the subsequent ﬁscal-year Service Plan. Nothing herein modiﬁes the Parties’ commitments regarding indirect cost allocations or Government Code Section 51350.

21. PENAL CODE SECTION 13823.95 COSTS AND BOOKING COSTS.

A. Penal Code Section 13823.95. Subject to Penal Code Section 13823.95, and any amendment thereto, the City shall be responsible for all costs charged pursuant to Penal Code Section 13823.95 (costs incurred by a qualiﬁed health care professional, hospital, or other emergency medical facility for the examination of the victim of a sexual assault under speciﬁed conditions) related to offenses alleged to have taken place in the City. These Penal Code Section 13823.95 charges shall be billed separately and represent costs to be paid by the City in excess of its obligations set forth in Sections 18 and 19, above. Such charges shall be paid by the City within thirty (30) days of the City's receipt of an invoice from the County.

B. Booking Costs. The City shall also be responsible for the payment of booking costs as set forth in the Service Plan. The City's responsibility to pay for booking costs shall be subject to, and comply with, State law related to booking costs.

However, nothing in this Agreement shall be construed as preventing the City from seeking reimbursement for such booking charges from the person arrested. In recognition of the cost to the City of paying booking charges to the County pursuant to this Agreement, the County and the Sheriff agree to take the following steps with respect to the subject of booking costs:

i. Support Reimbursement Efforts. The County and the Sheriff will support any efforts by the City to seek legislation to provide for State reimbursement of booking charges paid by any city pursuant to a law enforcement services agreement with a county, and

ii. Cite and Release Policy. The City of Rancho Cordova's Police Commander has the authority to implement what he deems in his reasonable discretion to be a prudent cite and release policy.

22. FINES, FORFEITURES AND MISCELLANEOUS REIMBURSEMENTS.

A. Fines and Forfeitures of Bail. Fines and forfeitures of bail pursuant to Penal Code Section 1463 et seq. resulting from services performed under this Agreement shall be distributed as though the employees performing services under this Agreement were employees of the City. Any reimbursement received by the County from any non-County funding sources for services charged to the City under this Agreement shall be credited to the City; less any mutually agreed ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 581 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 24 of 34 upon County administrative costs directly associated with obtaining or processing the reimbursement.

B. Federal or State Grant Reimbursement. Any funds received by the County on behalf of the City or for the beneﬁt of the City shall be credited to the City. The County will credit City with City's reasonable estimate of fair share of Byrne Grant funding or other Federal or State grant funding applied for and awarded to Sacramento County on behalf of the Rancho Cordova Police Department.

23. ASSET SEIZURES AND FORFEITURES.

A. Assets Seized within the City. When assets are seized in the City by or with the support of personnel performing services under this Agreement, and such assets are subsequently forfeited to the Sheriff, the forfeited assets shall be shared with the City, as set forth below, for purposes of augmenting law enforcement services within the City. The sharing and use of forfeited assets under this Section shall be subject to approval of the forfeiting agency.

B. Use of Assets to Augment Law Enforcement Services within the City. When assets are seized as set forth in Section 23(A), the Sheriff shall apply to the forfeiting agency for the return of assets to the County. In the application, the Sheriff shall specify the percentage of assets returned to the County that are proposed to be used to augment law enforcement services in the City. The City Manager may provide recommendations for the distribution of assets seized within the City. Prior to the submissions of any such applications, the Sheriff shall advise the City Manager of the distribution of assets that will be proposed in the application. The distribution proposed by the Sheriff shall be based upon applicable State and Federal guidelines pertaining to asset forfeitures, the provisions of this Section, and any applicable memorandum of understanding between the City and the County. Assets that are returned to the County by the forfeiting agency with approval to be used to augment the City's law enforcement services shall be used by the City and the County solely for such purpose. If the forfeiting agency attaches speciﬁc conditions to the use of such assets, the City and the County shall comply with such conditions. The Sheriff and the City Manager shall determine the speciﬁc use to be made of such assets consistent with any conditions imposed by the forfeiting agency.

C. Seized with the City by Personnel Serving City. In those cases in which assets are seized within the City by personnel assigned to the City pursuant to this Agreement, without the involvement of other law enforcement personnel, and in which the seizure is the result solely of activities self-initiated by such personnel in response to a call for service within the City, the Sheriff shall apply to have those assets that are subject to distribution to the Sheriff, pursuant to Health and Safety Code Section 11489, to be used to augment the City's law ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 582 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 25 of 34 enforcement services.

D. Seized within the City by Personnel Serving both City and County. In those cases where assets are seized within the City by both County personnel assigned to the City pursuant to this Agreement and other law enforcement personnel not so assigned, the Sheriff shall determine the appropriate percentage of the total forfeited assets that shall be proposed to be used to augment the City's law enforcement services. The Sheriff shall determine such percentage based upon the circumstances of the seizure and the pro rata involvement of the various personnel.

24. COMPLAINTS. County agrees to handle and respond to complaints regarding law enforcement service provided under this Agreement in a courteous and timely manner. Complaints shall be processed and appropriate records maintained consistent with applicable law and established Sheriff’s Office procedures for addressing citizen complaints. Disclosure of information relative to complaints and any associated internal investigations shall be made only to the extent prescribed by applicable law. The City of Rancho Cordova through its City Manager and/or Commander shall be entitled to information relative to complaints, and any associated internal investigations regarding services performed under this Agreement to the extent permissible by law, as well as action taken and disposition dates.

25. ENHANCED SERVICES OR SPECIALIZED EQUIPMENT.

A. Request by City for Enhanced Law Enforcement Services. At the written request of the City Manager, the Sheriff, at his/her sole discretion, may provide, consistent with the procedures set forth in this Section, law enforcement services within the City in addition to those contemplated in the Service Plan ("Enhanced Law Enforcement Services"). If the Sheriff determines that it is appropriate to provide such Enhanced Law Enforcement Services and there is sufficient staffing available, the type, time and place of such Enhanced Law Enforcement Services shall be agreed upon by the City Manager and the Sheriff.

B. Cost of Enhanced Law Enforcement Services. The Sheriff shall determine the personnel and equipment required to provide such Enhanced Law Enforcement Services and the budgeted cost for such Enhanced Law Enforcement Services.

Upon the written concurrence of the City Manager and the County Executive as to this budgeted cost, the Sheriff may proceed to provide such Enhanced Law Enforcement Services and the City shall pay the cost of such Enhanced Law Enforcement Services as agreed to by the City Manager.

C. Invoice and Payment of Enhanced Law Enforcement Services. The County shall submit a separate invoice or invoices for such Enhanced Law Enforcement ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 583 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 26 of 34 Services. Such invoice or invoices shall be due and payable within thirty (30) days of receipt by the City.

D. Special Equipment. If, during the term of this Agreement, items of special equipment ("Special Equipment") are necessary to support Enhanced Law Enforcement Services within the City that fall outside the services set forth in the Service Plan, the City may furnish such Special Equipment or authorize the County to obtain such Special Equipment. In either case, all costs associated with providing and maintaining such Special Equipment shall be borne by the City. Any such Special Equipment shall meet applicable County speciﬁcations.

Title to any Special Equipment purchased pursuant to this provision shall remain vested with the City. If the City elects not to provide Special Equipment, including but not limited to the authority under Government Code section 7070 et. seq., the County shall be authorized to modify or discontinue the performance of Enhanced Law Enforcement Services for which the Special Equipment is necessary.

26. TERMINATION.

A. Termination Without Cause. Either Party may not terminate this Agreement without cause. No later than 18 months prior to the expiration date of this agreement, City will notify County of its intent to continue this contract or pursue an alternative service delivery method.

B. Termination due to Breach. If the County fails to perform a material element of this Agreement, and further fails to correct such breach after being given a written notice speciﬁcally describing the breach and a reasonable opportunity to cure, the City shall be entitled to terminate this Agreement without further cause upon not less than ninety (90) days prior written notice to the County.

C. Termination for Lack of Reconciliation Payment. If any undisputed reconciliation payment required to be made by either Party pursuant to Sections 19 and 20 is not received by the Party to whom it is due within the prescribed time, and the defaulting Party fails to cure such breach by making the undisputed reconciliation payment within ﬁfteen (15) business days after receipt of a delinquency notice from the other Party, the Party to whom the undisputed payment is owed shall be entitled to terminate this Agreement without further cause upon not less than ninety (90) days prior written notice to the other Party.

D. Payments During Notice Period. In the event of the termination of the Agreement pursuant to this Section, the City shall pay the County for all costs of services rendered through and until the effective date of termination.

E. Transition Plan. In the event that a notice of intent to terminate the Agreement is ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 584 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 27 of 34 given, the City and Sheriff will negotiate, in good faith, a transition plan which will provide an orderly transition of service to maintain the same level of service and equipment during the remainder of the term.

F. Hiring of Additional Law Enforcement Officers. If either Party provides notice of its intent to terminate this Agreement pursuant to this Section, after such notice of termination, the City shall have the right to hire law enforcement officers and to otherwise augment law enforcement services.

G. Police Reports and Files. Upon termination of the Agreement, the County shall give the City any and all Police Reports and other activity reports to the extent permitted by law. Whenever possible the reports and logs shall be provided in a digital format usable by the City; the City shall pay the County all reasonable expenses to duplicate these records.

H. Surplus Equipment and Supplies. The County shall give the City the right of ﬁrst refusal to acquire surplus equipment and supplies used in this contract to include but limited to: office furnishings, vehicles and equipment installed in such vehicles and personal equipment for officers including, but not limited to, guns, vests, uniforms, communications gear, utility belts and similar safety equipment.

27. ADMINISTRATION. The City Manager shall administer this Agreement on behalf of the City and the Sheriff shall administer this Agreement on behalf of the County.

28. AUDIT.

A. Keeping of Records. The County shall maintain adequate ﬁnancial records during the term of this Agreement to document its charges to the City, and report to the City in a manner acceptable to the City. Records for each ﬁscal year during the term of this Agreement shall be maintained by the County for a three (3) year period after the City's receipt of the reconciliation for that ﬁscal year.

B. Access to Records. County shall provide free access to the representatives of City, or its designees, at reasonable times, to all records relating to performance of this Agreement. The City shall have the right to examine and obtain an independent audit of all records relating to performance of this Agreement of the County at any reasonable time and as often as the City desires. County shall permit City to make transcripts there from as necessary, and shall allow inspection of all work, data, documents, proceedings, and activities related to this Agreement. The City shall have the unrestricted right to Audit the County's records related to the Agreement.

ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 585 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 28 of 34 C. Audit by State Auditor. Pursuant to Government Code Section 8546.7, the City and the County shall be subject to examination and audit by the State Auditor for a period of three (3) years after ﬁnal payment by the City to the County pursuant to this Agreement. The City and the County shall retain all records relating to performance of this Agreement for this three (3) year period, except that records pertaining to any audit then in progress, or any claims or litigation, shall be retained beyond such three (3) year period until ﬁnal resolution of such audit, claim or litigation.

29. INDEMNIFICATION. The County and its officers, agents and employees shall not be deemed to have assumed any liability for the negligence or other act or omission of City or any of its officers, agents or employees, for any dangerous or defective condition of any public street or work or property of the City, or for any illegality or unconstitutionality of the City's ordinances. The City shall indemnify and hold the County and its officers, agents, employees and independent contractors harmless from any claim or liability whatsoever, based or asserted upon the condition of any public street or work or property of the City, upon the illegality or unconstitutionality of any City ordinances, or upon any act or omission of the City or its officers, employees subcontractors and independent contractors related to this Agreement, for property damage, bodily injury or death or any other element of damage of any kind or nature, and the City shall defend at its expense including attorney fees, the County and its officers, agents, employees and independent contractors in any legal action or claim of any kind based upon such condition of any such public street or work or property, such alleged illegality or unconstitutionality of a City ordinance, or such alleged acts or omissions. With respect to public streets, works or property, City and County agree that nothing in this Section is intended to require City to indemnify and hold harmless the County for any claim or liability arising prior to the incorporation of City on July 1, 2003.

County shall indemnify and hold the City and its officers, agents, employees and independent contractors harmless from and against any loss, damage, claim or liability whatsoever, based or asserted upon any act or omission of the County or its officers, agents, employees, subcontractors and independent contractors related to this Agreement, for property damage, bodily injury or death or any other element of damage of any kind or nature, and the County shall indemnify and defend at its expense, including attorney fees, the City and its officers, agents, employees and independent contractors in any legal action or claim of any kind based upon such alleged acts or omissions.

30. INSURANCE. Parties acknowledge that County is a self-insured entity. County has and shall maintain during the term of this Agreement insurance coverage for worker's compensation, general liability, automobile liability, and professional liability. County shall provide City with certiﬁcates of self-insurance, or other ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 586 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 29 of 34 documentation, which details the scope, limits, and forms of County's self- insurance coverage. County agrees to provide City with written notiﬁcation of any changes in coverage applicable to this Agreement and shall do so within thirty (30) days of the change or within ten (10) days in the event the change results in the termination of coverage(s) applicable to this Agreement. In the event County is unable to maintain insurance coverage(s) applicable to this Agreement, City shall have the right to terminate this Agreement.

31. ASSIGNMENT. Neither Party hereto shall assign, subcontract, or transfer any interest in this Agreement, or any duty hereunder, without the prior written consent of the other Party, and no assignment shall be of any force or effect whatsoever unless and until the other party furnishes such written consent.

Because of the unique nature of the services contemplated by this Agreement, consent of either Party may be withheld by either Party, within that Party's sole discretion, whether deemed reasonable or not.

32. AMENDMENTS. This Agreement may be modiﬁed or amended, or any of its provisions waived, only by a subsequent written agreement, approved by the Sacramento County Board of Supervisors and the Rancho Cordova City Council and executed by each of the Parties hereto, which amendment shall then be attached to this Agreement and become an integrated part of this Agreement.

33. INTEGRATION. This Agreement and the subjects addressed herein supersede all prior negotiations, representations or agreements, oral or written, which may be related to the subject matter of this Agreement, including any "interim" agreements that the parties may have entered into.

34. CONSTRUCTION AND INTERPRETATION. It is agreed and acknowledged by the Parties hereto that the provisions of this Agreement have been arrived at through negotiation, and that each of the Parties has had a full and fair opportunity to revise the provisions of this Agreement and to have such provisions reviewed by legal counsel. Therefore, the normal rule of construction that any ambiguities are to be resolved against the drafting Party shall not apply in construing or interpreting this Agreement.

35. WAIVER. The waiver, at any time by any Party, of any of its right with respect to a default or other matter arising in connection with this Agreement, shall not be deemed a waiver with respect to any subsequent default or other matter.

36. SEVERABILITY . The invalidity, illegality, or unenforceability of any provision of this Agreement shall, at the option of either Party, render the other provisions unenforceable, invalid or illegal, provided that such invalidity materially affects the respective rights and obligations of the parties.

ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 587 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 30 of 34

37. SUCCESSORS AND ASSIGNS. This Agreement shall bind and inure to the beneﬁt of the respective successors and assigns of the Parties hereto, provided that the required written consent has been obtained pursuant to Section 31 above.

38. NOTICES. Any notice, demand, request, consent, or approval that either Party hereto may, or is required to, give the other shall be in writing and shall be deemed to have been received three (3) days after deposited in the United States mail, ﬁrst class postage prepaid, and addressed as follows:

TO COUNTY:

Sacramento County Sheriff
4500 Orange Grove Avenue
Sacramento, CA 95841

TO CITY:

City Manager
City of Rancho Cordova
2729 Prospect Park Drive
Rancho Cordova, CA 95670

Either Party hereto shall have the right to serve any notice by personal delivery and change the address at which it will receive such communications by giving ﬁfteen (15) days advance notice to the other party.

39. DISPUTE RESOLUTION. Prior to initiating any legal proceedings with respect to the performance of this Agreement, the Parties shall ﬁrst engage in a good faith effort to resolve any claims, disputes, or other matters in question between them by mediation. The costs of the mediation shall be borne equally between the parties and shall be held in Sacramento, California.

40. DATA SHARING.

A. Automatic Data Exchange. The Parties shall implement automatic data transfer between County systems and the City’s systems, including but not limited to Growing Strong Neighborhood reporting and traffic accident reporting, to support operational management, performance measurement, and public transparency. The Sheriff shall provide the City with timely, machine-readable data extracts in a mutually agreed format and frequency.

B. Privacy, Security and Compliance. All data sharing shall comply with applicable laws and standards, including conﬁdentiality, records retention, evidence integrity, and information security requirements. The Parties shall adopt a data- governance protocol specifying data elements, access rights, retention ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 588 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 31 of 34 schedules and points of contact.

C. Costs and Support. Any costs associated with initial conﬁguration, integration, and maintenance of automated data transfer shall be identiﬁed in the Service Plan. The Parties shall collaborate to ensure data accuracy and continuity despite system upgrades or vendor changes.

ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 589 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 32 of 34 IN WITNESS WHEREO F, the parties hereto have executed this Agreement the day of year ﬁrst written above.

CITY OF RANCHO CORDOVA SACRAMENTO COUNTY

___________________________ ___________________________ Micah Runner, City Manager Chair of the Board of Supervisors of Sacramento County, California

Date:________________________ Date:_________________________

Attest:

______________________________
City Clerk
Date:_________________________

Approved as to Form:
______________________________
Adam Lingren, City Attorney
Date:_________________________

ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 590 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 33 of 34

ATTACHMENT A
Goals and Performance Measures
City Goals for Police Services

1. Ensuring Order and Civility in Public Places

2. Reduction of Crime and Victimization

3. Holding Offenders Accountable

4. Efficient and Effective Use of the (Operational and Financial)

5. Using Authority and Force Fairly and Effectively

6. Quality Service/Customer Satisfaction
Performance Measures for Each Goal
Ensuring Order and Civility in Public Places
• Neighborhood revitalization activities (POP projects, changes in property values)* • Traffic Safety
• Accident rates; fatal, injury and non-injury
• Traffic citations
• Traffic calming measures
• Special program (DUI, seatbelt enforcement, child restraint) • School safety*
• Reported crimes in schools
• Public perception of safety in schools
• Special programs (gang education, youth mentoring)
• Park Safety
• Usage of space
• Reported crime in parks
• Public perception of safety in parks
Reduction of Crime and Victimization
• Part 1 and Part 2 crime rates per capita; citywide, by beats, and neighborhoods • Reporting of crime, and fear of crime; use of alternative measures such as victimization, fear level, domestic violence, and public health surveys)* • Reduction in repeat calls for service (by category and speciﬁc locations) • Crime prevention initiatives (measuring crime reduction, target hardening programs)* • Crime Prevention through Environmental Design (CPTED)* • Crime statistics related to HOT, POP , and CSU.

Holding Offenders Accountable
• Arrest data - felony and misdemeanor
• Filing rates*
• Conviction rates*
• Clearance rates for crime category
ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 591 of 654 ends

Agreement for Law Enforcement Services between Contract: 2026-83 the County of Sacramento and the City of Rancho Cordova Page 34 of 34 • Gang related enforcement in court and probation conditions • Parole and probation searches and arrests
• Diversion programs (drug courts, family violence treatment programs, etc.)* Efficient and Effective Use of the (Operational and Financial) • Response time to emergency (life threatening and crimes in progress) calls for service • Response time to non-emergency calls for service
• Alternative methods of service delivery
• Civilian employees
• Volunteers
• Self-reporting (Internet, mail)
• Telephonic response
• Referrals
• Percentage of discretionary patrol time available*
• Resources used for repeat calls for service (by type and location - such as false alarms, domestic violence, chronic nuisances, etc.)*
• Financial accountability
• Meeting budget goals of overtime management
• Risk management (vehicle accident rates, lawsuits)*
• Problem-solving initiatives*
• Community goals (community engagement in goals setting, beat meetings)* • Formal program evaluations*
Using Authority and Force Fairly and Effectively
• Use of force rates (officer involved shootings, less than lethal force, physical force) • Complaints related to force and abuse of authority
• Other citizen complaints
• Officer initiated activity levels (vehicle stops, suspicious person stops) • Conﬁdence/trust levels between community and police department* • Racial proﬁling data*
• Pursuit analysis
Quality Service/Customer Satisfaction
• Customer satisfaction surveys*
• Service related complaints
• Feedback systems regarding public perceptions
• Community participation in problem identiﬁcation and solutions* • Accessibility
*Denotes measures that are non-traditional or not commonly employed by police agencies. 6368433.1
ITEM 12.2.

ATTACHMENT 2
Exhibit A to the Resolution

Page 592 of 654 ends

CONTRACT FOR LAW ENFORCEMENT SERVICES
June 15, 2026
ITEM 12.2.

ATTACHMENT 3

Page 593 of 654 ends

SERVICE CONTRACT MODEL
Contract provides the partnership between the City and the Sacramento County Sheriff’s Office to provide comprehensive law enforcement services.

Contract outlines:
• Overall Service Delivery
• Operational Responsibilities
• Communication Protocols
• Accountability Measures
The specific cost and level of service is outlined and approved in the City’s budget process biennially.
• FY 2026/27 Service Plan was approved by Council through the budget p
rocess at the cost of $29,600,000 plus Measure H supported positions (CSU/FOZ/Youth Services) at the cost of $1,770,000
ITEM 12.2.

ATTACHMENT 3

Page 594 of 654 ends

SERVICE MODEL OVERVIEW
Sacramento County Sheriff
Provides:
• Patrol
• Emergency Response
• Investigations
• Traffic Enforcement
• Specialty Services, such as
C
ommunity Policing (POP),
Homeless Outreach Team (HOT),
Crime Suppression Unit (CSU)
• Administration & Support
S
ervices
• Operates as an Independent
Co
ntractor
• Personnel remain County
emp
loyees under Sheriff’s Office
City of Rancho Cordova Receives:
• Flexibility to scale services
an
nually with approval of the
Annual Service Plan that occurs
with the Budget
• Access to specialized units from
th
e Sheriff, such as Helicopter,
Ruck, Specialized Investigations,
etc.
• Reduced administrative costs
r
elated to Human Resources,
Pensions, Payroll, Risk
Management
• Personnel turnovers are filled
q
uicker
ITEM 12.2.

ATTACHMENT 3

Page 595 of 654 ends

UPDATED TERMS
• Length of Contract – 5 years (July 1, 2026 – June 30, 2031) • No later than 18 months prior to expiration date, the City to notify the County of intent to modify the service delivery method • Termination due to Breach in contract – not less than 90 days • Incorporated Da ta Sharing to support Growing Strong Neighborhoods & City Services • Formalized co llaboration for the media strategy
• Formalized R ancho Cordova Police Department updates/reports from the Police Chief to City Council on an as needed basis
• Formalized the Police Chief’s participation in the City’s Leadership team • Incorporated the ability to provide pay differential for additional positions • Maintained a minimum assignment period for personnel in select positions ITEM 12.2.

ATTACHMENT 3

Page 596 of 654 ends

BENEFITS OF THE CURRENT SERVICE MODEL
• Sheriff provides training (POST), discipline and
o
perational polices
• Staffing of RCPD positions are filled quicker than
n
ormal HR processes
• RCPD g ets first pick of all trained staff
• City d oes not pay for Academy or hiring
process
Operational Expertise & Availability of Staff
Sheriff Onboarding Process
Hiring Process
3-4 Months for background
6 months for Law
Enforcement Academy
Patrol Training
25 Weeks
ITEM 12.2.

ATTACHMENT 3

Page 597 of 654 ends

Rancho Cordova City CouncilJune 15, 2026

Rancho Cordova City Council
June 15, 2026